BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L18 (913 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0668 + 19737875-19738073,19738157-19738304,19738315-197384... 30 2.2 06_01_0464 - 3300356-3300673,3300757-3301244,3301315-3302137 29 6.8 >10_08_0668 + 19737875-19738073,19738157-19738304,19738315-19738453, 19738521-19738664,19739502-19739561,19740058-19740190, 19740669-19740865 Length = 339 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%) Frame = +1 Query: 142 RMTSIDYTKVTIKEKEL-----YTPPXGRSSLCIVEWFNNELQVCGSVSGR 279 R TSI +T+K ++L + PP S ++EWF +++Q G V R Sbjct: 215 RKTSITGHSLTMKYRKLCIRGYWDPPEDISKYAMIEWFKSQMQEAGIVDLR 265 >06_01_0464 - 3300356-3300673,3300757-3301244,3301315-3302137 Length = 542 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -2 Query: 381 CGTKYGGPPISTSLASPVNPGD 316 C ++GGPP +S+A PV G+ Sbjct: 200 CQVRWGGPPSKSSIADPVLTGE 221 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,619,836 Number of Sequences: 37544 Number of extensions: 364604 Number of successful extensions: 916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -