BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L19 (849 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 25 2.2 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 24 5.1 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 24 5.1 AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 24 6.7 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 23 8.9 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 25.4 bits (53), Expect = 2.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 7 FXTTHYREFLRFSRDDSMPLAHVAIAVEGAGW 102 F H R RDD PL+H +A+EG W Sbjct: 95 FSYFHDRNLYYNERDD--PLSHHLVAMEGTRW 124 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 226 RGCPLRQHALGMKHYWNHHL 167 RG PL +LGM Y NHHL Sbjct: 41 RGFPL---SLGMSPYTNHHL 57 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 226 RGCPLRQHALGMKHYWNHHL 167 RG PL +LGM Y NHHL Sbjct: 41 RGFPL---SLGMSPYTNHHL 57 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.8 bits (49), Expect = 6.7 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -2 Query: 371 PSVTDVQSFIHSXWMLYNISSSCRLSATK*MPHRPVSL*QVLKD 240 PSVTDV H ++ Y+ + +P P+ + Q+ +D Sbjct: 127 PSVTDVCERAHRSFLCYHQHYGYLRKTDRYVPKTPLEMKQIQQD 170 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.4 bits (48), Expect = 8.9 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -3 Query: 487 DASVVAEHLTTNIFTDQEW 431 D ++ + +TTN++ +QEW Sbjct: 62 DVNLKNQIMTTNVWVEQEW 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,791 Number of Sequences: 2352 Number of extensions: 12850 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -