BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L17 (887 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 5.4 At5g44780.1 68418.m05488 expressed protein low similarity to SP|... 28 7.2 At3g45510.1 68416.m04914 zinc finger (C3HC4-type RING finger) fa... 28 7.2 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 28 7.2 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 28 7.2 At1g76010.1 68414.m08825 expressed protein 28 7.2 At1g72110.1 68414.m08335 expressed protein 28 7.2 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.5 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 5.4 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +2 Query: 209 PYIVN--PPKDYNPNGNG-YEPIDNGAYYVDPPQGRPYFKPTPFP 334 PY+ N PP Y+P+ Y+ Y PP PY+ PTP P Sbjct: 612 PYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPP--PYYSPTPKP 654 >At5g44780.1 68418.m05488 expressed protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 723 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 233 DYNP-NGNGYEPIDNGAYYVDPPQGR 307 +Y+P NG Y P G +Y PPQG+ Sbjct: 530 NYSPQNGGHYGPAQFGQWYPGPPQGQ 555 >At3g45510.1 68416.m04914 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 257 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 655 CNHYKLQ*NXLTTTI--AFILCFRFXGEVWXVFSA 753 C YK++ N TTT+ +LC R E W + S+ Sbjct: 200 CKEYKMKGNKATTTVWLYVLLCMRNPMEAWRLLSS 234 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 167 NADSGNGYEPIDNRP-YIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTP 328 NA G P+ + P + + PP ++ G P+ G Y PPQ P TP Sbjct: 257 NAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGGFPYGAPPQQLPSAPGTP 311 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 233 DYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 334 DY P+ Y+P N Y PP Y +P +P Sbjct: 101 DYQPSPYPYQPQGNFGAYGPPPPHYSYQEPAQYP 134 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 28.3 bits (60), Expect = 7.2 Identities = 26/63 (41%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +2 Query: 173 DSGNGYE-PIDNRPYIVNPPKDYNPNGNG-YE-PIDNGAYYVDPPQG-RPYFKPTPFPGA 340 D G GY+ P ++R Y D P G G Y+ P G Y D PQG R Y P P Sbjct: 220 DGGYGYDAPHEHRGYDDRGGYDAPPQGRGGYDGPQGRGGY--DGPQGRRGYDGP---PQG 274 Query: 341 RGG 349 RGG Sbjct: 275 RGG 277 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -1 Query: 422 NSYEILKYIVNTLFRY*-FSKIFFTSHREHQGK 327 N+ I++ I NTL + FS I T H EH+GK Sbjct: 41 NASTIVEGIKNTLINHPRFSSILVTGHGEHKGK 73 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +2 Query: 224 PPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 334 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,556,072 Number of Sequences: 28952 Number of extensions: 303464 Number of successful extensions: 703 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -