BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M02 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 2.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 2.0 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.2 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 2.0 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +3 Query: 222 LILPKITTLMETATNLSTTVHI-TWTLP 302 L+LPK+T +E L+ TV I TW P Sbjct: 518 LVLPKLTLEVEEWNPLTDTVPIHTWIHP 545 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 2.0 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 280 CILRGPSPRPTLLQAYPLS-LVLAVGSKEYL 369 C+LR +P P +L+A S VL V ++ +L Sbjct: 1106 CVLRASTPAPVVLEAVHASRRVLIVLTRNFL 1136 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 6.2 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = -2 Query: 744 GGGXXGXXGXXXGXEXGXXGXXXXXGGGGGG 652 G G G G G GGGGGG Sbjct: 21 GPGSSSAGGVVTGASGGSIVVGANNGGGGGG 51 Score = 21.8 bits (44), Expect = 8.1 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 309 DLTSSLPPFPGARGGK 356 DL LPP P RGG+ Sbjct: 370 DLDEPLPPPPPIRGGE 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,031 Number of Sequences: 438 Number of extensions: 5646 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -