BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L23 (873 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39605| Best HMM Match : zf-TRAF (HMM E-Value=5.3e-39) 29 3.8 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_34575| Best HMM Match : zf-TRAF (HMM E-Value=2.5e-15) 28 8.7 >SB_39605| Best HMM Match : zf-TRAF (HMM E-Value=5.3e-39) Length = 684 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +1 Query: 241 IRHMAYRSTSCDVIGCNCSKRCGSRDTLQKFKHHGSKE 354 IR + C + +CS CG+R ++ H SK+ Sbjct: 134 IRSLVGHLAECKFVSADCSNSCGARIQKRRMSEHTSKD 171 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +2 Query: 548 NGVQHFEVQPETFTCESIGEPKVTL-SSDLNSALEKDSGTNS 670 N + H +++PE CESI ++ L L L+KD S Sbjct: 467 NNIVHLDLKPENIMCESINSNQIKLVDFGLARELKKDEEVKS 508 >SB_34575| Best HMM Match : zf-TRAF (HMM E-Value=2.5e-15) Length = 262 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +1 Query: 241 IRHMAYRSTSCDVIGCNCSKRCGSRDTLQKFKHHGSKE 354 +R + C + +CS CG+R ++ H SK+ Sbjct: 49 LRKLQGHLAECKFVSADCSNSCGARIQKRRMSEHTSKD 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,849,685 Number of Sequences: 59808 Number of extensions: 543335 Number of successful extensions: 1061 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 995 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1060 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -