BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L08 (1044 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 46 5e-05 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 42 8e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 40 0.003 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 40 0.004 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 39 0.008 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.010 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.031 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 37 0.031 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 37 0.031 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 37 0.031 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.031 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 36 0.071 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.071 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.094 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 34 0.22 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 34 0.22 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 34 0.22 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.29 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.38 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 33 0.50 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.50 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.50 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.67 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 32 0.67 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.88 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 32 0.88 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 32 0.88 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 1.5 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 31 2.0 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 2.0 SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.5 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 30 3.5 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 6.2 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 6.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 6.2 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 29 6.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 6.2 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 8.2 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 8.2 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 SB_42986| Best HMM Match : Glycos_transf_4 (HMM E-Value=1.5) 29 8.2 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.2 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPP-PXXRXSXLFXPPPPGPXG 830 S L PPPPP P A LP PPP P + L PPPP P G Sbjct: 706 SGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPG 749 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G S + PPPPP P LP PPPP PPPPG G P Sbjct: 688 GSSLSVPPPPPPPPPPLLSGTLPMPPPP--------PPPPPGCAGLP 726 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAX---LPTPPPPXXRXSXLFXPPPPGP 824 GS L PPPPP P + +P PPPP PPPP P Sbjct: 688 GSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXP-XSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A LP PPPP PPPP P P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPP-PGCAGLPPPPPPIDVP 763 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPX----SXAXLP--TPPPPXXRXSXLFXPPPPGP 824 PPPPP P S + P PPPP L PPPP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPP 717 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P S L PPPP P P Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPP 703 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PPPP PPPP P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PPPP PPPP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P PPPP PPPP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP S PPPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPS---PPPPPQPPPPP 399 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPP--PPPPPAPPPPP 424 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P P PP PPPP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.023 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPP P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P P PP PPPP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P + P PPPP L PP Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PPPP + PP Sbjct: 410 PPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPP 424 PPP P P PP + PPP P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPP 391 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A LP PPP S PPPPG P Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPS---QPPPPGGNAPP 954 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPP-PPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P PP PP S PPPP P P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 PPP P GG P PP PPP P PP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 315 GGXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P G PPP P PPP P PPP Sbjct: 961 GSAPPPGGGAPPLPPPPGGSAP---PPPPPPPPPPPP 994 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPPGPXG 830 PPPPP P P PPP R S L PPPP P G Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S P PPPP R + PPPGP Sbjct: 376 PPPPPIEGRPPSSLGNPPPPPPPGRGA-----PPPGP 407 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPT---PPPPXXRXSXLFXPPPPGPXG 830 L PPPPP + P+ PPPP R S PPPP G Sbjct: 283 LGIQPPPPPSRGAAPPPPSRGAPPPPPSRGSA--PPPPPARMG 323 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P PPPP R S PPPP P Sbjct: 315 PPPPPARMGTAP-PPPPPSRSSQ--RPPPPSRGAPP 347 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/75 (25%), Positives = 20/75 (26%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP G P + PP PPP PPP S Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP 365 Query: 476 KKKKXXXGXXXPPPP 520 G PPPP Sbjct: 366 PPPPPVGGPPPPPPP 380 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPP-----PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P A P PPPP PPPP G P Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGP---PPPPPPIEGRP 385 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPP----PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP PP P S P PPPP + PPPP P Sbjct: 298 PPPSRGAPPPPPSRGSAP-PPPPARMGT---APPPPPP 331 Score = 28.7 bits (61), Expect = 8.2 Identities = 22/77 (28%), Positives = 22/77 (28%), Gaps = 1/77 (1%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXP-HXPPPXSXXXKXXGXXXPXXX 472 PPP G P PP R PP PPP S G P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPS-----RGAPPPPSM 351 Query: 473 XKKKKXXXGXXXPPPPP 523 G PPPPP Sbjct: 352 GMAPPPVGGAAPPPPPP 368 Score = 28.7 bits (61), Expect = 8.2 Identities = 18/76 (23%), Positives = 18/76 (23%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP G P PP PPP PP Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 364 Query: 476 KKKKXXXGXXXPPPPP 523 G PPPPP Sbjct: 365 PPPPPPVGGPPPPPPP 380 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/46 (45%), Positives = 23/46 (50%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 GGG+ + PPPPP S A P PPPP PPPP P G Sbjct: 286 GGGAPV----PPPPPADGS-APAPPPPPPPGGAPPPPPPPPPPPPG 326 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P A P PPPP PPPPG G P Sbjct: 304 PPPPPPPGGAPPPPPPPP---------PPPPGDGGAP 331 Score = 34.3 bits (75), Expect = 0.16 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P + P PPPP S PPPP P G P Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAP 314 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP + PPPPG G Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAP--PPPPPGFGG 709 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAX-LPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P PPPP PPPP G P Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAP 700 Score = 37.5 bits (83), Expect = 0.018 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PPPP PPPP P G Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIG 696 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 38.3 bits (85), Expect = 0.010 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + P+PPPP + PPPP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 35.5 bits (78), Expect = 0.071 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P S A PPPP + PPPP Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 35.1 bits (77), Expect = 0.094 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPP P PPPP L PPPPG Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPPG 220 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + A PPPP + PPPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P PPPP + PPPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 29.9 bits (64), Expect = 3.5 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP--GPXGXP 836 PPPPP A +P P P S PPPP GP P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAAS----PPPPSGGPPPPP 199 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-------PPPGPXGXP 836 PPPPP P PPPP + + P PP P G P Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP +P PPPP + PPPP P Sbjct: 51 PPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR 788 PPPPP P PPPP R Sbjct: 65 PPPPPRRGFYDDYPPPPPPPRR 86 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PPPP PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PPPP F PPPP Sbjct: 464 PPPPPPPPPPP--PPPPPPPPPPPPPFPPPPP 493 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPPP Sbjct: 476 PPPPPPPPPPPPFPPPPPP 494 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + PPPP L PPPP P P Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 380 Score = 34.3 bits (75), Expect = 0.16 Identities = 22/81 (27%), Positives = 25/81 (30%) Frame = +2 Query: 281 KKKKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXX 460 ++ PPP PG G PP PPP + PPP G Sbjct: 210 ERSSGPPPPPPGRG-----PSQRSLAPPPTGSSRPLPAPPPGENRPPP-PMRGPTSGGEP 263 Query: 461 PXXXXKKKKXXXGXXXPPPPP 523 P G PPPPP Sbjct: 264 PPPKNAPPPPKRGSSNPPPPP 284 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRX-SXLFXPPPPGP 824 PPPP P PPPP R S PPPP P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P S +P PPPP + PPPP Sbjct: 318 PPPPPPSRDQVPLPPPPL--RGQIAPPPPP 345 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P S P PPPP PPPP P Sbjct: 298 PPLPPSRDQAPAPPPPLNA-----TPPPPPP 323 Score = 28.7 bits (61), Expect = 8.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 696 GGSXLLXXXPPPPPX--------PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G S PPPPP P + P PPPP S PPP P Sbjct: 185 GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 239 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 711 LXXXPPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPP 815 L PPPPP P S P PPPP F P Sbjct: 368 LGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 404 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP G P Sbjct: 198 PPPPPPPGFPGGAPPPPPP-----PFGAPPPPALNGGP 230 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 735 PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P + P PPPP PPPP P G P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAP 221 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + PPPP L PPPP P P Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP 292 Score = 34.3 bits (75), Expect = 0.16 Identities = 22/81 (27%), Positives = 25/81 (30%) Frame = +2 Query: 281 KKKKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXX 460 ++ PPP PG G PP PPP + PPP G Sbjct: 122 ERSSGPPPPPPGRG-----PSQRSLAPPPTGSSRPLPAPPPGENRPPP-PMRGPTSGGEP 175 Query: 461 PXXXXKKKKXXXGXXXPPPPP 523 P G PPPPP Sbjct: 176 PPPKNAPPPPKRGSSNPPPPP 196 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP S PPPP P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 33.1 bits (72), Expect = 0.38 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P S +P PPPP + PPPP Sbjct: 230 PPPPPPSRDQVPLPPPPL--RGQIAPPPPP 257 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P S P PPPP PPPP P Sbjct: 210 PPLPPSRDQAPAPPPPLNA-----TPPPPPP 235 Score = 28.7 bits (61), Expect = 8.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 696 GGSXLLXXXPPPPPX--------PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G S PPPPP P + P PPPP S PPP P Sbjct: 97 GNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRP 151 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 711 LXXXPPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPP 815 L PPPPP P S P PPPP F P Sbjct: 280 LGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 316 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 36.7 bits (81), Expect = 0.031 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 35.9 bits (79), Expect = 0.054 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP S PPPP P P Sbjct: 205 PPPPPRPPPS---PPPPPPPPSPSPP-RPPPPPPPSPP 238 Score = 35.5 bits (78), Expect = 0.071 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 S + PPPP P S P PPPP S PPPP P Sbjct: 199 SQITQPPPPPPRPPPS----PPPPPPPPSPSPPRPPPPPPP 235 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-PPPGPXGXP 836 PPPPP P P PPP R P PPP P P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P S + + PPPP R PPPP P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSP 226 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 735 PXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P S P PPPP S PPPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSP 224 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 723 PPPPPXPXS--XAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P A LP PPP L PPP Sbjct: 231 PPPPPSPPRPLAAKLPEPPPIPNMPPTL--PPP 261 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP + S PPPP P P Sbjct: 683 PPPPPPPPPPP--PPPPPPPPQPS---TPPPPPPSTPP 715 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP P P G P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P+ PPP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPP 708 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S + P PPPP PPPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPP---------PPPPTP 1186 Score = 35.9 bits (79), Expect = 0.054 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P+PPPP PPPP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPP---------PPPPPPPPTP 1186 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP S PPPP P P Sbjct: 1157 PPPPPPP--------PPPPPSSPSP--PPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 8.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 35.5 bits (78), Expect = 0.071 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A LP PPPP + + P GP Sbjct: 424 PPPPPPP---APLPPPPPPPPQPTTALPDPLQGP 454 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.071 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP---PPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P PP PP PPPP P P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P PPPP PPPP G P Sbjct: 384 PPPPPPPTNG---PPPPPPPTNGPP---PPPPPTNGPP 415 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP---PPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP PP PPPP P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 31.9 bits (69), Expect = 0.88 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +3 Query: 696 GGSXLLXXXPP---PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GG + PP PP P P PPPP + PPPP P P Sbjct: 340 GGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNK-----PPPPPPPTNGP 384 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPX-----PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNG----PPPPPPPTNGP 404 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/55 (27%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP + PPP + PPP K P PPPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 35.1 bits (77), Expect = 0.094 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A PP R PPP P G P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPP 779 G + PPPPP P S P PPPP Sbjct: 76 GPAAVIPPPPPPPPPASNVPAPPPPPP 102 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 753 AXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 A +P PPPP S + PPPP P P Sbjct: 79 AVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGGG G + GGGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = -3 Query: 817 GGGGXKXKDXR-----XXGGGGVGRXAXEXGXGGGGG 722 GGGG + + R GGGG G G GGGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P A P PPPP PPPP P P Sbjct: 162 PPPPNPPPPNA--PYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAX-LPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PPPP PPPP P Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P + P P PP PPPP P P Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 33.1 bits (72), Expect = 0.38 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P P PP PPPP P P Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 33.1 bits (72), Expect = 0.38 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 726 PPPPXPXSXAXL----PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P L P PPPP PPPP P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP + + PPP P P Sbjct: 95 PPPPYPPYPPPPPYPPPP----NPPYPPPPNAPYPPP 127 Score = 31.9 bits (69), Expect = 0.88 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PPP + + PPP P Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PP P + PP P P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PP PP PPPP P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PP PP P P PP PP PPPP P Sbjct: 206 PPNPPYP-PPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 28.7 bits (61), Expect = 8.2 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 315 GGXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 GG P PPP P PPP P PPP P P Sbjct: 81 GGHPPTNFSPNPPYPPPP-----YPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP + + PPP P P Sbjct: 175 PPPPYPPPPNP-PYPPPP----NPPYPPPPNAPNPPP 206 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P A P PPP + PPP P P Sbjct: 50 PPPPPPSPPAAAPAAPPP-PAAAPAAPPPPAAPPAAP 85 Score = 31.9 bits (69), Expect = 0.88 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP A P PPP P PPP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P LP PPPP + + PPP P P Sbjct: 85 PPPPPP-----LPAPPPPPAQPAP--QPPPAPPHFLP 114 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 723 PPPPPXPXS----XAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + LP PPPP + + P PP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PP P + P PPPP L PPPP Sbjct: 72 PAAPPPPAAPPAAPPPPPP------LPAPPPP 97 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +3 Query: 723 PPPP----PXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPP P P + P PPPP PPPPG Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPG 592 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG D GG G G G GGGGG Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG D GGG G G GGGGG Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG GGGG G G GGGGG R Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P PTPPPP P PPGP Sbjct: 95 PPPPATPPPPTMPPTPPPPQ-------TPAPPGP 121 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GG GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GG G GGGG G G GGGGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G G G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG GGGG G G GG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P + LP PP PPPP P G P Sbjct: 280 PPPPPPLTGGMLP---PPFGGHPAAAPPPPPLPAGVP 313 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPPP Sbjct: 303 PPPPPLPAGVPAPPPPPPP 321 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP A P PPPP PPPP P Sbjct: 292 PPPFGGHPAAAP-PPPPLPAGVPAPPPPPPPP 322 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P A PPPP + PPPP P Sbjct: 301 PPPPPPTDFA----PPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXL-----FXPPPPGP 824 PP P A P PPPP + F PPPP P Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP 306 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A PPP PPPP P Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPT--XPPP 425 PPP F P PPP PT PPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPP 325 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP + P PPPP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.38 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR------XSXLFXPPPPGPXGXP 836 PPPPP P P PPPP S + P PP P P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPP 145 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 S ++ PPPPP P +P S PPGP P Sbjct: 131 SHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAP 175 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.7 bits (71), Expect = 0.50 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 729 PPPXPXSXAXLPTPP--PPXXRXSXLFXPPPPGPXG 830 PPP P P PP PP R P PPGP G Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPG 1288 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 12/50 (24%) Frame = +3 Query: 723 PPPPPX-----PXSXAXLPTPPP---PXXRXSXLFXPP----PPGPXGXP 836 PPPPP P LP PPP P PP PPGP G P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT--PPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP + P PPGP G P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQ-----PPGPPGPPGPP 1287 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.7 bits (71), Expect = 0.50 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P + PTPP P P PP P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMP 209 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P P P + P PP P P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPP 352 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 32.3 bits (70), Expect = 0.67 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP LP PP P P PGP G P Sbjct: 272 PPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP A LP PP P S P PPGP G P Sbjct: 612 PPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P A P+PP P P P GP G P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PP PP P P P P P PPGP G Sbjct: 41 PPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPG 76 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P A P+PP P P P GP G P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P P P P PGP G P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP LP PP P S P PPGP G P Sbjct: 782 PPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP LP PP P S P PPGP G P Sbjct: 867 PPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP LP PP P S P PPGP G P Sbjct: 697 PPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 765 TPPPPXXRXSXLFXPPPPGPXGXP 836 TPPPP + P PPGP G P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPP 51 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + P PP P P GP G P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP LP P P P PGP G P Sbjct: 187 PPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P S P PPPP PPPPGP G Sbjct: 19 PACTLSCCETPPPPPPYEA-----PPPPPGPPG 46 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P S P+PP P P P GP G P Sbjct: 625 PGPPGPASP---PSPPGPPGPPGPKGPPGPNGPLGPP 658 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.3 bits (70), Expect = 0.67 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPP P PPPP PPPPG Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPPG 684 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P P PPPP + PP P P G Sbjct: 653 PPPPPGGGMFPPPPPPPPG--GGVPGPPKPPPPG 684 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP P PP P Sbjct: 653 PPPPP---GGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL 800 PPPPP P P PPP S L Sbjct: 664 PPPPPPPGGGVPGPPKPPPPGNLSTL 689 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.9 bits (69), Expect = 0.88 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G + G GGGGG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 814 GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGG D GGGG G G GGGGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG D G GG G G GGGGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG + G G + GGG G GGG G GGG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGGG GGGG G G GGGGG K Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGVIK 879 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G GGGGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G G GGGGG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGG G G GGGGG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGG G G GGGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG F G G GGG G GGG G GGG Sbjct: 821 GGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGGG G G GGGGG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G GGGGG Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 29.1 bits (62), Expect = 6.2 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GGGGG + G G GGG G GGG G GGG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GG G D GGGG G G GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG D GGGG G + G G GG Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 28.7 bits (61), Expect = 8.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXG-GGGVGRXAX-EXGXGGGGG 722 G G GGGG D G GGG G G GGGGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G GGG GGGG G G G GGG Sbjct: 174 PRGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGG 209 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + R GGG G G GGGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGG 210 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.9 bits (69), Expect = 0.88 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPP---PPXXRXSXLFXPPPPGP 824 PPP P A P PP PP PPPP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 29.1 bits (62), Expect = 6.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P P PP + P G G P Sbjct: 198 PPPPAPPGALIPPPPAPPTFNNNQNMGYPSNGNMGYP 234 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG D G G A G GGGGG Sbjct: 46 GGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPP 424 PP PG PG PP R PPP P PPP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A PP P PPPP P Sbjct: 6 PPPPPPPPIAAEFTAPPAP---------PPPPNP 30 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 G +L P PP + +P PPP + F PPPP P Sbjct: 404 GPPMLNMAPSIPPWQTTPGYIPPPPPGFPQ----FQPPPPPP 441 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP----PPXXRXSXLFXPPPPGP 824 PPPP A P PP PP + PPPP P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPP P P+ PP PPPPG Sbjct: 400 PPPPGPPMLNMAPS-IPPWQTTPGYIPPPPPG 430 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +P PPPP PPPP Sbjct: 196 PPPPPGPGG---IPPPPPPIRGG---VPPPPP 221 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG + GGG+G G GGGGG Sbjct: 1808 GGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG---GGGG 722 G G GGGG GGGG+ E G G GGGG Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G+G G GG GG Sbjct: 1775 GGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGG 1812 Score = 29.1 bits (62), Expect = 6.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG+G G G GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 GGGG GGGG G A G G GG Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P PPPP S L PP P Sbjct: 158 PPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGG Sbjct: 195 GYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_26832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 635 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P PP P S +P PP P R + + P PPGP G Sbjct: 481 PAGPPGP-SGRYVPGPPGPPGR-TVIGLPGPPGPAG 514 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 +GGG L PPPP +P PP F PPP GP Sbjct: 447 QGGGPPQLPPNLPPPPG--GMRGMPPPPMGMYPPPRGFPPPPFGP 489 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP PPPP + PPP P G P Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPP-PRGMP 504 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPP P A P PPPP Sbjct: 758 PPPPAVPGEGARPPPPPPP 776 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 G G + PPPPP P L P P R S LF PP Sbjct: 786 GEGVGGITPPPPPPPPPPPPEDLIIPLP--RRGSDLFAPP 823 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 29.9 bits (64), Expect = 3.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGG GGG GR E G GG GG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGG 167 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGG G + G G GG Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGG 455 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P + A PP P PPPP P Sbjct: 178 PPAPPPPGAPA---APPAPPFGGPPSAPPPPPAP 208 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 29.9 bits (64), Expect = 3.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG GGGG G G GGG G R Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRAR 132 Score = 29.1 bits (62), Expect = 6.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGG-GGVGRXAXEXGXGGGGGXXKR 710 G G GGGG GG GG G G GGGGG R Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 814 GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGG GGGG G G GGGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GG + R GGGG R G GGGG KR Sbjct: 793 GWGGNRDNYSRG-GGGGYNRGYGSGGGYGGGGYNKR 827 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLP-TPPPPXXRXSXLFXPPPPGPXG 830 PPPPP + P T PP R + PPP G Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPG 253 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 6.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPP---PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP PP P LP P P P PGP G P Sbjct: 1666 PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP 1706 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.1 bits (62), Expect = 6.2 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGG---VGRXAXEXGXGGGGG 722 G G GGGG +D GGGG G G GGGG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGG 261 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 6.2 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + + PP L PPPP P Sbjct: 312 PPPPPLPPAMPAMDDLLPP----EVLSPPPPPPP 341 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PP PP P + P PPPP Sbjct: 298 PPAPPLPNFTSPSPPPPPP 316 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GG D GGG G G GGGGG Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGG 488 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPP 779 PPPP P P PPPP Sbjct: 92 PPPPPPQLENDFPPPPPP 109 >SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) Length = 1382 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -3 Query: 793 DXRXXGGGGVGRXAXEXGXGGGGG 722 D GGGG+G G GGGGG Sbjct: 767 DDEDDGGGGMGLGMGGSGGGGGGG 790 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G GGGGG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG D GGGG + GGGGG Sbjct: 50 GDDDGGGGGCGGGDDDDDGGGGGDDDDDDDDDDGGGGG 87 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPP--PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP PP P A P PPPP P P P Sbjct: 784 PPPEYPPPPPGLAR-PNPPPPNPPLQVTSIPGEPAP 818 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG GGGG G GGGGG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 8.2 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 P PPP P + P PPPP Sbjct: 231 PAPPPPPAAAPPPPPPPPP 249 >SB_42986| Best HMM Match : Glycos_transf_4 (HMM E-Value=1.5) Length = 279 Score = 28.7 bits (61), Expect = 8.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP S +PPP L PPPP P Sbjct: 96 PPPPSLSSQTSSSSPPPSSSSSQSL--PPPPSSSSQP 130 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 28.7 bits (61), Expect = 8.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG D GGGG G GGGGG Sbjct: 11 GGGGDSYDDGDDAGGGG-GSDDDGYDAGGGGG 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,040,724 Number of Sequences: 59808 Number of extensions: 316844 Number of successful extensions: 5411 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3285 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3130351752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -