BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L08 (1044 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0080 + 587674-588510 42 8e-04 02_05_0686 - 30900748-30902167,30903442-30904742 40 0.002 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 40 0.004 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 39 0.006 08_01_0202 - 1638978-1639571 39 0.008 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 39 0.008 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 38 0.010 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 38 0.013 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 38 0.013 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 38 0.013 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 38 0.017 11_01_0133 + 1121392-1122731,1123417-1123858 38 0.017 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 38 0.017 03_01_0515 - 3864796-3865425 38 0.017 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 37 0.023 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 37 0.023 07_03_1136 + 24218601-24218734,24218769-24219906 37 0.030 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 37 0.030 06_03_0790 - 24636805-24637770 36 0.040 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 36 0.040 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 36 0.040 02_04_0400 - 22608519-22608844,22609044-22609122 36 0.040 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 36 0.040 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 36 0.053 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 36 0.053 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 36 0.070 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 36 0.070 07_03_0890 - 22332768-22333382 36 0.070 12_02_1174 - 26696869-26698191 35 0.093 08_01_0059 - 394001-394708 35 0.093 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 35 0.093 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 35 0.093 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 35 0.093 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 35 0.12 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 35 0.12 09_02_0543 + 10427321-10428315,10428440-10429154 34 0.16 06_01_0178 + 1386981-1387505 34 0.16 06_01_0145 + 1092764-1093351 34 0.16 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 34 0.16 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 34 0.21 12_01_0135 + 1042889-1044255,1045368-1045809 34 0.21 08_01_1038 + 10540185-10540709 34 0.21 05_05_0135 - 22626163-22626198,22626391-22626441,22626516-226266... 34 0.21 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 34 0.21 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 34 0.21 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 33 0.28 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 33 0.28 07_03_0527 - 19085828-19086319 33 0.28 05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094,450... 33 0.28 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 33 0.28 02_01_0584 - 4326072-4326094,4326306-4326885 33 0.28 09_03_0145 - 12749288-12751510 33 0.37 06_02_0175 - 12624608-12625297 33 0.37 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 33 0.37 04_04_0057 + 22410167-22411330 33 0.37 04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463,871... 33 0.37 03_06_0599 + 34984869-34985319,34986581-34987563 33 0.37 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 33 0.37 02_04_0021 + 18975992-18976408 33 0.37 01_02_0031 + 10364487-10365407 33 0.37 01_01_0715 - 5542648-5543219,5543352-5543544 33 0.37 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 33 0.50 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 33 0.50 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 33 0.50 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 33 0.50 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 33 0.50 11_01_0066 - 536281-537196,537397-537452 33 0.50 10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904... 33 0.50 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 33 0.50 09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155... 33 0.50 09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763... 33 0.50 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 33 0.50 08_02_1256 + 25645085-25645396 33 0.50 08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695... 33 0.50 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 33 0.50 08_02_0193 - 14073103-14073246,14073332-14073481,14073571-140736... 33 0.50 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 33 0.50 06_03_1326 - 29355467-29355817 33 0.50 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 33 0.50 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 33 0.50 05_06_0078 - 25412770-25413852 33 0.50 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 33 0.50 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 33 0.50 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 33 0.50 04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479... 33 0.50 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 33 0.50 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 33 0.50 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 33 0.50 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 33 0.50 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 33 0.50 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 33 0.50 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 32 0.66 11_01_0359 - 2731522-2732346 32 0.66 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 32 0.66 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 32 0.66 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 32 0.66 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 32 0.66 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 32 0.66 07_03_0560 + 19479597-19480667 32 0.66 06_01_0125 + 970746-970967,971126-971226,971897-972026,972108-97... 32 0.66 05_05_0313 - 24026142-24026708 32 0.66 04_01_0034 - 401208-402923 32 0.66 03_05_0630 + 26260159-26260272,26260520-26260894 32 0.66 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 32 0.66 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 32 0.66 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 32 0.66 01_05_0490 + 22672241-22674679 32 0.66 01_05_0423 + 22032940-22033695 32 0.66 12_02_0299 - 17051570-17052474,17053542-17053755 32 0.87 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 32 0.87 07_03_1751 - 29215074-29216270 32 0.87 07_03_1533 + 27523811-27524710 32 0.87 07_01_0633 - 4735298-4735485,4736083-4736114,4736203-4736297,473... 32 0.87 07_01_0516 - 3850252-3852870 32 0.87 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 32 0.87 05_05_0154 - 22774503-22774652,22774738-22774968,22775508-227756... 32 0.87 04_04_1413 - 33386049-33386339 32 0.87 04_04_1126 + 31095651-31096115 32 0.87 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 32 0.87 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 32 0.87 02_05_0149 + 26290236-26290880 32 0.87 01_01_0570 - 4231100-4232560 32 0.87 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 31 1.1 08_02_1615 + 28257275-28258428,28258523-28259144 31 1.1 08_02_1553 + 27835320-27835364,27836853-27836966,27837062-278374... 31 1.1 08_02_0937 + 22801526-22802461 31 1.1 06_02_0271 + 13618149-13618297,13618311-13618560 31 1.1 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 31 1.1 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.1 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 31 1.1 03_01_0023 + 198414-198968 31 1.1 01_06_0046 + 25943183-25943590 31 1.1 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 31 1.1 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 31 1.1 01_01_0046 - 331758-332627 31 1.1 02_02_0183 + 7576901-7576908,7577666-7578176 29 1.2 12_02_0644 - 21463629-21463916,21464147-21464253,21465164-21465362 31 1.5 12_01_0841 - 7873458-7874225 31 1.5 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 31 1.5 10_08_0216 - 15942379-15942852,15942956-15943033 31 1.5 09_02_0603 - 11150739-11150746,11150791-11151340 31 1.5 09_02_0223 + 5977138-5977459,5979842-5980842 31 1.5 08_02_0839 + 21693348-21694853 31 1.5 07_03_0559 + 19475893-19476783 31 1.5 07_03_0154 + 14509979-14512033 31 1.5 06_03_1363 - 29576265-29577575 31 1.5 06_02_0127 + 12140843-12140966,12141170-12141567 31 1.5 06_02_0126 + 12130409-12130532,12131015-12131373 31 1.5 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 31 1.5 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.5 05_04_0011 + 17139322-17139451,17139552-17140174 31 1.5 04_04_1542 - 34264994-34265331,34266195-34267029 31 1.5 04_03_0904 + 20717005-20718087 31 1.5 03_03_0139 + 14769393-14769764,14770113-14770193,14770537-14770737 31 1.5 02_05_0407 + 28715332-28715385,28715528-28715680,28715810-287158... 31 1.5 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 31 1.5 01_01_0073 + 555485-556315 31 1.5 05_07_0219 - 28474661-28475146,28475979-28476644 28 1.9 12_02_1219 + 27096477-27096590,27096704-27097078 31 2.0 11_06_0292 - 22015603-22015716,22015774-22016163 31 2.0 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 31 2.0 09_06_0125 - 21011757-21012428 31 2.0 09_04_0430 + 17502387-17503505 31 2.0 09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443,404... 31 2.0 08_01_0134 + 1067826-1068158 31 2.0 07_03_1636 + 28290642-28291574 31 2.0 07_03_1382 - 26170563-26170631,26171151-26171843 31 2.0 06_03_1506 + 30641428-30642168 31 2.0 06_03_0696 + 23617687-23617851,23618838-23619536 31 2.0 04_03_0925 - 20856628-20856690,20856786-20856845,20856924-208570... 31 2.0 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 31 2.0 02_03_0367 + 18220099-18220905 31 2.0 02_01_0035 - 220036-221419,222050-222801 31 2.0 01_06_0146 + 26969011-26969995,26970878-26970930 31 2.0 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 31 2.0 01_01_0656 + 5013609-5014256 31 2.0 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 30 2.6 11_01_0621 - 4981070-4981136,4982906-4983825 30 2.6 10_08_0236 + 16078162-16078731 30 2.6 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 2.6 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 30 2.6 08_02_0602 + 19183549-19184919 30 2.6 07_03_0558 + 19461369-19462448 30 2.6 07_03_0177 - 14770777-14772045 30 2.6 05_07_0031 - 27183252-27183317,27183542-27184282 30 2.6 05_05_0334 + 24156532-24156565,24156681-24156782,24157145-241572... 30 2.6 05_03_0458 + 14280953-14281866,14281964-14282912 30 2.6 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 30 2.6 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 30 2.6 03_05_0252 - 22403504-22404676 30 2.6 03_04_0231 + 19050105-19050567,19051376-19052648,19052743-19054171 30 2.6 03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539,525... 30 2.6 02_03_0279 + 17250347-17252098 30 2.6 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 30 2.6 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 30 2.6 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 30 2.6 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 30 3.5 11_06_0610 - 25449085-25453284 30 3.5 11_04_0246 - 15311912-15312481 30 3.5 10_07_0161 - 13674631-13675433,13675793-13675862 30 3.5 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 30 3.5 08_02_0796 - 21300251-21300373,21300846-21301721 30 3.5 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 30 3.5 07_03_1065 + 23711677-23711837,23711859-23712180,23713071-23713277 30 3.5 07_01_0862 - 7172083-7172931 30 3.5 06_03_1310 + 29238644-29240260 30 3.5 06_03_0502 + 21493442-21494341 30 3.5 06_01_0486 - 3455030-3455770 30 3.5 05_07_0217 - 28469229-28469798 30 3.5 05_02_0122 - 6840840-6841307 30 3.5 05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 30 3.5 04_04_1049 + 30414545-30414596,30414732-30414853,30415121-304151... 30 3.5 04_04_0679 + 27214577-27215023 30 3.5 04_03_1022 - 21778315-21779007 30 3.5 03_06_0642 + 35239658-35240083,35240167-35240238,35240305-352409... 30 3.5 03_06_0346 - 33287761-33287895,33288418-33288489,33288577-332886... 30 3.5 03_05_0928 + 28888405-28889121 30 3.5 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 30 3.5 03_02_0738 - 10824121-10825572 30 3.5 02_05_0860 - 32296743-32296769,32297328-32297357,32298432-322985... 30 3.5 02_05_0269 + 27307837-27308424 30 3.5 02_03_0120 + 15463163-15465250 30 3.5 01_07_0255 - 42322111-42322308,42322658-42322750,42323127-423233... 30 3.5 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 30 3.5 01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831,768... 30 3.5 01_01_0929 - 7344911-7345978 30 3.5 11_06_0419 + 23324772-23325035,23325200-23325214 29 4.6 10_07_0134 + 13289641-13290216,13290435-13290914 29 4.6 09_04_0506 - 18188785-18190599 29 4.6 09_04_0112 - 14757947-14758972 29 4.6 09_02_0369 - 8012470-8013120 29 4.6 08_01_0135 + 1068948-1069730 29 4.6 08_01_0060 - 413088-413999 29 4.6 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 4.6 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 29 4.6 07_01_0479 + 3606663-3607448 29 4.6 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 29 4.6 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 29 4.6 05_07_0236 - 28582157-28582552,28582639-28582911,28583324-285835... 29 4.6 05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 29 4.6 05_03_0163 + 9070781-9071320 29 4.6 03_05_0576 + 25765137-25766420 29 4.6 03_05_0292 + 22846273-22846377,22847161-22847823 29 4.6 03_05_0161 + 21400580-21401695 29 4.6 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 29 4.6 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 29 4.6 01_06_1651 + 38909410-38909625,38909713-38910181,38910265-38910899 29 4.6 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.6 12_02_1122 - 26244667-26245299 29 6.1 12_01_0838 - 7830944-7831444 29 6.1 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 29 6.1 10_08_0399 - 17614585-17614809,17614860-17615168 29 6.1 10_08_0214 - 15915156-15915713 29 6.1 09_02_0082 - 4060018-4061604 29 6.1 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 29 6.1 08_02_1019 - 23657175-23658047 29 6.1 07_03_1350 - 25955624-25955842,25955877-25955922,25956456-25956751 29 6.1 07_03_1300 - 25609670-25609915,25610006-25610130,25610240-256104... 29 6.1 07_03_0594 - 19833967-19834557 29 6.1 07_03_0287 - 16283460-16283658,16283696-16283802 29 6.1 06_03_0429 - 20701107-20701534,20701628-20701847 29 6.1 06_03_0424 - 20648938-20649564,20650588-20650902 29 6.1 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 29 6.1 05_03_0685 + 16992899-16993570 29 6.1 04_04_0176 - 23329589-23331043 29 6.1 04_03_0833 + 20147242-20147849,20147937-20148081,20148157-201482... 29 6.1 03_02_0765 + 11000724-11002496 29 6.1 03_02_0576 - 9587698-9588636 29 6.1 03_02_0342 - 7645323-7645909,7646323-7646491 29 6.1 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 29 6.1 02_02_0268 + 8422024-8422623 29 6.1 01_06_1377 + 36764461-36765339 29 6.1 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 6.1 01_01_0796 + 6190931-6192745 29 6.1 12_02_1114 - 26171876-26172493 29 8.1 12_02_0310 - 17358220-17358834 29 8.1 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 29 8.1 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 29 8.1 10_02_0175 - 6207485-6207898 29 8.1 09_04_0402 - 17304828-17305622 29 8.1 09_04_0306 + 16555664-16556623 29 8.1 07_03_0600 + 19866757-19867218,19867920-19868429 29 8.1 07_03_0309 + 16569201-16569468,16570310-16570534,16570860-16571176 29 8.1 06_03_0757 + 24267599-24268882 29 8.1 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 29 8.1 06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 29 8.1 06_01_0931 + 7192519-7194075 29 8.1 06_01_0805 + 6043248-6043551,6043654-6043755,6044858-6044964,604... 29 8.1 06_01_0743 - 5534743-5534985,5535075-5535172,5535286-5535429,553... 29 8.1 06_01_0333 + 2404459-2404857,2404917-2405009,2405428-2405522,240... 29 8.1 05_04_0303 - 20010761-20011756 29 8.1 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 29 8.1 04_04_0066 - 22495396-22495424,22495716-22495758,22495871-224961... 29 8.1 03_05_0737 + 27258320-27259007,27259263-27259435,27262684-272627... 29 8.1 03_05_0635 + 26303130-26303570 29 8.1 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 29 8.1 02_05_1277 - 35408097-35409080 29 8.1 02_04_0290 - 21627733-21628353,21628424-21628663,21628874-216292... 29 8.1 02_01_0158 - 1103461-1104186 29 8.1 01_06_1104 - 34551466-34551572,34552019-34553057 29 8.1 01_06_0840 + 32343700-32344138,32345329-32345419,32345584-323458... 29 8.1 01_05_0641 - 23881429-23881836 29 8.1 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 26 9.3 >07_01_0080 + 587674-588510 Length = 278 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 R GG + PPPPP P S P PPPP PPPP P Sbjct: 81 RLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPP----PPPPPPP 121 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPP 117 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P PPP Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPP 118 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS 794 PPPPP P P PPP R S Sbjct: 104 PPPPPPPPPPPPPPPPPPLFTRRS 127 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 333 GXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G + PPP P PPP P PPP Sbjct: 86 GMFRRPPPPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 29.1 bits (62), Expect = 6.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P PPP Sbjct: 97 PPPSSGSPPPPPPPPPPPPPPPP 119 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP S PPPP P P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPP 115 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P PPPP PPP GP P Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPP--PPPPKGPPPPP 348 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P+PPPP PPPP P G Sbjct: 353 PPPPPPPKG----PSPPPPPPPGGKKGGPPPPPPKG 384 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPP--PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P A P PPPP S PPP G G P Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGP 377 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT---PPPPXXRXSXLFXPPPPGPXGXPXXXXXXXRG 863 PPPPP P + P PPPP PPP GP P +G Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKG 375 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXP 463 PPP P P K PP + PP P PPP K G P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGP--PPPPPPKGPSPPPPPPPGGKKGGPPPP 380 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PP P+ PPP G P P Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG-PXG 830 P PPP P PPPP + P PG P G Sbjct: 362 PSPPPPPPPGGKKGGPPPPPPKGGASRPPAAPGVPTG 398 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL----FXPPPPGPXGXP 836 PPPPP P +P+PPPP L PPPP P P Sbjct: 587 PPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLP 628 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + + P PPPP + PPPP P P Sbjct: 606 PPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +3 Query: 708 LLXXXPPPPPXP-----XSXAXLPTPPPPXXRXSXLFXPPPPGP 824 L+ PPPPP P S P PPPP S L PPPP P Sbjct: 598 LVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPP 641 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S P PPPP PPPP P Sbjct: 622 PPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S PPPP F PPP P Sbjct: 636 PPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPP 669 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSX---AXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPPP + L PPP P P Sbjct: 570 PPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Score = 35.9 bits (79), Expect = 0.053 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P + P PPPP F PPPP P P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 35.1 bits (77), Expect = 0.093 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 S L PPPPP +P PP P PPPP P Sbjct: 631 SVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 33.9 bits (74), Expect = 0.21 Identities = 21/83 (25%), Positives = 26/83 (31%), Gaps = 3/83 (3%) Frame = +2 Query: 296 PPPXXPGGG---FXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPX 466 PPP P G F P PP + PPP P PP + P Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPP 608 Query: 467 XXXKKKKXXXGXXXPPPPPXHHN 535 + PPPP +H+ Sbjct: 609 PPILPNRSVPPPPPPPPPLPNHS 631 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP PPPP P P Sbjct: 544 PPPPPPP--------PPPPSGNKPAFSPPPPPPPPPPP 573 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP P + PPPP P P Sbjct: 563 PPPPPPPP-----PPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP---GPXGXP 836 PPPP A P PPPP PPPP G G P Sbjct: 751 PPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRP 791 Score = 32.3 bits (70), Expect = 0.66 Identities = 23/98 (23%), Positives = 26/98 (26%) Frame = +2 Query: 245 PKXNKKIXXXKXKKKKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPP 424 P NK PPP P + PP + PPP P PPP Sbjct: 554 PSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCL-VPSPPPPPP--PPP 610 Query: 425 XSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXHHNK 538 P PPPPP N+ Sbjct: 611 ILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNR 648 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + P PPPP PPP P P Sbjct: 735 PPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAP 772 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPP + + PPPP P P Sbjct: 544 PPPPPP------PPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 31.1 bits (67), Expect = 1.5 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P G PP PP P PPP K P Sbjct: 714 PPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPP--PPPLMTGKKAPAPPPPPPQA 771 Query: 476 KKKKXXXGXXXPPPPPXH 529 K PPPPP H Sbjct: 772 PKPPGTV----PPPPPLH 785 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP P P Sbjct: 552 PPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPP 589 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 10/48 (20%) Frame = +3 Query: 723 PPPPPXPX----------SXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PPPP R + P PP P P Sbjct: 692 PPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLP 739 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 684 AXRGGGSXLLXXXPPPPPXPXS------XAXLPTPPPPXXRXSXLFXPPPPGP 824 A R G + PPPPP P + A P PPP + PP P P Sbjct: 700 ANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPP 752 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + PT + PPPP P P Sbjct: 666 PPPPPPPRSSSRTPTGAATSSKGP----PPPPPPPLPP 699 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 9/43 (20%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFX---------PPPPGP 824 PPPPP A P PPPP L PPPP P Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P P PP PPP P PPP S + Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPP--PPPPSLPNRLVPPPPAPGIG 659 Query: 476 KKKKXXXGXXXPPPPP 523 K PPPPP Sbjct: 660 NK---FPAPPPPPPPP 672 Score = 28.7 bits (61), Expect = 8.1 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 9/47 (19%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLF---------XPPPPGPXGXP 836 PPP P + P PPPP R S PPPP P P Sbjct: 652 PPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLP 698 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P + T PPP P PP G Sbjct: 764 PPPPPPQAPKPPGTVPPPPPLHGASGRPHPPSSKG 798 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXPXXXXXXXRG 863 PPPPP PPPP S PP P RG Sbjct: 765 PPPPPQAPKPPGTVPPPPPLHGASGRPHPPSSKGLNAPAPPPLLGRG 811 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + + P PPPP PPPP P P Sbjct: 94 PPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 37.9 bits (84), Expect = 0.013 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P G P PP PPP P PPP G P Sbjct: 22 PPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQ 81 Query: 476 KKKKXXXGXXXPPPPPXH 529 PPPPP + Sbjct: 82 PPPPPQMYYQPPPPPPPY 99 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P PPPP S PPPP P P Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPP 117 Score = 36.3 bits (80), Expect = 0.040 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSX-AXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP PPPP P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP--PXXRXSXLFXPPP 815 PPPP P S P PPP P R + L PPP Sbjct: 111 PPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 31.9 bits (69), Expect = 0.87 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP PT PPP Sbjct: 111 PPPPSPPPSAPPPPPPPPTQPPP 133 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P A PPP L PPPP P P Sbjct: 27 PYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPP 64 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 96 PPPYGVNSSQPPPPPPPPPSPPP 118 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/76 (22%), Positives = 20/76 (26%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PP P P PP + F PP PPP + P Sbjct: 43 PPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVN 102 Query: 476 KKKKXXXGXXXPPPPP 523 + P PPP Sbjct: 103 SSQPPPPPPPPPSPPP 118 Score = 28.7 bits (61), Expect = 8.1 Identities = 22/79 (27%), Positives = 23/79 (29%), Gaps = 3/79 (3%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 P P P GGF P PP PPP PPP P Sbjct: 9 PHPPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPP-QGAPPPFLAPPPPPPPGPPPPHQ 67 Query: 476 KKKKXXXG---XXXPPPPP 523 + G PPPPP Sbjct: 68 PQFNFGPGPPQQQQPPPPP 86 >08_01_0202 - 1638978-1639571 Length = 197 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + R GGGG G + G GGGGG Sbjct: 92 GGGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGGG 125 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -3 Query: 820 PGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GGG D GGGG GR + G GGGGG Sbjct: 83 PSGGG----DRGYGGGGGGGRYGGDRGYGGGGG 111 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP + PPPP P P Sbjct: 349 PPPPPPPPPPP--PPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 35.1 bits (77), Expect = 0.093 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + TPP P F P PP Sbjct: 53 PPPPPAPDFTSDPSTPPAPDAPSGDFFPPAPP 84 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP--XXRXSXLFXPPPPGPXGXP 836 PPPPP + A P PPPP S P P P P Sbjct: 360 PPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAVP 399 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P P P S A P PPPP PPPP P Sbjct: 338 PSPRPVQPSNAPPPPPPPPPP------PPPPPPP 365 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 38.3 bits (85), Expect = 0.010 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXL-PTPP-PPXXRXSXLFXPPPPGPXGXP 836 L PPPPP P L P PP P R PPPP P G P Sbjct: 23 LRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 >10_08_0343 - 16960764-16960895,16961166-16961171,16961272-16961640, 16962118-16962304,16962567-16962759,16962864-16963137, 16963215-16963374,16963985-16964199,16964784-16964876, 16965192-16965260,16965293-16965445,16965534-16965737, 16966416-16966691,16967336-16967431,16967585-16967788, 16967877-16968069,16968229-16968374,16968771-16969425, 16971462-16971774,16971989-16972139,16972602-16973815, 16973933-16974182,16974784-16975035 Length = 1934 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 GGGG + R GGGG GR G GGGG +R Sbjct: 858 GGGGPNSQRGRGRGGGGAGRGGGGGGRGGGGRGEQR 893 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P S P PPPP R S PPP P Sbjct: 36 PSPPPPPPSPVPSPAPPPPPHRPS---PSPPPNP 66 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP S + P P S PPPP Sbjct: 51 PPPPPHRPSPSPPPNPLSSKLWLSSKLSPPPP 82 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP S P PPPP + + P PP P Sbjct: 148 PPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPSP 181 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLP----TPPPPXXRXSXLFXPPPPGP 824 PPPPP P A LP PPPP + L PPPP P Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPPTSVAAL--PPPPPP 169 Score = 36.3 bits (80), Expect = 0.040 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXS-XAXLP----TPPPPXXRXSXLFXPPPPGP 824 S L PPPP P S A LP PPPP + L PPPP P Sbjct: 126 SLLTSDPAPPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQP 171 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GG G + R GGGG G G GGGGG Sbjct: 47 GPPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGGGGG 84 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG + GGGGVG GGGGG Sbjct: 17 GGGRGGGGGDGRGGGYGGAGGGGVGGRGGRGPPGGGGG 54 Score = 31.9 bits (69), Expect = 0.87 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGR---XAXEXGXGGGGGXXKR 710 G G GGGG + R GGG GR G GGGGG R Sbjct: 30 GGYGGAGGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGGGGGGGR 74 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVG-RXAXEXGXGGGG 725 G G GGGG + R GGGG G G GGGG Sbjct: 75 GYGGGGGGGGYESGGGRGYGGGGRGYESGGGRGPGGGG 112 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G G + + GGGG GR G GGGG Sbjct: 7 GGGRGRGRGRGGGRGGGGGDGRGGGYGGAGGGG 39 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG G + R GGGG G E G GGG G Sbjct: 90 GRGYGGGGRGYESGGGRGPGGGGRGH---ESGGGGGRG 124 >03_01_0515 - 3864796-3865425 Length = 209 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P PP P PPPP P P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 35.1 bits (77), Expect = 0.093 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 L PPPPP S P PPP + PPPP P Sbjct: 69 LMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 Score = 35.1 bits (77), Expect = 0.093 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P A P PPP S + PPP P P Sbjct: 87 PLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPP-----PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP PP P + +P PPPP S PPPP P P Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSS--PPPPPLPPPPP 93 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-----PPXXRXSXLFXPPPPGP 824 PP PP S L PP PP L PPPP P Sbjct: 39 PPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPP 77 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXPXXKK 482 PPP P PPP P PPP P P K Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVK 113 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 37.1 bits (82), Expect = 0.023 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP + P PPPP S PPPP Sbjct: 599 PPPPPPKSTGPGPPRPPPPAMPGSSKTRPPPP 630 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PP P P + P PPPP PPPP G Sbjct: 586 PPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMPG 621 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 37.1 bits (82), Expect = 0.023 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP-----XXRXSXLFXPPPP 818 PPPPP P PTPPPP R PPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPP 93 Score = 35.5 bits (78), Expect = 0.070 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPP-PPGPXGXP 836 PPPP P LPTPPPP S PP PP P P Sbjct: 89 PPPPPPL----LPTPPPPPASISPTPAPPLPPPPAPAP 122 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P S + PTP PP PP P P Sbjct: 97 PTPPPPPASIS--PTPAPPLPPPPAPAPPPTPTP 128 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG GGGG G G GGGGG Sbjct: 170 GRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGG 207 Score = 36.3 bits (80), Expect = 0.040 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG K GGGG G E G GGGGG R Sbjct: 238 GGGGGGGALKRAAGSGGGG-GALECEIGGGGGGGGTDR 274 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG K GGGG G G GGGGG Sbjct: 224 GGGGGGGALKCVVGGGGGGGGALKRAAGSGGGGG 257 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P G GGGG + GGGG G G GGGGG R Sbjct: 121 PPGAGGGGGA-RPPAPGGGGGGGAPRRVLGGGGGGGALAR 159 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + GGGG G + G GGGGG Sbjct: 251 GSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGG 284 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P G GGGG GGGG G G GGGGG +R Sbjct: 108 PPGGGGGGGPPSLPPGAGGGG-GARPPAPGGGGGGGAPRR 146 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEX---GXGGGGGXXKR 710 GGGG R GGGG G A + G GGGGG KR Sbjct: 210 GGGGEGGAPERVIGGGGGGGGALKCVVGGGGGGGGALKR 248 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P PGGGG R GGGG G GG GG R Sbjct: 132 PPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGR 171 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG A E G GGGG Sbjct: 266 GGGGGGTDRNKGGGGGGGGALENAREDGAEGGGG 299 Score = 32.3 bits (70), Expect = 0.66 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G PGGGG R GGGG G G GGGGG Sbjct: 181 GPGRAPGGGGGGGGPGRAPGGGGGG-----GGLGGGGG 213 Score = 32.3 bits (70), Expect = 0.66 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = -3 Query: 835 GXPXGPGGGGXKX-----KDXRXXGGGGVGR--XAXEXGXGGGGG 722 G G GGGG K KD GGGG G E G GGGGG Sbjct: 352 GGGGGGGGGGTKVRVCAPKDISGGGGGGGGMLDKPDEAGGGGGGG 396 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG K GGGG G G GGGGG Sbjct: 376 GGGGGGMLDKPDEAGGGGGGGSGG---GGGGGGG 406 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G PGGGG G GG G GGGGG RR Sbjct: 104 GGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRR 146 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 820 PGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 PGGG GGGG G G GGGGG R Sbjct: 161 PGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGR 197 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 GGGG R GGG G G GGGGG R Sbjct: 149 GGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGR 184 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG G G P GGG +G GGG G + GGG Sbjct: 177 GGGGGPGRAPGG------GGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGG 226 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGGG D GGG G + G GGGG Sbjct: 374 GGGGGGGGMLDKPDEAGGGGGGGSGGGGGGGGG 406 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G A E G GGGG Sbjct: 293 GAEGGGGGGG---------GGGGGGHGAPELGFSGGGG 321 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 820 PGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GGG R GGGG G GGGGG Sbjct: 160 PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGG 192 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXG-----XGGGGG 722 G GGGG GGGG+G E G GGGGG Sbjct: 189 GGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGGG 227 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + GG +GR G GGG G Sbjct: 150 GGGGGGALARPPGGGRGGALGRPPGGGGGGGGPG 183 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 P G G GG + GGGG A G GGGG Sbjct: 160 PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGG 194 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G GG GGGG GR G GGG G Sbjct: 161 PGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPG 196 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = -3 Query: 823 GPGGGGXKXK---DXRXXGG--GGVGRXAXEXGXGGGGG 722 G GGGG + D R GG GGV + G GGGGG Sbjct: 320 GGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGGG 358 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 36.7 bits (81), Expect = 0.030 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = +3 Query: 711 LXXXPPPPPXPXSXA---XLPTPPPPXXRXSXLFXPPPPGP 824 L PPPPP P + A LP PPPP PPPPGP Sbjct: 229 LPPPPPPPPKPANIAGAPGLPLPPPP---------PPPPGP 260 Score = 34.3 bits (75), Expect = 0.16 Identities = 22/63 (34%), Positives = 25/63 (39%), Gaps = 17/63 (26%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAX----------LPTPPPPXXRXSXL-------FXPPPPGPX 827 G L PPPPP P S LP PPPP + + + PPPP P Sbjct: 199 GPSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPP 258 Query: 828 GXP 836 G P Sbjct: 259 GPP 261 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP PPPP P Sbjct: 251 PPPPPPP------PGPPPREIVPGQTLLPPPPPP 278 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP--PXXRXSXL------FXPPPPGPXGXP 836 P PPP P LP PP P + L F PPPP P P Sbjct: 348 PLPPPQPSHLPPLPPRPPTMPSMQPDMLAPGVPRFPPPPPPPDTRP 393 >06_03_0790 - 24636805-24637770 Length = 321 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGGG G G GGGGG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGGG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGGG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG GGGG G G GGGGG R Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 121 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + GGGG G + G GGGGG Sbjct: 236 GDGGGGWESSG----GGGGRGDVSGAGGGGGGGG 265 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GG GG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G G GGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 >04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 Length = 676 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + +P PPPP + + PPPP P G Sbjct: 489 PPPPRGNPPSWVPLPPPPGGN-APSWVPPPPQPRG 522 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P +P PPP P PP P G Sbjct: 1109 PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEG 1144 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PP PP P +P PPP PPP G G Sbjct: 1136 PPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRG 1171 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PP P A P PPPP + + PPP G G Sbjct: 1099 PPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLG 1131 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +3 Query: 726 PPPPXPXSXAXL---PTPP----PPXXRXSXLFXPPPPGPXGXP 836 PPPP P + PTPP PP PPPPG G P Sbjct: 1184 PPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLP 1227 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P PPP P + PPP + PPPP P G Sbjct: 1083 PLPPPLPPTLGDYGVAPPPPSIGAGA-PPPPPPPGG 1117 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP-GPXGXP 836 PPPPP P PP PPPP G G P Sbjct: 1122 PPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGP 1160 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 36.3 bits (80), Expect = 0.040 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGGG G G GGGGG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGGG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGGG Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 862 PRXXXXXXXGXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P+ G G GGGG GGGG G G GGGGG Sbjct: 26 PQANKQGCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 73 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 74 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G G GGGGG Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 36.3 bits (80), Expect = 0.040 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + P PPPP L PP P P P Sbjct: 123 PPPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRPAP 159 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P PP P PPPP P Sbjct: 111 PPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAP 142 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + +P PP P R + P P Sbjct: 136 PPPPPAPAAPVLVP-PPAPAPRPAPAPAPRVP 166 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 35.9 bits (79), Expect = 0.053 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 S L PPPPP P P PPP + + PPPP P Sbjct: 1176 SPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPI--PPPPVP 1214 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P S + LP PPPP S PP P P P Sbjct: 1169 PPPPPPLSPS-LPPPPPPPPLPSG--PPPQPAPPPLP 1202 Score = 33.1 bits (72), Expect = 0.37 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG-PXGXP 836 P PP P S PPPP S PPPP P G P Sbjct: 1155 PCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPP 1193 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P +P PP P S + PP P Sbjct: 1196 PAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLP--TPP--PPXXRXSXLFXPPPPGP 824 PPPPP P LP +PP PP PPPP P Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPP 1174 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP PPP P P Sbjct: 1169 PPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPP 1206 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL-FXPPPPGPXGXP 836 PPPPP P LP+ PPP L PPP P P Sbjct: 1180 PPPPPPPP----LPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P+ PPP Sbjct: 1172 PPPLSPSLPPPPPPPPLPSGPPP 1194 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 1185 PPPLPSGPPPQPAPPPLPIQPPP 1207 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 35.9 bits (79), Expect = 0.053 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 7/40 (17%) Frame = +3 Query: 726 PPPPXPXSXAXLP--TPP-----PPXXRXSXLFXPPPPGP 824 PPPP P S A +P PP PP S ++ PPPP P Sbjct: 423 PPPPPPGSYAPVPWGQPPPYASYPPPPPGSSMYNPPPPAP 462 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 35.5 bits (78), Expect = 0.070 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT--PPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P + A + PPPP PPPPG G P Sbjct: 597 PRPPPAPSATANTASALPPPPPRPPGAPPPPPPPGKPGGP 636 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 614 PPPPPRPPGAP--PPPPPPGKPGGP--PPPPPRPGSLP 647 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 35.5 bits (78), Expect = 0.070 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S LP+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHLPSPPP--LRSPPRQPTPPPSPSQQP 605 >07_03_0890 - 22332768-22333382 Length = 204 Score = 35.5 bits (78), Expect = 0.070 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFX-PPPPGPXGXP 836 S L PPPPP + P PPPP PPPP P P Sbjct: 68 SLLRLGSPPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAP 113 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLP----TPPPPXXRXSXLFXPP 812 PPPPP P +P TPPPP + PP Sbjct: 85 PPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 >12_02_1174 - 26696869-26698191 Length = 440 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXGXP 836 L PPPPP P + + P PPP PPPP P P Sbjct: 119 LSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPP 162 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P P S PPP P P Sbjct: 161 PPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRP 198 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P P P+PPPP + S + PPP Sbjct: 288 PPEPTKPKPPP--PSPPPPPQQPSQRYWTPPP 317 Score = 29.1 bits (62), Expect = 6.1 Identities = 21/80 (26%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 290 KXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPP--PXPHXPPPXSXXXKXXGXXXP 463 K PP P P PP R PP P P PPP + P Sbjct: 114 KTPPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 Query: 464 XXXXKKKKXXXGXXXPPPPP 523 K + PPPP Sbjct: 174 VVQPKPQPPPSLQPPSPPPP 193 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P P + PP P P Sbjct: 159 PPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPP 192 >08_01_0059 - 394001-394708 Length = 235 Score = 35.1 bits (77), Expect = 0.093 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + TPPPP R PPPP P P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRR-----APPPPSPPIRP 34 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXLP-----TPPPPXXRXSXLFXPPPPGP 824 PPPPP P A P PPPP PPPP P Sbjct: 34 PPPPPTPRPYAPPPPSHPLAPPPPHISPPAP-VPPPPSP 71 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPPG-PXGXP 836 PPPPP P + PPPP R + PPPP P P Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPRP---YAPPPPSHPLAPP 55 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PP P R PPPP P Sbjct: 12 PPPATPPPPPRRAPPPPSPPIR-----PPPPPTP 40 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 35.1 bits (77), Expect = 0.093 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L+ PPPPP P P PPPP R PPPP G P Sbjct: 351 LMPPPPPPPPPPP-----PPPPPPPPRPP---PPPPPIKKGAP 385 Score = 35.1 bits (77), Expect = 0.093 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP + PPP P Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKKG----APPPAP 389 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PPPP PP P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP K G P P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIK--KGAPPPAP 389 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 35.1 bits (77), Expect = 0.093 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GG + PPPPP P + A PPP R PPPP P P Sbjct: 954 GGSAQQSEKRPPPPPPPPNVA-----PPPFTRQD--IPPPPPSPPPLP 994 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 284 KKKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXP---PPXPHXPPP 424 +K+ PPP P P + PP T P PP P+ PPP Sbjct: 961 EKRPPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPPNSPPP 1010 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 35.1 bits (77), Expect = 0.093 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + + GGGG G G GGGGG Sbjct: 45 GGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGG 76 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + GGGG R + GGGGG Sbjct: 200 GGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGG 233 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G GGGGG Sbjct: 75 GGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGG 112 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGGG Sbjct: 68 GGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGG 105 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGG Sbjct: 73 GGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGG 110 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GG GG Sbjct: 80 GGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGG 117 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGGG G G GGGGG Sbjct: 60 GGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGG 97 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -3 Query: 823 GPGGGGXK--XKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GGGG R + GG GG Sbjct: 213 GGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGG 248 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 820 PGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 PGGGG GGGG G G GGGGG Sbjct: 388 PGGGGPGAPPPYHGGGGGGG------GGGGGGG 414 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P A P PP R S L PPPP P P Sbjct: 8 PPRPAPTPPAPAPAPPQVFLRRSVL--PPPPAPHHAP 42 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P LP PPPP + PP P P P Sbjct: 355 PAPPPPPPFAPTLPPPPPPRRK------PPSPSPPSSP 386 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP---PXXRXSXLFXPPP-PGPXGXP 836 PPPPP P PTP P P + PPP PGP P Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAP 76 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/76 (25%), Positives = 19/76 (25%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P G P PP PP PPP P Sbjct: 26 PPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSPHSPSPSN 85 Query: 476 KKKKXXXGXXXPPPPP 523 PPPPP Sbjct: 86 APWVAPAADIPPPPPP 101 >06_01_0178 + 1386981-1387505 Length = 174 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG K + G GG G G GG GG R Sbjct: 90 GAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGR 131 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P PGG G + R GG G G GGGGG Sbjct: 13 GEPGQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGG 50 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG + R GG G G GGGGG Sbjct: 16 GQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGG 53 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG G GG G G GGGGG R+ Sbjct: 40 GGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRK 82 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G GG G G GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGG 74 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGG-GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG GG GGGG GR G GG GG Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGG 93 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG K + G GG G G GGGGG R+ Sbjct: 68 GAGGGGGGGGGKGRKGGAGGHGGAG------GGGGGGGGKGRK 104 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GG GGGG GR G GG GG R Sbjct: 84 GAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGR 119 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G + G GG GG Sbjct: 31 GRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGG 68 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G GG G G GG GG Sbjct: 34 GASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGG 71 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG GG G G G GGGGG ++ Sbjct: 64 GGHGGAGGGGGGGGGKGRKGGAG-GHGGAGGGGGGGGGKGRK 104 >06_01_0145 + 1092764-1093351 Length = 195 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GPGG G K G GG+G + G GG GG ++ Sbjct: 102 GGNAGPGGVGGKGGPGGDGGPGGIGGRGGDGGCGGVGGRGRK 143 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG + R GG +G G GGGG Sbjct: 25 GQPGGRGRGGRGGRGGRGGAGGRLGVRHGRRGRRGGGG 62 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GG G G GGVG + G GG GG Sbjct: 114 GGPGGDGGPGGIGGRGGDGGCGGVGGRGRKGGRGGRGG 151 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GG G D G GG GR G GG GG Sbjct: 120 GGPGGIGGRGG---DGGCGGVGGRGRKGGRGGRGGRGG 154 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 R GGG L P P + A P PPPP F PPP P P Sbjct: 117 RGGGGGGFDALYRAPIGPYVRGATAPPPPPPPPMAVAPPPFLPPPLRPFAAP 168 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 125 GYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGG 158 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +3 Query: 708 LLXXXPPPPPXPXS-XAXLP----TPPPPXXRXSXLFXPPPPGP 824 LL P PPP P S A LP PPPP + L PPP P Sbjct: 129 LLNSDPAPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPAQP 172 >08_01_1038 + 10540185-10540709 Length = 174 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P G GG G GGGG+G+ G GG GG +R Sbjct: 18 PVGGGGVGLGGGSGLGGGGGGLGKGGVRGGGGGLGGGRRR 57 >05_05_0135 - 22626163-22626198,22626391-22626441,22626516-22626608, 22627249-22627254,22628051-22628180,22628333-22628583 Length = 188 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P PGGGG + GGGG G G GGGGG Sbjct: 5 PGSPGGGGGSHESGSPRGGGGGG-----GGGGGGGG 35 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 33.9 bits (74), Expect = 0.21 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G G+ PPPPP + P P P PPPP P P Sbjct: 311 GAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAP 358 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 684 AXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 A GGG + PPPP P A P P PP PPPP P Sbjct: 265 ASAGGGQ--VPAAPPPPAGPPPPA--PPPLPPSHHHHHGHHPPPPHP 307 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP-XGXPXXXXXXXRG 863 PPPP S A + PPP + P PPGP G P RG Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRG 380 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT------PPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP A P PPPP PPPP G P Sbjct: 350 PPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPGGP 393 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPP---PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP PP + A PPPP + PPPP P Sbjct: 303 PPPHPLPPGAGAGAGTGAPPPPPAHPAAP-APPPPAP 338 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXH 529 PPP P PP P G PPPPP H Sbjct: 283 PPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAH 327 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGG 184 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG D G G VG G GGGGG Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGG 187 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG D GGGG G G GGGGG Sbjct: 159 GDVGGDGGGGG---DGNVGGGGGGGGGGGGGGGGGGGG 193 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G GG G G GGGGG Sbjct: 144 GRLGGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGG 181 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG + GGGG G G GGG G Sbjct: 158 GGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGGDG 195 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P P R + PPP P P Sbjct: 10 PPPPPPPQLEASGSDPDDPLLRDRVVVIAPPPPPPPPP 47 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P P PPPP + PPPP P G Sbjct: 920 PPPPRPPGA---PPPPPPPGKPGG--PPPPPPPPG 949 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXGXP 836 P PPP P + A + PPP PPPPG G P Sbjct: 902 PRPPPAPSATANTASALSPPPPRPPGAPPPPPPPGKPGGP 941 Score = 31.9 bits (69), Expect = 0.87 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPPP Sbjct: 929 PPPPPPPGKPGGPPPPPPP 947 >07_03_0527 - 19085828-19086319 Length = 163 Score = 33.5 bits (73), Expect = 0.28 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P G GG G GGGG+G G GG GG +R Sbjct: 18 PVGGGGTGLGGGSGLGGGGGGLGEGGVRGGGGGLGGGRRR 57 >05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094, 4501219-4501296,4501333-4501557,4502842-4502910, 4502946-4503200 Length = 351 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGG-GVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGG G GR G GG GG R Sbjct: 6 GRGFGRGGGGRGDGGGRGGGGGRGFGRVGDSGGRGGRGGRGGR 48 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGG 78 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGG-GGGGSGGGCGGGGG 76 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G G GGGGG Sbjct: 42 GGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGG 79 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G G GG GGGG G G GGGG Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG G GGGG G GGGGG Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 >02_01_0584 - 4326072-4326094,4326306-4326885 Length = 200 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG + GGGG G E G GGGGG R Sbjct: 80 GGGGGGQDGGEESRDGGGGGG---GEKGSGGGGGGLAR 114 >09_03_0145 - 12749288-12751510 Length = 740 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PPPP PPPP P G Sbjct: 30 PPPPPPPPGIQ----PPPPALPGMPHGRPPPPFPGG 61 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P + + P PPPP + PPPP G P Sbjct: 19 PPFKPKPTNPSPPPPPPPPGIQ------PPPPALPGMP 50 >06_02_0175 - 12624608-12625297 Length = 229 Score = 33.1 bits (72), Expect = 0.37 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG + + + G G GGG G GGG G GGG Sbjct: 68 GGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GG GGGG G G GGGGG RR Sbjct: 86 GWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 128 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG + + G G GGG G GGG G GGG Sbjct: 70 GGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG R G G GR + G GGGG R+ Sbjct: 112 GGGGGGGGGGGGGGGRRCWWGCGNGRRRHKGGKEGGGGGEGRK 154 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 33.1 bits (72), Expect = 0.37 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPP--PPXXRXSXLFXPPPPGPXGXP 836 G L PPPPP P A P PP P + PPPP P P Sbjct: 47 GQHHALPHPPPPPP-PPQPAKEPPPPTKPKHPKPKQQQHPPPPPPQKPP 94 >04_04_0057 + 22410167-22411330 Length = 387 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A +P P PPPP P Sbjct: 181 PPPPPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 L PPPPP P + A P R PPPP Sbjct: 178 LEKPPPPPPPPPAAAAASPSPERSPRCQPSPPPPPP 213 >04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463, 8711553-8711634,8711909-8712100 Length = 935 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 483 PPSPPEPPSPRHQPSPPP--LRSPPRQPTPPPSPSQQP 518 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P P PPPP R + PPP Sbjct: 398 PPPPPQPPP----PPPPPPHQRETPSPSPPP 424 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 33.1 bits (72), Expect = 0.37 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPPPXPXSXA---XLP--TPPPPXXRXSXLFXPP--PPGPXGXP 836 PPPPP P S A LP +PPPP PP PP P P Sbjct: 70 PPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 >02_04_0021 + 18975992-18976408 Length = 138 Score = 33.1 bits (72), Expect = 0.37 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P P PTP PP S PPPP G Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPS----PPPPKAAG 129 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P PTPPPP PP P P P Sbjct: 97 PPPPKPK-----PTPPPPAPTPK----PPAPSPSPPP 124 >01_02_0031 + 10364487-10365407 Length = 306 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP P + LP PPPP L PP Sbjct: 169 PPPPPPPPA---LPAPPPPPAPMLPLAPPP 195 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLF-XPPPPGPXGXP 836 PPPP P + P+PPPP + P PP P P Sbjct: 146 PPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAP 184 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP A P+PP P + PPPP P G Sbjct: 162 PPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAG 197 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP + P PP + PPPP P Sbjct: 161 PPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPP 193 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPQHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 401 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 436 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 413 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQP 443 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P + A P P PP PPP P P Sbjct: 195 PAPPTPPTIARPPRPLPPASPPPPSIATPPPSPASPP 231 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P + PTPPP + PPPP P Sbjct: 239 PPPSPTPTTTRASPTPPP---IPTATVRPPPPLP 269 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P P S A P P P PPPP P Sbjct: 211 PPASPPPPSIA-TPPPSPASPPPPSTATPPPPSP 243 >10_07_0154 + 13487971-13488168,13488259-13488483,13488592-13490492, 13490578-13490829,13491110-13491191,13491466-13491657 Length = 949 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 534 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 569 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 546 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQP 576 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >09_04_0487 - 18014469-18014660,18014935-18015016,18015297-18015548, 18015634-18017789 Length = 893 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 478 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 513 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 490 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQP 520 >09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962, 7633517-7633622,7633897-7633978,7634068-7634178, 7634259-7634510,7634596-7635688,7636157-7636829, 7636920-7637117 Length = 936 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 414 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 449 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 426 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQP 456 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 483 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 518 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 495 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 525 >08_02_1256 + 25645085-25645396 Length = 103 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P P PPPP + PPP Sbjct: 61 PPPPPPPPPLPSPPPPPPPQQQEEQ--SPPP 89 >08_02_0450 - 17266977-17267165,17268017-17268053,17268139-17269514, 17285369-17286055,17286146-17286343 Length = 828 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 524 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 559 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 536 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQP 566 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 548 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 583 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 560 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 590 >08_02_0193 - 14073103-14073246,14073332-14073481,14073571-14073640, 14073900-14074021,14074260-14074395,14074492-14074967 Length = 365 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP--------PPPXXRXSXLFXPPPPGP 824 PPPP P S P+P PPP R + PPPP P Sbjct: 30 PPPPTTPESCPDGPSPVAPYFAPPPPPLCRRRRSWPPPPPPP 71 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 548 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 583 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 560 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 590 >06_03_1326 - 29355467-29355817 Length = 116 Score = 32.7 bits (71), Expect = 0.50 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG K GGGG G G GGGGG Sbjct: 10 GGGKGGGGGGGGGK----GGGGGSGGGGRSGGGGGGGG 43 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG K GG G G + G GGGG Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGG 39 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVG--RXAXEXGXGGGGG 722 G G GGGG R GGGG G + E G G GG Sbjct: 18 GGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGG 57 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGGG K G G G GGGGG K Sbjct: 32 GGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGK 72 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >05_06_0078 - 25412770-25413852 Length = 360 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG G G GR G GGGG R Sbjct: 278 GATGGAGGGGGDAAGGEGGGAAGGGRDGITGGGGGGGSGAPR 319 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 GGGG R G GG G G GGGG Sbjct: 309 GGGGGGSGAPRDGGNGGAGAGVLALGGGGGG 339 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GG GVG G GGGGG Sbjct: 202 GGGDGDGGGGFTGE-----GGDGVGGSTGITGVGGGGG 234 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG +D GGGG G A G GG G Sbjct: 293 GEGGGAAGGG---RDGITGGGGGGGSGAPRDGGNGGAG 327 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527, 4797608-4797859,4797945-4800115 Length = 935 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 483 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 518 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 495 PPSPPPLRSPPRQPTPPPSPSQQPPLPVPQP 525 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 32.7 bits (71), Expect = 0.50 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 GGGG GGGGVG G GGGG RR Sbjct: 14 GGGGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGMGRR 50 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLF---XPPPPGP 824 PPPPP P A P PP F PPPP P Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPP 69 >02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551, 2703632-2703883,2703969-2704798,2704895-2706202, 2706293-2706490 Length = 990 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 538 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 573 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 550 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 580 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 32.7 bits (71), Expect = 0.50 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP + A LP PP P L PPP P P Sbjct: 55 PPPSSSASTAAPLPAPPTPSPVPEHLHHHPPPPPPVPP 92 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 723 PP--PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PP PPP P P PPPP PPPPG Sbjct: 127 PPEDPPPHPPHPPDHPPPPPPCR------VPPPPG 155 >01_06_0075 - 26201231-26201422,26201697-26201778,26201868-26201978, 26202059-26202310,26202396-26204629,26204720-26204917 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPEPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+PPP R PPP P P Sbjct: 570 PPSPPKPPSPRHPPSPPP--LRSPPRQPTPPPSPSQQP 605 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP S PTPPP + L P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQP 612 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP PPPP PPPP P Sbjct: 53 PPPPPQVIRVFAAAPPPPPAAFFAAVPPPPPPP 85 Score = 31.9 bits (69), Expect = 0.87 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP PPPP + + PPPP Sbjct: 53 PPPPPQVIRVFAAAPPPPPAAFFAAVPPPPPP 84 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP A P PPPP Sbjct: 67 PPPPPAAFFAAVPPPPPPP 85 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP A P PPP + PPPP Sbjct: 54 PPPPQVIRVFAAAPPPPPAAFFAAVPPPPPPP 85 >11_01_0359 - 2731522-2732346 Length = 274 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +3 Query: 684 AXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 A G + P P P P S + P PPPP + PPPP Sbjct: 27 AATNGTAAFAVAYPYPAPPPHSHSH-PPPPPPHAYHHHHYPPPPP 70 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P PPPP PPP Sbjct: 53 PPPPPHAYHHHHYPPPPPPHHHPYPPHPPPP 83 Score = 28.7 bits (61), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + PPPP + P PP P Sbjct: 52 PPPPPPHAYHHHHYPPPPPPHHHP-YPPHPPPP 83 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 R G G+ + PP P P PPP + PPPP P P Sbjct: 307 RFSAGSGAEMNKQMASPPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P S + L P P + PPPP Sbjct: 377 PPPPPPPMSPSCLLPPIIPAPTFTYSSPPPPP 408 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P S P PP PPPP Sbjct: 221 PPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P PTPPP L PPPP P P Sbjct: 53 PPELMPPSPPKASPTPPPQPQPHPQLQPPPPPAPLPPP 90 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P PTPPPP R PPPP P P Sbjct: 24 PKPKPTPIRN---PTPPPPPPRRR---TPPPPPPGSGP 55 >07_03_0560 + 19479597-19480667 Length = 356 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG K GGG G G GGGGG Sbjct: 94 GGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGG 131 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG K+ GGGVG A G GGGG Sbjct: 175 GGDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGGGG 212 Score = 31.1 bits (67), Expect = 1.5 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGG 359 GGGGG F G G GGG +G GGG G A GG Sbjct: 253 GGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGGAGGG 307 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G A + G GG GG Sbjct: 247 GGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGG 284 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG D GGGG G G GGGGG Sbjct: 62 GGGGGFGGDGGFGGGGG-GGLGGGGGFGGGGG 92 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GG GG Sbjct: 74 GGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGG 107 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + GGGG+G G GGGGG Sbjct: 115 GGGGGEGGGLGGGGGGGLGGGGG-GGVGGGGG 145 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 82 GGGGGFGGGGGAGGGGGLGGGGGKG-GGFGGGVGGGGG 118 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG GGGG+G + G GGG Sbjct: 76 GGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGG 112 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG K GGG+G A G GGGG Sbjct: 209 GGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGG 246 Score = 29.5 bits (63), Expect = 4.6 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGG 359 GGGGG F G G GGG G GGG G A GG Sbjct: 211 GGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGGMGGGAGGG 265 Score = 28.7 bits (61), Expect = 8.1 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG G G GGG +G GGG G GGG Sbjct: 62 GGGGGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGG 117 Score = 28.7 bits (61), Expect = 8.1 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVG-RXAXEXGXGGGGG 722 G G GGGG D GGGG+G E G G GGG Sbjct: 163 GGGLGGGGGGGFGGD----GGGGLGGGGGKEGGFGAGGG 197 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGG Sbjct: 203 GGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGG 240 Score = 28.7 bits (61), Expect = 8.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXG--GGGVGRXAXEXGXGGGG 725 G G GGGG K G GGG G G GGGG Sbjct: 211 GGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGG 249 >06_01_0125 + 970746-970967,971126-971226,971897-972026,972108-972333, 972400-972502,972519-972594,972710-973333 Length = 493 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP G G D G GG+GR G GG GG Sbjct: 18 GGDGGPHGIGGSGGDGGCGGVGGLGRKGGRGGHGGRGG 55 >05_05_0313 - 24026142-24026708 Length = 188 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 GGGG + G G + R G GGGGG +R Sbjct: 11 GGGGNARRSATGGGAGRMHRKGKHQGDGGGGGGKRR 46 >04_01_0034 - 401208-402923 Length = 571 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P PPPP + + PPPP P P Sbjct: 294 PHAPRLPLQPRPAPPPPPPQQQRAKPSRPPPPPPPLDP 331 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 32.3 bits (70), Expect = 0.66 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG G GGGG G E G GGGGG Sbjct: 95 GYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGG 132 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG ++ GGGG G G GGGGG Sbjct: 110 GGYGGGGGGGYGRREGGYGGGGGYG-----GGRGGGGG 142 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGG G Sbjct: 109 GGGYGGGGGGGYGRREGGYGGGG-GYGGGRGGGGGGYG 145 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP + PPPP G P Sbjct: 280 PPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 Score = 31.9 bits (69), Expect = 0.87 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P PP P P PPPP PPPP G Sbjct: 293 PRIPPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGG 328 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP--PPGPXG 830 PPPP P P PPPP + + PP PP P G Sbjct: 267 PPPPQVPPPPPQAPPPPPP---NAPMGMPPRIPPPPVG 301 >02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960, 1136053-1136116,1136174-1136392,1138562-1138945 Length = 284 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P P + P PPPP + P P P G Sbjct: 177 PPPVPSPSAPPLPPQPPPPRNQAQADKAPIPVAPPG 212 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 32.3 bits (70), Expect = 0.66 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPP PPPP P P Sbjct: 418 PPPPLPSDAFEQPPPPPEHPPPPESTSPPPP-PTSDP 453 Score = 32.3 bits (70), Expect = 0.66 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP +PPPP PPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPPVPPPPP 461 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P PPPP + PPPP G Sbjct: 431 PPPPEHPPPPESTSPPPPPTSDPPPV--PPPPPTTG 464 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPP----PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP PP P + P PPPP S F P P P Sbjct: 438 PPPESTSPPPPPTSDPPPVPPPPPTTGS--FMPIPSAP 473 >01_05_0490 + 22672241-22674679 Length = 812 Score = 32.3 bits (70), Expect = 0.66 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P PP S PPPP P P Sbjct: 641 PPPPPPPTTRRSRKPPQPP----SRPAPPPPPPPQQQP 674 >01_05_0423 + 22032940-22033695 Length = 251 Score = 32.3 bits (70), Expect = 0.66 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 726 PPPPXPXSXAXLPT-PPPPXXRXSXLFXPPPP 818 PP + LP+ PPPP + LF PPPP Sbjct: 154 PPVAVASNGGFLPSPPPPPQGQQQLLFLPPPP 185 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.9 bits (69), Expect = 0.87 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P P PP + PPP Sbjct: 322 PPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPP 353 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLP-TPPP--PXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPP P +F PP P P P Sbjct: 255 PPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPP 295 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP-PXXRXSXLFXP--PPPGPXGXP 836 PPPPP P P PP P F P PPP P P Sbjct: 289 PPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPP 424 PPP P F PP + PPP P PPP Sbjct: 290 PPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPP 332 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GGGG A G GGGGG Sbjct: 78 GAGGGGGGVGDVEGGGGGG---GAGGGGGGGGGG 108 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDX-RXXGGGGVGRXAXEXGXGGGGG 722 G GGG D GGGGVG G GG GG Sbjct: 66 GVGGGEAMEVDGGAGGGGGGVGDVEGGGGGGGAGG 100 >07_03_1751 - 29215074-29216270 Length = 398 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GG G G A G GGGGG Sbjct: 348 GGGAGAGGGFGGGKGGGFGGGVGGGHGAGGGGAGGGGG 385 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG G G F GGG G GGG G K GGG Sbjct: 274 GGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFG-GGKGGGFGGG 328 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGGG+G A G G GGG Sbjct: 256 GAGGGAGAGGGLGAGGGAGGGGGIGGGAG-GGAGAGGG 292 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GG GVG A G GGGGG Sbjct: 178 GGGLGGGSGGGGGLGGGAGGGAGVGGGAG-GGAGGGGG 214 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG+G A G GGGGG Sbjct: 206 GGGAGGGGGLGGGAGGGAGGGGGLGGGAG-GGHGGGGG 242 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGG K GGGG G A G GGG Sbjct: 284 GGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGG 320 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG G GVG A G GGGG Sbjct: 130 GGGGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGGG 167 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGG Sbjct: 204 GAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGG 241 >07_03_1533 + 27523811-27524710 Length = 299 Score = 31.9 bits (69), Expect = 0.87 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG GGGG + G GGGGG RR Sbjct: 87 GDDDGGGGGGG---GGGGGGGGGDDSGGDDGGGGGGGGDGDRR 126 >07_01_0633 - 4735298-4735485,4736083-4736114,4736203-4736297, 4736414-4736487,4736682-4736817,4736902-4736965, 4737101-4737166,4737265-4737446,4737824-4737948, 4738031-4738169,4738250-4738369,4738675-4738746, 4738900-4738935,4739633-4739749,4739821-4739953, 4740053-4740156,4740243-4740370,4740880-4741010, 4741561-4741757,4743906-4744583 Length = 938 Score = 31.9 bits (69), Expect = 0.87 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G P GG + GGGG G G GGGGG R Sbjct: 57 GRGPAPAAGGVVGRGTGGGGGGGRGDGGRGRGRGGGGGDGVR 98 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.9 bits (69), Expect = 0.87 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXR 788 PPPP P A P+PPPP R Sbjct: 27 PPPPPPPPPAHGPSPPPPRTR 47 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P P S P PPPP PPPP Sbjct: 16 PPQPPPTSRPLPPPPPPPPPAHGP--SPPPP 44 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 31.9 bits (69), Expect = 0.87 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PPPP + P PP P Sbjct: 18 PPPPPVQVPVPPPPPPPLPPAAAAVEPLPPQP 49 >05_05_0154 - 22774503-22774652,22774738-22774968,22775508-22775675, 22775760-22775936,22776281-22776302,22776351-22776417, 22776583-22776774,22776819-22776962,22778421-22779102 Length = 610 Score = 31.9 bits (69), Expect = 0.87 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 P GGG K R GGGG G GGGGG K+R Sbjct: 22 PASTGGGKKKPHQARNGGGGG--------GGGGGGGWEKKR 54 >04_04_1413 - 33386049-33386339 Length = 96 Score = 31.9 bits (69), Expect = 0.87 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GG + + GGGG G G GGGGG Sbjct: 53 GSGGRRRRTGGGGGGGGGGGGCGGGGGGGGGG 84 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G G GGG Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGGGGCGGGGGSGGG 95 >04_04_1126 + 31095651-31096115 Length = 154 Score = 31.9 bits (69), Expect = 0.87 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P + + +P PPPP + P P P G Sbjct: 41 PPPPPPPAPSGVPCPPPP-------YTPTPATPTG 68 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 31.9 bits (69), Expect = 0.87 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +2 Query: 389 TXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXHHN 535 T PPP P PPP S + G P PPPPP HH+ Sbjct: 7 TWPPPTPS-PPPFSSRPRVVGPPPPPP---------SDPPPPPPPHHHH 45 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 31.9 bits (69), Expect = 0.87 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P A P PPPP PPP G Sbjct: 51 PPPPPPMVAA--PPPPPPQYAKHFAAGPPPAAAAG 83 >02_05_0149 + 26290236-26290880 Length = 214 Score = 31.9 bits (69), Expect = 0.87 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXG-GGGVGRXAXEXGXGGGGG 722 G GGGG R G GGG G G GGGGG Sbjct: 103 GGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGG 137 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVG---XGGGXGXXXKXXAXGGG 356 GGGGG + F G G P F GGG G GGG G GGG Sbjct: 104 GGGGGGGGGSGRAYGFGGGYG-GHPGGFGGGGGGGGGGGGRNYGGGSGGIGGYGNYGGG 161 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG + GG G G GGGGG R Sbjct: 102 GGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGR 143 >01_01_0570 - 4231100-4232560 Length = 486 Score = 31.9 bits (69), Expect = 0.87 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG GGGG+G G GGGG Sbjct: 85 GGLGGGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGG 121 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG D GGGVG G GGGGG Sbjct: 257 GGGAGGGMGGDIGGGAGGGVG-GGGGGGMGGGGG 289 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G GGGG Sbjct: 155 GFGGGAGGGGGIGAGGGFGGGAGAGGGVGGGGRFGGGG 192 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P S A PPP PPPP P Sbjct: 84 PTPPPPSSTASSSLPPPTPLLPKHQQAPPPPPP 116 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + +PPPP + PP P P Sbjct: 59 PPPPAPLTPPPPKSPPPPPHIQTTDLPPPKPLP 91 >08_02_1553 + 27835320-27835364,27836853-27836966,27837062-27837457, 27837751-27837822,27837957-27838082,27838164-27838244, 27838364-27838558,27839018-27840013 Length = 674 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P + P PPPP P PP P Sbjct: 481 PPPLPAAHNVPPRPPPPVNAAPEAAIPRPPPP 512 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP 809 PPPP A +P PPPP + + P Sbjct: 494 PPPPVNAAPEAAIPRPPPPVPPATRISNP 522 >08_02_0937 + 22801526-22802461 Length = 311 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 G L P PPP P + +PPPP PPPPG Sbjct: 50 GEFLEEENPNPPPEPEEEEEVSSPPPP--------PPPPPG 82 >06_02_0271 + 13618149-13618297,13618311-13618560 Length = 132 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG + D GGG GR G G GGG Sbjct: 54 GGEGGGGEGGGEGGDGGTEGGGDGGREGSGDGGGEGGG 91 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP PPPP Sbjct: 48 PPPPPQPHT---APPPPPPNAEPE---APPPP 73 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P PPPP + PPPP P P Sbjct: 36 PPPSRPEPDQAAP-PPPPQPHTA----PPPPPPNAEP 67 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 L PPPPP P P+PP P + + PP Sbjct: 73 LAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPP 106 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P PPPP + PPPP Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + + PPPP PPPP G Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPPPARSG 73 >03_01_0023 + 198414-198968 Length = 184 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG R GGG G G GGGG Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGG 72 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGG G G G GGG Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGG 76 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G PGGGG GGG G G GGGGG Sbjct: 30 GSCPSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGG 67 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G GGGG GGG G G GG GG Sbjct: 35 PGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGG 70 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG + GG G G + G GGGG Sbjct: 41 GGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGG 77 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G G GGG Sbjct: 57 GSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGG 94 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG G GGGG G GGGGG Sbjct: 60 GGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGG 97 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGG G + G GGGGG Sbjct: 51 GRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGG 88 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGGG G G GGG G Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSG 92 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG G GG G G GGGGG Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGG 90 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGGG G G GGGG Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGG 82 Score = 29.1 bits (62), Expect = 6.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG G GGGG G G GGGG Sbjct: 50 GGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGG 87 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGG Sbjct: 40 GGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGG 77 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGG G G GGGGG Sbjct: 61 GSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGG 98 >01_06_0046 + 25943183-25943590 Length = 135 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 G +L PPPP P PPP + PPPP Sbjct: 40 GADCPVLYPSPPPPALPPPPPYYYYSPPPPAYYPGSYCPPPP 81 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP PP PGP P Sbjct: 183 PGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKP 220 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P PP P + PP PGP P Sbjct: 174 PGPKPKPPKPGPKPKPPKPGPKPKP--KPPKPGPKPKP 209 Score = 29.1 bits (62), Expect = 6.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P P + PP PGP P Sbjct: 161 PKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKP 198 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P S P PPPP L PP P G Sbjct: 75 PPPTPPSP---PPPPPPPPTNGTLTPPPSSAPSG 105 >01_01_0046 - 331758-332627 Length = 289 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPP 424 PP R F T PPP P PPP Sbjct: 9 PPQRYWFPYWTSPPPPPPPPPP 30 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-----PPPGP 824 PPPPP P S + P PP R P PP GP Sbjct: 25 PPPPPPPPSSSRYRPPSPPSSRHPHPTIPAARAAPPLGP 63 >02_02_0183 + 7576901-7576908,7577666-7578176 Length = 172 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 GGGG + R GGGG R G GGGG Sbjct: 41 GGGGWIRRPARQRGGGG-RRRRRRCGGGGGG 70 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G G + + GGGGVG GGG G R Sbjct: 93 GDGTGDVEAEGGGGGGGGGVGWMGMRRAEGGGSGSVAR 130 Score = 27.1 bits (57), Expect(2) = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGG 722 GG G G E G GGGGG Sbjct: 92 GGDGTGDVEAEGGGGGGGG 110 Score = 23.0 bits (47), Expect(2) = 1.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGR 758 GGGG + + GGGG R Sbjct: 54 GGGGRRRRRRCGGGGGGAAR 73 >12_02_0644 - 21463629-21463916,21464147-21464253,21465164-21465362 Length = 197 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGG K GGGG R G GGGG Sbjct: 12 GSGGGDGAKKGKGRWGGGGRRRNEQRLGSGGGG 44 >12_01_0841 - 7873458-7874225 Length = 255 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + GGG G + G GGGGG Sbjct: 48 GGGGSGYGEGYGQGGGASGGGYGQGGGGGGGG 79 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G GGGGG Sbjct: 41 GGGGGEGGGGGSGYGEGYGQGGGASGGGYGQGGGGGGG 78 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG R GGGG G G GGGGG Sbjct: 16 GGGGGGGGGGGGRGNGGGGFG-----GGGGGGGG 44 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 11 GYTSGGGGGGG--------GGGGGGRGNGGGGFGGGGG 40 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 31.1 bits (67), Expect = 1.5 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGG 359 GGGGG + G G + GGG G GGG G A GG Sbjct: 78 GGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGGGGGGGYGYGAGGG 132 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPP 424 PPP PG F P PP F PPP PPP Sbjct: 44 PPPPPPGSTFVPLPQSGVPPPPPLGSFF----VPPPQSRVPPP 82 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPP 815 PPPPP + LP PPPP F PPP Sbjct: 44 PPPPPPGSTFVPLPQSGVPPPPP--LGSFFVPPP 75 >09_02_0223 + 5977138-5977459,5979842-5980842 Length = 440 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PP P P + LP+PP P + PPP G Sbjct: 378 PPLPPPPTMLMLPSPPSPPPSDAEGDAPPPSG 409 >08_02_0839 + 21693348-21694853 Length = 501 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P LP PPPP PPPP Sbjct: 16 PPTSPLQLPLPYLPPPPPPPQPPLLQLQPPPP 47 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGG R GGGG+G G GGGG Sbjct: 58 GRCHGGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGG 94 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGG-GGVGRXAXEXGXGGGGG 722 G G GGGG K GG GG G GGGGG Sbjct: 172 GGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGG 210 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G + G GGGGG Sbjct: 104 GFGGGVGGGSGAGGGLGGGGGGGFGGGSG-GGVGGGGG 140 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG + GGG G G GGGG Sbjct: 90 GGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGG 126 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G G GGGGG Sbjct: 146 GAGGGVGGGSGTGGGLGGGGGGGFG-GGGGGGIGGGGG 182 Score = 28.7 bits (61), Expect = 8.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXG--GGGVGRXAXEXGXGGGG 725 G G GGGG K G GGG G G GGGG Sbjct: 206 GGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGGG 244 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP + + + P P P Sbjct: 53 PPPPPPPP-----PPPPPPQVQAATVATPVPATP 81 >06_03_1363 - 29576265-29577575 Length = 436 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 GGG L+ PPPP PPP R S PPPP Sbjct: 379 GGGKVLIVDVTPPPP----------PPPAARRESWAAPPPPP 410 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGG GGGG G G GGGGG K Sbjct: 107 GGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSK 147 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G GG G G GGGGG Sbjct: 105 GGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGG 142 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGG Sbjct: 120 GGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYGGGG 157 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G GGGGG Sbjct: 101 GGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGGG 138 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G GG G G GGGGG Sbjct: 99 GYGGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGG 136 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP PPPP P Sbjct: 1931 PPPPPPPPPVEGKPKPPP--------HAPPPPPP 1956 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P P S PP P P P Sbjct: 311 PPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPPP 348 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 284 KKKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 K + PPP P GG G K P PPP P PP Sbjct: 136 KFQPPPPSPPNGGNVIGDGKRLTPTGPDPIHNEFQPPPPPPPPSPP 181 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 PPP P GG G K P PPP P PP Sbjct: 72 PPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPPPSPP 113 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 723 PPPPPXPXSXAXL--------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A + PT P P F PPPP P Sbjct: 206 PPPPPSPPNGANVIGDGKRLTPTGPDPVHNE---FQPPPPSP 244 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPP 779 RA R GG+ + P PPP P + LP PPPP Sbjct: 204 RAARRGGATIA---PTPPPPPLALP-LPPPPPP 232 >04_03_0904 + 20717005-20718087 Length = 360 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P P P PTP PP + + P PP P Sbjct: 328 PKPTPTPPTYTPTPTPPYHKPPPSYTPGPPPP 359 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P P P P + PTPP S PPPP Sbjct: 328 PKPTPTPPTYTPTPTPPYHKPPPSYTPGPPPP 359 >03_03_0139 + 14769393-14769764,14770113-14770193,14770537-14770737 Length = 217 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG K + GGGG G G GGG G +R Sbjct: 7 GGGGGGIAGKKRKAVGGGGGG------GGGGGSGYGER 38 >02_05_0407 + 28715332-28715385,28715528-28715680,28715810-28715872, 28715988-28716021,28716157-28716279,28716400-28716462, 28716655-28716748,28717049-28717094,28717180-28717247, 28717360-28717408,28717593-28717658,28718876-28719074, 28719344-28719386,28719719-28719923 Length = 419 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G GGG + GGGG G+ G GG GG K Sbjct: 20 GGGGGARRGGGGGGGGGGGGGKSQFSFGFGGLGGGSK 56 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >01_01_0073 + 555485-556315 Length = 276 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGG 728 G G GGGG GG G G E G GGG Sbjct: 184 GDATGTGGGGTVAGGGTATGGAGGGEGGGESGCGGG 219 >05_07_0219 - 28474661-28475146,28475979-28476644 Length = 383 Score = 28.3 bits (60), Expect(2) = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPP P P S A P PPPP Sbjct: 74 PPPSPPPLS-ATTPHPPPP 91 Score = 21.0 bits (42), Expect(2) = 1.9 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPP 818 PTP PP + L+ P P Sbjct: 112 PTPTPPPTSATLLWPRPRP 130 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 GGGG R GGGG G G GGGGG +RR Sbjct: 90 GGGGGGGYGQRG-GGGGYGGGGG-YGGGGGGGYGQRR 124 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG GGGG E G GGGGG Sbjct: 102 GGGGYGGGGGYGGGGGGGYGQRREGGYGGGGG 133 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GG G G G GGGGG Sbjct: 107 GGGGGYGGGGGGGYGQRREGGYG-GGGGYGGGRGGGGG 143 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGG-GGGXXKR 710 G G GGGG + GGG G G GG GGG R Sbjct: 109 GGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSR 151 >11_06_0292 - 22015603-22015716,22015774-22016163 Length = 167 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGGG + ++ R GGGG G G G Sbjct: 56 GGGGGGGEEEEPRIGGGGGAAGAGEREGRGRAG 88 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P LP P R PPPP P P Sbjct: 74 PPPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPPPQP 109 >09_06_0125 - 21011757-21012428 Length = 223 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXG 830 P+PPPP R L PPPP P G Sbjct: 169 PSPPPPPPRAPFL-APPPPPPVG 190 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPP 779 G L PPPPP P + P PPPP Sbjct: 163 GEPLPPPSPPPPP-PRAPFLAPPPPPP 188 >09_04_0430 + 17502387-17503505 Length = 372 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P A LPTPP R PP P P Sbjct: 170 PPPQPTPPRAAPLPTPP----RAPPQSTPPRAAPQSTP 203 >09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443, 4042529-4044001,4044222-4044733,4044824-4045021 Length = 902 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP P PTPPP + L P P Sbjct: 499 PPEPPSPRHPPRQPTPPPSPSQQPPLPTPQP 529 >08_01_0134 + 1067826-1068158 Length = 110 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P S P PPPP R PPPP P Sbjct: 2 PPPLPSSR---PPPPPPLPRPHP--APPPPCP 28 >07_03_1636 + 28290642-28291574 Length = 310 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 708 LLXXXPPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 L PP PP P A L P PP + L PPPP Sbjct: 158 LFETAPPSPPYVPPPPDAYLRKPSPPSPPPAKLSPPPPP 196 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PP P A L PPPP + L PP P Sbjct: 180 PSPPSPPP-AKLSPPPPPQTQTQPLAKPPAP 209 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PPPPP P+PP P + L P PP P Sbjct: 151 PPPPPPQLFETAPPSPPYVPPPPDAYLRKPSPPSP 185 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 711 LXXXPPPPPXPXSXA-XLPTPPPPXXR 788 L PPPPP P A P PPPP R Sbjct: 182 LGPPPPPPPQPSGDANENPPPPPPPLR 208 >06_03_1506 + 30641428-30642168 Length = 246 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXG-GGGVGRXAXEXGXGGGGG 722 G G GGGG G GGG G G GGGGG Sbjct: 104 GGGYGGGGGGSYGSGGMGSGYGGGYGSGYDYGGQGGGGG 142 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L+ PPPPP P P PP P PPPP P Sbjct: 72 LIKQTPPPPPPP------PPPPSPPATHDVGQPPPPPSLAAPP 108 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P + + PPPP L PPP Sbjct: 83 PPPPPSPPATHDVGQPPPP----PSLAAPPP 109 >04_03_0925 - 20856628-20856690,20856786-20856845,20856924-20857001, 20857127-20857192,20857542-20858675,20858991-20860283 Length = 897 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP--PPPXXRXS--XLFXPPPPGPXGXP 836 PPPP P + A P P PPP S PP P P P Sbjct: 7 PPPPEHPPTPAPAPAPASPPPHPAASGNEAAAPPKPNPPITP 48 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 30.7 bits (66), Expect = 2.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP 776 PPPPP P + +PTP P Sbjct: 128 PPPPPPPPARTPMPTPTP 145 >02_03_0367 + 18220099-18220905 Length = 268 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT---PPPPXXR-------XSXLFXPPPPGPXGXP 836 PPPPP P S P PP P + S LF P PP P P Sbjct: 153 PPPPPSPMSPKVTPAQQQPPQPAEKVHDASPPPSSLFPPLPPPPPPAP 200 >02_01_0035 - 220036-221419,222050-222801 Length = 711 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G G D GGG G G GGGGG Sbjct: 186 GVDGGGGSGATGGTDDALNDGGGAGSGMMLHGGGGGGG 223 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP-----PXXRXSXLFXPPPPGPXGXP 836 PPPPP P S A TP P P PPP P P Sbjct: 44 PPPPPLPASAAAPTTPSPNHSGDPSRPIPSQAPAPPPPPTADP 86 >01_05_0024 - 17262504-17263308,17264251-17264399,17264879-17264978, 17265829-17265953,17267565-17267743,17269648-17270698 Length = 802 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPP 779 GS + PPP P P A TPPPP Sbjct: 198 GSSPVTPPPPPRPNPSPPATRTTPPPP 224 >01_01_0656 + 5013609-5014256 Length = 215 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP S A LP PP PPPP P Sbjct: 104 PPPTTTASSAPLPLMPPAVAYELPFLPPPPPLP 136 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT-PPPPXXRXSXLFXPPPP 818 PPP P P P+ PPPP + S PPPP Sbjct: 71 PPPQPQPEPQPAAPSQPPPPQEQPS----PPPP 99 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P PTPPPP Sbjct: 128 PPPPPHPLPPPP-PTPPPP 145 >10_08_0236 + 16078162-16078731 Length = 189 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G G G GG G + G GGGGG Sbjct: 84 GSAYGSGNGSGSSSSQTSNGEGGYGGESDAGGGGGGGG 121 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P S P PPPP PPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPP---------PPPP 95 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPP 95 >09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052, 1741559-1741641,1741733-1741784,1742038-1742105, 1742279-1742345,1742426-1742505,1742576-1742640, 1742785-1742847,1743271-1743427,1743511-1743588, 1743677-1744219,1744321-1744497,1744534-1744788, 1745270-1745329,1745874-1745888,1746123-1746135, 1746819-1746934 Length = 793 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG R GGG G + G GGGGG Sbjct: 37 GGGGGGSGSPPHRFSRGGGGG--GGDGGGGGGGG 68 >08_02_0602 + 19183549-19184919 Length = 456 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G R GGG G G GGGGG Sbjct: 46 PHSSGSGSGSGGSHRGASGGGSGGGGGGGGGGGGGG 81 >07_03_0558 + 19461369-19462448 Length = 359 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G GGGGG Sbjct: 63 GGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGG 100 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGG-GVGRXAXEXGXGGGGG 722 G GGGG GGG GVG A G GGGGG Sbjct: 245 GGGGGGLGGGHGGGFGGGAGVGSGAG-GGVGGGGG 278 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGG-GVGRXAXEXGXGGGGG 722 G GGGG GGG GVG A G GGGGG Sbjct: 281 GGGGGGLGGGHGSGFGGGAGVGGGAG-GGVGGGGG 314 Score = 29.1 bits (62), Expect = 6.1 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGG-GVGRXAXEXGXGGGGG 722 G GGGG GGG GVG A G GGGGG Sbjct: 177 GGGGGGLGGGHGGGFGGGAGVGGGAG-GGVGGGGG 210 Score = 29.1 bits (62), Expect = 6.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G A G GGGGG Sbjct: 206 GGGGGFGGGGGSGLGGGQGGGFGAGGGAG-GGIGGGGG 242 >07_03_0177 - 14770777-14772045 Length = 422 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGGG GGGG G GGGGG K Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGK 109 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGGG Sbjct: 373 GGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGG 410 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 62 GKGGGFGGGGGGGGGGGFGGGGGFG-GGGGGGLGGGGG 98 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG K GGGG+G G G GGG Sbjct: 344 GFGKGGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFGGG 381 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + + P L PPPP P Sbjct: 122 PPPPPPPTTTTKPESLPAEADSEPELKAPPPPPP 155 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PPP P PPP + K P + + PPPPP Sbjct: 118 PPPPPPPPPPPTTTTKPES--LPAEADSEPELKAPPPPPPPPP 158 >05_05_0334 + 24156532-24156565,24156681-24156782,24157145-24157274, 24157361-24157445,24157525-24157666,24157762-24157894, 24157993-24158254,24158331-24158519,24158596-24158721, 24158809-24159195,24159288-24159398,24159629-24160423, 24161114-24161255,24161350-24162518,24162609-24162818, 24163010-24163478,24164037-24164464 Length = 1637 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GG D GGGG G A GGGG Sbjct: 1563 GGGDGGSGGGDSNRGGGGGWGTPAGGSDGGGGG 1595 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P PP S PPPP P P Sbjct: 65 PPPLPPLQPTPPPLPPTTLSCSSHPTPPPPPSPTTSP 101 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP---PXXRXSXLFXPPPPGP 824 PP PP S + PTPPP P S PP P P Sbjct: 76 PPLPPTTLSCSSHPTPPPPPSPTTSPSASSLPPVPTP 112 >05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149, 2754692-2754775,2755780-2757548 Length = 892 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P S PPPP Sbjct: 767 PPPPPPPFSVQQQQLPPPP 785 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS 794 PPPPP LP PPP R S Sbjct: 769 PPPPPFSVQQQQLPPPPPYHLRHS 792 Score = 26.2 bits (55), Expect(2) = 3.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 759 LPTPPPPXXRXSXLFXPPPP 818 LP PPPP PPPP Sbjct: 766 LPPPPPPPFSVQQQQLPPPP 785 Score = 22.2 bits (45), Expect(2) = 3.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 732 PPXPXSXAXLPTPPP 776 PP P LP PPP Sbjct: 731 PPRPPVTQPLPPPPP 745 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXS--XLFXPPPPGP 824 PPPP P P PPPP S L PPPP P Sbjct: 355 PPPPPP------PPPPPPVYYSSYVMLDRPPPPPP 383 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP + PPP P Sbjct: 355 PPPPPPP------PPPPPVYYSSYVMLDRPPPPP 382 >03_05_0252 - 22403504-22404676 Length = 390 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -3 Query: 814 GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGG + R GGGG G A G GGGGG Sbjct: 5 GGGGGGRAGRVGGGGGGG--AGGGGGGGGGG 33 >03_04_0231 + 19050105-19050567,19051376-19052648,19052743-19054171 Length = 1054 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -3 Query: 802 KXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 K +D GGGG+G G GGG +RR Sbjct: 11 KNEDNAGGGGGGLGTGGNGGGGGGGSANGRRR 42 >03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539, 5252836-5253019,5253564-5253814,5253921-5254024, 5254143-5254281 Length = 363 Score = 30.3 bits (65), Expect = 2.6 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 6/39 (15%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPP------PPPXPXSXAXLPTPPPP 779 R RGGG LL P PPP P S A TPPPP Sbjct: 11 RRLRGGGHRLLPSRPSTSAASQPPPPPPSAA---TPPPP 46 >02_03_0279 + 17250347-17252098 Length = 583 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP L PP P Sbjct: 124 PPPPPPP------PPPPPPLFAKPDLDSTAPPQP 151 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G A G GGGGG Sbjct: 80 GDGTGGGGGNTGGGGGEVTGGGG-GGVAEGTGIGGGGG 116 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG + GGGG G G GGGGG Sbjct: 215 GLDGGGGGGFTGGRGGGLTGGGGEGNTG---GGGGGGG 249 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +3 Query: 711 LXXXPPPPPXPX-------SXAXLPTPPPPXXRXSXLFXPPPPGP 824 L PPPPP P + P PPPP R S P GP Sbjct: 269 LPPIPPPPPMPALSVCGRAAAPPPPPPPPPARRTSGAASPAASGP 313 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G G + GG G+GR + G GGGG Sbjct: 92 PPGVGRGRGRGDIGTKPGGRGIGRGQDDGGSKGGGG 127 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGG R + G GGGGG Sbjct: 181 GGSYGQGGGGGGGGGGQ--GGGAHARGYGQGGGGGGGG 216 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +3 Query: 726 PPPPXPXSXAXLP---TPPP---PXXRXSXLFXPPPPGPXG 830 PPPP P P TPP P S PPPP P G Sbjct: 661 PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEG 701 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +3 Query: 726 PPPPXPXSXAXLP---TPP---PPXXRXSXLFXPPPPGPXG 830 PPPP P P TPP P S PPPP P G Sbjct: 694 PPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAPEG 734 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +3 Query: 726 PPPPXPXSXAXLP---TPPP---PXXRXSXLFXPPPPGPXG 830 PPPP P P TPP P S PPPP P G Sbjct: 628 PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTPEG 668 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLP--TPPPP---XXRXSXLFXPPPPGPXGXP 836 P PPP P S P +PPPP + PPPP P P Sbjct: 1135 PLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISP 1177 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +3 Query: 726 PPPPXPXSXAXLP--TPPPPXXRXS---XLFXPPPPGPXGXP 836 PPPP P P +PPPP S + PPPP P P Sbjct: 1152 PPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +3 Query: 726 PPPPXPXSXAXLP--TPPPPXXRXS---XLFXPPPPGPXGXP 836 PPPP P P +PPPP S + PPPP P P Sbjct: 1184 PPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILP 1225 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P A + PPPP + PPPP P P Sbjct: 1178 PPPVKSPPPPAPVILPPPP------VKSPPPPAPVISP 1209 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P A + PPPP + PPPP P P Sbjct: 1210 PPPVKSPPPPAPVILPPPP------VKSPPPPAPVISP 1241 >11_04_0246 - 15311912-15312481 Length = 189 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GG GR G G GGG Sbjct: 71 GEGGGGDGGGDGGGEDGGDGGREGSGDGGGEGGG 104 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G GG G G GGGGG Sbjct: 180 GLTDSGGGGGWTGGGNGGGGSGGGGGARGSSGGGGGGG 217 >09_02_0601 + 11112201-11112386,11112471-11114080,11114345-11114579, 11115233-11115358 Length = 718 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P+ PPP R PPP P P Sbjct: 413 PPSPPEPPSPRH-PSSPPPL-RSPPRQPTPPPSPSQQP 448 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P A P PPPP PPPP P Sbjct: 91 PEAPPSPPLLALPPPPPPPPP------PPPPPQP 118 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 8/44 (18%) Frame = +3 Query: 723 PPPPPX--------PXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPP + PPP GP G Sbjct: 138 PPPPPNREPGHGYHPAPAFYPPQPPPSHDEPGYGYRPPPVGPPG 181 >07_03_1065 + 23711677-23711837,23711859-23712180,23713071-23713277 Length = 229 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GG G G GG G A G GG GG Sbjct: 80 GSGGNGGNGGSGGKAGSGGSGGRAGSAGSGGNGG 113 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 390 PXPPPXPTXPPPXXXXKXXXGXXXPXPXXKK 482 P PPP P PPP K P P KK Sbjct: 125 PAPPPPPPPPPPTAEEKKLLLFPPPLPPRKK 155 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP L PPP R + P P P P Sbjct: 132 PPPPPTAEEKKLLLFPPPLPPRKKAMLFPLPLPPRKKP 169 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L PPP P P P PP R L PPP P P Sbjct: 143 LLLFPPPLPPRKKAMLFPLPLPP--RKKPLLYPPPLPPKKKP 182 >06_03_1310 + 29238644-29240260 Length = 538 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 GG + L P P PTPPPP PPPP Sbjct: 373 GGRTPLAPHRSPLPHHMPPRRTPPTPPPPSSPTPSHLPPPPP 414 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP + + LP PPP PP P Sbjct: 398 PPPPSSPTPSHLPPPPPTYSESPKSSMPPSTSP 430 >06_03_0502 + 21493442-21494341 Length = 299 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGGXXKR 710 GG GVG A G GGGGG +R Sbjct: 49 GGEGVGYGAWAGGGGGGGGEQRR 71 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P PTPP P + PPP P Sbjct: 126 PPTPPSPPPYVPPPTPPSPPP-----YVPPPSPP 154 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP---PPXXRXSXLFXPPPPGPXGXP 836 PP PP PTPP PP + PPP P P Sbjct: 106 PPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPP 146 >05_07_0217 - 28469229-28469798 Length = 189 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GG GR G G GGG Sbjct: 71 GEGGGGDGGGDGGGEDGGDGGREGSGDGGGEGGG 104 >05_02_0122 - 6840840-6841307 Length = 155 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGG VG G G GG Sbjct: 76 GRGAGEGGGGGGAVEGGAGGGGAVGAGGGGGGVVGAGG 113 >05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 Length = 368 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G GG GGGG G+ + G GGGGG Sbjct: 203 PPGNGNGGG-------GGGGGGGKKKGKKGGGGGGG 231 Score = 28.7 bits (61), Expect = 8.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVG 761 G GGGG K K + GGGG G Sbjct: 212 GGGGGGGKKKGKKGGGGGGGG 232 >04_04_1049 + 30414545-30414596,30414732-30414853,30415121-30415198, 30415329-30415459,30415644-30417552,30417797-30417836, 30418194-30418259,30418583-30418734 Length = 849 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPP + + +P PP P PPP Sbjct: 483 PPPPRGNAPSWVPPPPQPRGNAPSCVPPPP 512 Score = 28.7 bits (61), Expect = 8.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXR 788 PPPP P A PPPP R Sbjct: 495 PPPPQPRGNAPSCVPPPPQSR 515 >04_04_0679 + 27214577-27215023 Length = 148 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 835 GXPXGPGGG-GXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GPGGG G + GG G G GGGGG R Sbjct: 42 GWASGPGGGWGYGHSSAQSPGGTAFGFGFGGGGGGGGGGVGGR 84 Score = 28.7 bits (61), Expect = 8.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGG + GG G G A G G GGG Sbjct: 91 GGHGGGFGWAGGQGHGGWGAGAGAFGGGSGSGGG 124 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.9 bits (64), Expect = 3.5 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 9/43 (20%) Frame = +3 Query: 723 PPPPPX-----PXSXAXL----PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S A L P PPPP PP P P Sbjct: 17 PPPPPATRARPPCSSAHLLPPPPPPPPPPPYVPPHLLPPSPAP 59 >03_06_0642 + 35239658-35240083,35240167-35240238,35240305-35240919, 35241253-35241435,35241604-35241663,35241733-35241936, 35242497-35242745,35243609-35243707,35243760-35243858, 35244463-35244480,35244668-35244862,35244981-35245073, 35245265-35245531,35245884-35246102 Length = 932 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P S + P PPP + PPP P P Sbjct: 54 PPPTPRSRSRSPLPPPEQQKQQ---QPPPTTPPPAP 86 >03_06_0346 - 33287761-33287895,33288418-33288489,33288577-33288645, 33288782-33288847,33289025-33289228,33291194-33291445 Length = 265 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G GGGG + G + G GGGGG +RR Sbjct: 19 GGGGGGGGGRGLEAAASGVTEQSNGSRGGGGGGGAGRRR 57 >03_05_0928 + 28888405-28889121 Length = 238 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 820 PGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 PGGGG GG VG G GG GG + R Sbjct: 86 PGGGGPPGYMHMAAMGGAVGGGGGVDGGGGSGGRRRTR 123 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 29.9 bits (64), Expect = 3.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXS---XLFXPPPPGPXGXP 836 LL PPPPP P LP P S PPPP P G P Sbjct: 49 LLPHQPPPPPPP---PPLPQPQHHHDAVSTDESRTPPPPPPPMGAP 91 >03_02_0738 - 10824121-10825572 Length = 483 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P S L PPPP S PPPP Sbjct: 79 PPPSPPSSSPPPLSFPPPPPPPSS----PPPP 106 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP +F P PPP P+ PPP Sbjct: 88 PPPLSF-----PPPPPPPSSPPP 105 Score = 28.7 bits (61), Expect = 8.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P S + PPP F PPPP P P Sbjct: 78 PPPPSPPSSS-----PPPLS-----FPPPPPPPSSPP 104 >02_05_0860 - 32296743-32296769,32297328-32297357,32298432-32298503, 32298967-32299812 Length = 324 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPPPPXXRXSXLF 803 PP PP P + A +P PPPP + LF Sbjct: 151 PPVPPAPTPTAAAVPPPPPPQQQTPMLF 178 >02_05_0269 + 27307837-27308424 Length = 195 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GG GR G G GGG Sbjct: 71 GEGGGGDGGGDGGGEDGGDGGREGSGDGGGEGGG 104 >02_03_0120 + 15463163-15465250 Length = 695 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPP----PXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P + LP PP P PPPP P Sbjct: 284 PPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSPPPPPHP 321 >01_07_0255 - 42322111-42322308,42322658-42322750,42323127-42323344, 42323476-42323642,42324097-42324207,42324267-42324409, 42324492-42324710,42324975-42325055,42325202-42325381, 42325971-42326301,42326775-42326888,42327036-42327127, 42327631-42328059 Length = 791 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 LL PPP P + LP P S + PPPP P Sbjct: 2 LLRLRPPPQPAASLASFLPFSPFRRFLHSPSWRPPPPPP 40 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 29.9 bits (64), Expect = 3.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 P PPP P +P PPPP Sbjct: 47 PQPPPPPYQVMPVPPPPPP 65 Score = 29.1 bits (62), Expect = 6.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP + + PPPP P G P Sbjct: 47 PQPPPPPYQVMPV--PPPPPPVGLP 69 >01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831, 7688011-7688469,7690648-7690788,7691771-7692421 Length = 539 Score = 29.9 bits (64), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-PPPGP 824 PPP P P PP P ++ P PPP P Sbjct: 435 PPPLPPAAMLQRFPVPPVPGMVPHPMYRPIPPPSP 469 >01_01_0929 - 7344911-7345978 Length = 355 Score = 29.9 bits (64), Expect = 3.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PP PP P S P PPPP Sbjct: 20 PPLPPSPPSKTRRPPPPPP 38 >11_06_0419 + 23324772-23325035,23325200-23325214 Length = 92 Score = 29.5 bits (63), Expect = 4.6 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G GGGG + R GGGG R G GGGGG K Sbjct: 5 GDGGGGWRR---RGGGGGGGWRWC---GRGGGGGIAK 35 >10_07_0134 + 13289641-13290216,13290435-13290914 Length = 351 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G GGGG + G GG G GGGGG KRR Sbjct: 77 GDGGGGGAASEDEEDGCGG--------GGGGGGGEKKRR 107 >09_04_0506 - 18188785-18190599 Length = 604 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 G L PPP P PPP + L PPPP Sbjct: 41 GDGFLQSSHPPPQPPPPPQQQQQPPPISQQPPPLQAPPPP 80 >09_04_0112 - 14757947-14758972 Length = 341 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P A LP PP P R PG G Sbjct: 97 PPPPPPP---ALLPAPPMPPHRGEETPEVRLPGVDG 129 >09_02_0369 - 8012470-8013120 Length = 216 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPP P + A P PPPP PPP Sbjct: 28 PPPAPHAAATKPPPPPP--HDDPPLKPPP 54 >08_01_0135 + 1068948-1069730 Length = 260 Score = 29.5 bits (63), Expect = 4.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR 788 PPPPP + PTPP P R Sbjct: 38 PPPPPVAFAVPLSPTPPSPHIR 59 >08_01_0060 - 413088-413999 Length = 303 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P L P S LF PPP Sbjct: 33 PPPPPPPPLPFHLHHHPLDPSPSSSLFPPPP 63 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 29.5 bits (63), Expect = 4.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS 794 P PPP P S LP PP P + S Sbjct: 1070 PSPPPLPSSPPPLPRPPCPVFQDS 1093 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A PT P P P PP P Sbjct: 55 PPPPPPPPTPAVEPTLPIPPAST----PPTPPQP 84 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPP R PPPP G P Sbjct: 212 PPPMGPPQVRPGMPGGPPPGMRPG---MPPPPFRPGMP 246 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP R PPP G P Sbjct: 201 PPPPPGPFMRGP-PPMGPPQVRPGMPGGPPPGMRPGMP 237 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P A P P P + + PPP P P Sbjct: 51 PPPPADPPQYA--PPPAAPQPQPYYPYEPPPHNPAPSP 86 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP----PXXRXSXLFXPPP 815 PPPPP P L PPP P + PPP Sbjct: 92 PPPPPPPLPQHRLEPPPPHYGFPPRGHPDAYSPPP 126 >05_07_0236 - 28582157-28582552,28582639-28582911,28583324-28583560, 28583653-28583694,28583782-28583964,28584393-28584524, 28585605-28586057 Length = 571 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP S LP+PPPP L PP P Sbjct: 98 PPPSSGSGHTLPSPPPP---LPPLLPPPQP 124 >05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 Length = 433 Score = 29.5 bits (63), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG R GGGG GGGGG Sbjct: 14 GNPRGGGGGG-----PRGCGGGGPRSGGGGGPRGGGGG 46 >05_03_0163 + 9070781-9071320 Length = 179 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GG + GGGG GR G GGGGG +R Sbjct: 16 GAGGWSQR-AEGWGGGG-GRSQRAEGGGGGGGRSRR 49 >03_05_0576 + 25765137-25766420 Length = 427 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 R RGG P P P P P PPPP + PP Sbjct: 59 RKKRGGPEAPPSPSPSPSPSPPPQPSSPPPPPPSPPPAAAVSVSPP 104 >03_05_0292 + 22846273-22846377,22847161-22847823 Length = 255 Score = 29.5 bits (63), Expect = 4.6 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -3 Query: 817 GGGGXKXKDXRXXGG--GGVGRXAXEXGXGGGGG 722 GGGG + R GG GG GR A G GGG Sbjct: 57 GGGGGRGDGARDGGGARGGGGRGARGGGGARGGG 90 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + R GGGG G A + G GGG Sbjct: 48 GGGGGRG---RGGGGGGRGDGARDGGGARGGG 76 >03_05_0161 + 21400580-21401695 Length = 371 Score = 29.5 bits (63), Expect = 4.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPXSXAXLPTPPPP 779 R GGG PPPPP P PPPP Sbjct: 13 RKGAGGGGTTT---PPPPPPAQQQQQQPLPPPP 42 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 814 GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGG GGGG G A G GGGGG Sbjct: 88 GGGFGGGAGGPLGGGGGGWGAGGGGGGGGGG 118 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 P P GG R GGG G G GGGG R Sbjct: 49 PVAPAGGDFSRFGGRGRGGGAGGGGWGRGGGGGGGAGGYR 88 >01_06_1651 + 38909410-38909625,38909713-38910181,38910265-38910899 Length = 439 Score = 29.5 bits (63), Expect = 4.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG D GGGG G+ + G G G Sbjct: 224 GGGGGGDSDDGNEGGGGEGKGKHKHSGGDGDG 255 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.5 bits (63), Expect = 4.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 111 PPPPPPPHLLHYYGHPPPP---------PPPPPP 135 >12_02_1122 - 26244667-26245299 Length = 210 Score = 29.1 bits (62), Expect = 6.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVG----RXAXEXGXGGGGG 722 P PGG R GGG G R + G GGGGG Sbjct: 29 PPSPGGASPSIPPGRGGGGGTSGGDNNRGSRGGGNGGGGG 68 >12_01_0838 - 7830944-7831444 Length = 166 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG + + GGGG G G G G G Sbjct: 95 GYGYGQGNGGAQGQGSGGGGGGGGGGGGGGSGQGSGSG 132 Score = 29.1 bits (62), Expect = 6.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G + G GGGGG Sbjct: 114 GGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGG 147 Score = 28.7 bits (61), Expect = 8.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG G G G G GGGGG Sbjct: 112 GGGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGG 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,879,515 Number of Sequences: 37544 Number of extensions: 590097 Number of successful extensions: 18152 Number of sequences better than 10.0: 303 Number of HSP's better than 10.0 without gapping: 3067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11499 length of database: 14,793,348 effective HSP length: 83 effective length of database: 11,677,196 effective search space used: 3082779744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -