BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L08 (1044 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 43 6e-04 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 43 6e-04 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 41 0.002 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 41 0.003 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 41 0.003 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 41 0.003 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 41 0.003 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 41 0.003 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 41 0.003 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 41 0.003 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 41 0.003 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 40 0.004 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 40 0.004 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 40 0.004 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 40 0.004 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 39 0.013 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 39 0.013 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 39 0.013 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 39 0.013 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 38 0.023 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 38 0.023 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 38 0.023 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 38 0.023 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 37 0.040 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 37 0.040 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 37 0.053 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 37 0.053 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 37 0.053 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 37 0.053 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 37 0.053 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 37 0.053 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 36 0.070 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 36 0.070 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 36 0.070 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 36 0.070 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 36 0.070 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 36 0.092 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 36 0.092 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 36 0.092 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 36 0.092 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 36 0.12 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 36 0.12 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 36 0.12 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 36 0.12 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 36 0.12 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 36 0.12 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 36 0.12 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 36 0.12 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 36 0.12 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 36 0.12 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 36 0.12 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 36 0.12 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 36 0.12 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 36 0.12 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 35 0.16 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 35 0.16 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 35 0.16 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 35 0.16 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 35 0.16 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 35 0.16 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 35 0.16 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 35 0.16 BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p pro... 34 0.28 AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p pro... 34 0.28 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 34 0.28 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 34 0.28 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 34 0.28 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 34 0.28 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 34 0.28 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 34 0.28 AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC... 34 0.28 AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA... 34 0.28 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 34 0.28 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 34 0.37 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 34 0.37 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 33 0.49 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 33 0.49 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 33 0.49 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 33 0.49 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 33 0.49 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 33 0.49 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 33 0.49 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 33 0.65 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 33 0.65 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 33 0.86 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 33 0.86 AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA... 33 0.86 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 33 0.86 Z11743-1|CAA77802.1| 1403|Drosophila melanogaster prospero protein. 32 1.1 M81389-1|AAA28841.1| 1407|Drosophila melanogaster Pros protein p... 32 1.1 D10609-1|BAA01464.1| 1403|Drosophila melanogaster prospero protein. 32 1.1 BT015263-1|AAT94492.1| 1374|Drosophila melanogaster LD37627p pro... 32 1.1 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 32 1.1 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 32 1.1 AY060680-1|AAL28228.1| 598|Drosophila melanogaster GH11848p pro... 32 1.1 AF190403-1|AAF05703.1| 1403|Drosophila melanogaster homeodomain ... 32 1.1 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 32 1.1 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 32 1.1 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 32 1.1 AE014297-1287|AAN13500.2| 1374|Drosophila melanogaster CG17228-P... 32 1.1 AE014297-1286|AAF54628.2| 1403|Drosophila melanogaster CG17228-P... 32 1.1 AE014297-1285|AAN13501.2| 1535|Drosophila melanogaster CG17228-P... 32 1.1 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 32 1.1 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 32 1.5 BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p pro... 32 1.5 BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p pro... 32 1.5 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 32 1.5 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 32 1.5 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 32 1.5 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 32 1.5 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 32 1.5 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 32 1.5 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 32 1.5 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 32 1.5 AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-P... 32 1.5 AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-P... 32 1.5 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 31 2.0 AE014297-996|AAF54422.3| 4671|Drosophila melanogaster CG9492-PA ... 31 2.0 X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein pr... 31 2.6 U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro... 31 2.6 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 31 2.6 BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p pro... 31 2.6 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 31 2.6 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 31 2.6 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 31 2.6 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 31 2.6 BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p pro... 31 2.6 AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p pro... 31 2.6 AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p pro... 31 2.6 AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p pro... 31 2.6 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 31 2.6 AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro... 31 2.6 AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein... 31 2.6 AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p... 31 2.6 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 31 2.6 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 31 2.6 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 31 2.6 AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P... 31 2.6 AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P... 31 2.6 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 31 2.6 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 31 2.6 AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA,... 31 2.6 AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,... 31 2.6 AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,... 31 2.6 AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,... 31 2.6 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 31 2.6 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 31 2.6 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 31 2.6 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 31 2.6 AE014296-365|AAF47576.2| 451|Drosophila melanogaster CG13923-PA... 31 2.6 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 31 2.6 AE014134-1275|AAF52515.1| 421|Drosophila melanogaster CG5261-PA... 31 2.6 AE014134-1274|AAF52514.1| 512|Drosophila melanogaster CG5261-PB... 31 2.6 AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-P... 31 2.6 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 31 2.6 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 31 3.5 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 31 3.5 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 31 3.5 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 31 3.5 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 31 3.5 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 31 3.5 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 31 3.5 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 31 3.5 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 31 3.5 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 31 3.5 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 30 4.6 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 30 4.6 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 30 4.6 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 30 4.6 BT011082-1|AAR82748.1| 468|Drosophila melanogaster RH73646p pro... 30 4.6 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 30 4.6 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 30 4.6 AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa pr... 30 4.6 AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-P... 30 4.6 AE014297-2419|AAO41573.1| 1513|Drosophila melanogaster CG31247-P... 30 4.6 AE014297-2418|AAO41572.1| 1513|Drosophila melanogaster CG31247-P... 30 4.6 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 30 4.6 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 30 4.6 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 30 4.6 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 30 4.6 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 30 4.6 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 30 4.6 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 30 4.6 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 30 6.0 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 30 6.0 BT004502-1|AAO42666.1| 741|Drosophila melanogaster GH07373p pro... 30 6.0 BT003322-1|AAO25082.1| 575|Drosophila melanogaster AT02511p pro... 30 6.0 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 30 6.0 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 30 6.0 AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p pro... 30 6.0 AY071657-1|AAL49279.1| 208|Drosophila melanogaster RE73905p pro... 30 6.0 AY058699-1|AAL13928.1| 600|Drosophila melanogaster LD42024p pro... 30 6.0 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 30 6.0 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 30 6.0 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 30 6.0 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 30 6.0 AE014298-3195|AAF50943.2| 208|Drosophila melanogaster CG17600-P... 30 6.0 AE014298-3192|AAF50946.2| 600|Drosophila melanogaster CG17600-P... 30 6.0 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 30 6.0 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 30 6.0 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 30 6.0 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 30 6.0 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 30 6.0 AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB... 30 6.0 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 30 6.0 AE014134-2898|AAF53643.2| 741|Drosophila melanogaster CG15151-P... 30 6.0 AE013599-2343|AAS64829.1| 575|Drosophila melanogaster CG15920-P... 30 6.0 AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-P... 30 6.0 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 29 8.0 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 29 8.0 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 29 8.0 BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p pro... 29 8.0 AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p pro... 29 8.0 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 29 8.0 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 29 8.0 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 29 8.0 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 29 8.0 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 29 8.0 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 29 8.0 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 29 8.0 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 29 8.0 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 29 8.0 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 29 8.0 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 29 8.0 AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC... 29 8.0 AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB... 29 8.0 AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA... 29 8.0 AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD... 29 8.0 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 29 8.0 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 43.2 bits (97), Expect = 6e-04 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + A P PPPP L PPPP Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 39.1 bits (87), Expect = 0.010 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A P PPPP + PPPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPP---INGAAPPPPPPP 301 Score = 31.1 bits (67), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP P P P Sbjct: 295 PPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P P + TPPPP + PPPP P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 43.2 bits (97), Expect = 6e-04 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + A P PPPP L PPPP Sbjct: 283 PPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 Score = 39.1 bits (87), Expect = 0.010 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A P PPPP + PPPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPP---INGAAPPPPPPP 301 Score = 31.1 bits (67), Expect = 2.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP P P P Sbjct: 295 PPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P P + TPPPP + PPPP P Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPP 289 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG--PXGXP 836 G+ L PPPPP P S PPP + PPPPG P G P Sbjct: 689 GAASLTLPPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP 736 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 506 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 537 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 520 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 521 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 558 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 507 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 37.1 bits (82), Expect = 0.040 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL-FXPPPPGPXGXP 836 PPPPP P A P PPPP + PPP P P Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPP 527 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXL-----PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPP 524 Score = 33.5 bits (73), Expect = 0.49 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP F P PPP P PPP Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPP 511 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 477 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 753 AXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 A P PPPP PPPP P P Sbjct: 482 AVAPPPPPPPPPLPAFVAPPPPPPPPPP 509 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP + + PPPP P P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPP 510 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 601 PPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 632 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 615 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 616 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 653 Score = 37.9 bits (84), Expect = 0.023 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 602 PPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 37.1 bits (82), Expect = 0.040 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL-FXPPPPGPXGXP 836 PPPPP P A P PPPP + PPP P P Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXL-----PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPP 619 Score = 33.5 bits (73), Expect = 0.49 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP F P PPP P PPP Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPP 606 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 572 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 753 AXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 A P PPPP PPPP P P Sbjct: 577 AVAPPPPPPPPPLPAFVAPPPPPPPPPP 604 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP + + PPPP P P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPP 605 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 734 PPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 765 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 748 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 749 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 786 Score = 37.9 bits (84), Expect = 0.023 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 735 PPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 37.1 bits (82), Expect = 0.040 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL-FXPPPPGPXGXP 836 PPPPP P A P PPPP + PPP P P Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXL-----PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPP 752 Score = 33.5 bits (73), Expect = 0.49 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP F P PPP P PPP Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPP 739 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 705 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 753 AXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 A P PPPP PPPP P P Sbjct: 710 AVAPPPPPPPPPLPAFVAPPPPPPPPPP 737 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP + + PPPP P P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPP 738 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 497 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 511 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP PPPP P G Sbjct: 490 PPPPPPP------PPPPPPPLANYGAPPPPPPPPPG 519 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 34.7 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL--FXPPPPGPXGXP 836 PPPPP A P PPPP L + PPP P P Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP F P PPP P PPP P P Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP------PPPPPPP 502 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP PPP P PPP G P G PPPPP Sbjct: 478 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPPPP 529 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P + A P PPPP PPPP P P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPP 501 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P F PP PPP P PPP S G P Sbjct: 478 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP--PPPGS------GSAPPPPPP 529 Query: 476 KKKKXXXGXXXPPPP 520 + G PPPP Sbjct: 530 APIEGGGGIPPPPPP 544 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 507 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 538 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 521 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 522 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 508 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP PPPP P G Sbjct: 500 PPPPPPP------PPPPPPPLANYGAPPPPPPPPPG 529 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 525 Score = 34.7 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL--FXPPPPGPXGXP 836 PPPPP A P PPPP L + PPP P P Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 528 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP F P PPP P PPP P P Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPP------PPPPPPP 512 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 477 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 512 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP PPP P PPP G P G PPPPP Sbjct: 488 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPPPP 539 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P + A P PPPP PPPP P P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPP 511 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P F PP PPP P PPP S G P Sbjct: 488 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP--PPPGS------GSAPPPPPP 539 Query: 476 KKKKXXXGXXXPPPP 520 + G PPPP Sbjct: 540 APIEGGGGIPPPPPP 554 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 497 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 511 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 512 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 549 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP PPPP P G Sbjct: 490 PPPPPPP------PPPPPPPLANYGAPPPPPPPPPG 519 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 34.7 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL--FXPPPPGPXGXP 836 PPPPP A P PPPP L + PPP P P Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP F P PPP P PPP P P Sbjct: 479 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPP------PPPPPPP 502 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP PPP P PPP G P G PPPPP Sbjct: 478 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPPPP 529 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P + A P PPPP PPPP P P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPP 501 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P F PP PPP P PPP S G P Sbjct: 478 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP--PPPGS------GSAPPPPPP 529 Query: 476 KKKKXXXGXXXPPPP 520 + G PPPP Sbjct: 530 APIEGGGGIPPPPPP 544 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 655 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 686 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 669 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 702 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 670 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 707 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 656 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP PPPP P G Sbjct: 648 PPPPPPP------PPPPPPPLANYGAPPPPPPPPPG 677 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 673 Score = 34.7 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL--FXPPPPGPXGXP 836 PPPPP A P PPPP L + PPP P P Sbjct: 637 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 676 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP F P PPP P PPP P P Sbjct: 637 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 674 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPP------PPPPPPP 660 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 625 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 660 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP PPP P PPP G P G PPPPP Sbjct: 636 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPPPP 687 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P + A P PPPP PPPP P P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPP 659 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P F PP PPP P PPP S G P Sbjct: 636 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP--PPPGS------GSAPPPPPP 687 Query: 476 KKKKXXXGXXXPPPP 520 + G PPPP Sbjct: 688 APIEGGGGIPPPPPP 702 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 602 PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 633 Score = 39.9 bits (89), Expect = 0.006 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 616 PPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 649 Score = 38.7 bits (86), Expect = 0.013 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPP PPPP P Sbjct: 617 PPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 654 Score = 37.5 bits (83), Expect = 0.030 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + P PPPP PPPP P Sbjct: 603 PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PPPP PPPP P G Sbjct: 595 PPPPPPP------PPPPPPPLANYGAPPPPPPPPPG 624 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPPP + PPPP P Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 620 Score = 34.7 bits (76), Expect = 0.21 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL--FXPPPPGPXGXP 836 PPPPP A P PPPP L + PPP P P Sbjct: 584 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPP 623 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP F P PPP P PPP P P Sbjct: 584 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 621 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPP------PPPPPPP 607 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 318 GXXPRGXXKXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 G P PPP P PPP P PPP Sbjct: 572 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP PPP P PPP G P G PPPPP Sbjct: 583 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPP---PPPPPPGSGSAPPPPPP 634 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 741 PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P + A P PPPP PPPP P P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPP 606 Score = 29.9 bits (64), Expect = 6.0 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P F PP PPP P PPP S G P Sbjct: 583 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP--PPPGS------GSAPPPPPP 634 Query: 476 KKKKXXXGXXXPPPP 520 + G PPPP Sbjct: 635 APIEGGGGIPPPPPP 649 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P P PPPP + PPPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG---PXGXP 836 PPPPP A P PPPP PP PG P G P Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGP 581 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P P PPPP PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PP P PPPP Sbjct: 554 PPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PPP R PPPP P Sbjct: 514 PPPPPG-GGGAPPPPPPPMPGRAGGGPPPPPPPP 546 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P P PPPP + PPPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG---PXGXP 836 PPPPP A P PPPP PP PG P G P Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGP 581 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P P PPPP PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PP P PPPP Sbjct: 554 PPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PPP R PPPP P Sbjct: 514 PPPPPG-GGGAPPPPPPPMPGRAGGGPPPPPPPP 546 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P P PPPP + PPPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG---PXGXP 836 PPPPP A P PPPP PP PG P G P Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGP 581 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P P PPPP PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PP P PPPP Sbjct: 554 PPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PPP R PPPP P Sbjct: 514 PPPPPG-GGGAPPPPPPPMPGRAGGGPPPPPPPP 546 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P P PPPP + PPPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP PPPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG---PXGXP 836 PPPPP A P PPPP PP PG P G P Sbjct: 541 PPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGP 581 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P P PPPP PPPP P P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PP P PPPP Sbjct: 554 PPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PPP R PPPP P Sbjct: 514 PPPPPG-GGGAPPPPPPPMPGRAGGGPPPPPPPP 546 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 38.7 bits (86), Expect = 0.013 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 36.3 bits (80), Expect = 0.070 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP PPPP P Sbjct: 161 PPPPPAPPTVEP-PPPPPPAPPTVEPPPPPPPAP 193 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP------PPPXXRXSXLFXPPPPGP 824 PPPPP P P P PPP + L PPPP P Sbjct: 187 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAP 226 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P P PP + PPPP P Sbjct: 139 PPPPPAPPTLVPPPPPAPPTIK-----PPPPPAP 167 Score = 34.7 bits (76), Expect = 0.21 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P P PP PPPP P P Sbjct: 150 PPPPPAPPTIKPPPPPAPPTVE------PPPPPPPAPP 181 Score = 34.7 bits (76), Expect = 0.21 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 185 PPPPPPPAPTKVEPPPPPAP--AEVEPPPPPAP 215 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PP P S PP P P Sbjct: 94 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDP 131 Score = 33.5 bits (73), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P P PP PPPP P Sbjct: 209 PPPPPAPTELEPPPPPAPPKVE-----LPPPPAP 237 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P P PP S F PPPP Sbjct: 107 PPPPAPPGVESPPGPQPPA---SPRFDPPPP 134 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P P PPPP S PPPP P G Sbjct: 81 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPG 114 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 38.7 bits (86), Expect = 0.013 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 36.3 bits (80), Expect = 0.070 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP PPPP P Sbjct: 424 PPPPPAPPTVEP-PPPPPPAPPTVEPPPPPPPAP 456 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP------PPPXXRXSXLFXPPPPGP 824 PPPPP P P P PPP + L PPPP P Sbjct: 450 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAP 489 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P P PP + PPPP P Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIK-----PPPPPAP 430 Score = 34.7 bits (76), Expect = 0.21 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P P PP PPPP P P Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVE------PPPPPPPAPP 444 Score = 34.7 bits (76), Expect = 0.21 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAP--AEVEPPPPPAP 478 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PP P S PP P P Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDP 394 Score = 33.5 bits (73), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P P PP PPPP P Sbjct: 472 PPPPPAPTELEPPPPPAPPKVE-----LPPPPAP 500 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P P PP S F PPPP Sbjct: 370 PPPPAPPGVESPPGPQPPA---SPRFDPPPP 397 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P P PPPP S PPPP P G Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPG 377 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 38.7 bits (86), Expect = 0.013 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 36.3 bits (80), Expect = 0.070 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP PPPP P Sbjct: 424 PPPPPAPPTVEP-PPPPPPAPPTVEPPPPPPPAP 456 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP------PPPXXRXSXLFXPPPPGP 824 PPPPP P P P PPP + L PPPP P Sbjct: 450 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAP 489 Score = 35.1 bits (77), Expect = 0.16 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P P PP + PPPP P Sbjct: 402 PPPPPAPPTLVPPPPPAPPTIK-----PPPPPAP 430 Score = 34.7 bits (76), Expect = 0.21 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + P P PP PPPP P P Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVE------PPPPPPPAPP 444 Score = 34.7 bits (76), Expect = 0.21 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + + PPPP + + PPPP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAP--AEVEPPPPPAP 478 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S P PP P S PP P P Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDP 394 Score = 33.5 bits (73), Expect = 0.49 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P P PP PPPP P Sbjct: 472 PPPPPAPTELEPPPPPAPPKVE-----LPPPPAP 500 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P P PP S F PPPP Sbjct: 370 PPPPAPPGVESPPGPQPPA---SPRFDPPPP 397 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P P PPPP S PPPP P G Sbjct: 344 PEPVQVPAPPKVNPPPPPRPASPKVEPPPPAPPG 377 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 38.7 bits (86), Expect = 0.013 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P + + TPPPP ++ PPPP P Sbjct: 167 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPP 198 Score = 38.7 bits (86), Expect = 0.013 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP + PPPP P Sbjct: 180 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 213 Score = 38.7 bits (86), Expect = 0.013 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP + PPPP P Sbjct: 280 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 313 Score = 36.3 bits (80), Expect = 0.070 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPPP P PPPP + ++ PPP G Sbjct: 193 PPPPPPTKKVVYTPPPPPPPPK-KVVYTPPPTG 224 Score = 36.3 bits (80), Expect = 0.070 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPPP P PPPP + ++ PPP G Sbjct: 293 PPPPPPTKKVVYTPPPPPPPPK-KVVYTPPPTG 324 Score = 33.5 bits (73), Expect = 0.49 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P + + TPPPP ++ PPPP P Sbjct: 265 PPVYVPPPTKKVIYTPPPPPPTKKVVYTPPPPPP 298 Score = 33.1 bits (72), Expect = 0.65 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P + + TPPPP ++ PPPP P Sbjct: 152 PPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPP 185 Score = 30.7 bits (66), Expect = 3.5 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P PP + ++ PPPP P Sbjct: 354 PPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPP 386 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP A PPP + PPPP P P Sbjct: 354 PPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVYIP 391 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 37.9 bits (84), Expect = 0.023 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + T P P + + PPPP P P Sbjct: 60 PPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 37.9 bits (84), Expect = 0.023 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + T P P + + PPPP P P Sbjct: 60 PPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 37.9 bits (84), Expect = 0.023 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + T P P + + PPPP P P Sbjct: 42 PPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 79 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 37.9 bits (84), Expect = 0.023 Identities = 19/43 (44%), Positives = 21/43 (48%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG + R GGGG G G GGGGG + R Sbjct: 194 GGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRGR 236 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG + GGGG G G GGGGG Sbjct: 4 GKPRGGGGGGGRGFGG-GGGGGGRGFGGGGGGRGGGGG 40 Score = 33.1 bits (72), Expect = 0.65 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG A G GGGGG R Sbjct: 183 GRGGGRGGGGRGGGGGR--GGGGFRGGAGRNGGGGGGGGFNR 222 Score = 30.7 bits (66), Expect = 3.5 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGGG GR G GGGGG Sbjct: 12 GGGRGFGGGG--GGGGRGFGGGGGGRGGG-GGRGGGGG 46 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 37.1 bits (82), Expect = 0.040 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G ++ P PPP +P PPPP + PPP P P Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTP 261 Score = 35.9 bits (79), Expect = 0.092 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 G L+ PPPPP P + PPPP + + PP Sbjct: 231 GGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPAEVAPPP 268 Score = 33.5 bits (73), Expect = 0.49 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 GG + PPPP P PPPP + PPPP Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 31.9 bits (69), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP PTPPPP + PPPP P Sbjct: 211 PMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPP 244 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP + P P P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 37.1 bits (82), Expect = 0.040 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G ++ P PPP +P PPPP + PPP P P Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPPSFTP 261 Score = 35.9 bits (79), Expect = 0.092 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 G L+ PPPPP P + PPPP + + PP Sbjct: 231 GGVLVMPRPPPPPPPAGGVLVMPPPPPSFTPAEVAPPP 268 Score = 33.5 bits (73), Expect = 0.49 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 GG + PPPP P PPPP + PPPP Sbjct: 216 GGVMVMPSPTPPPPAGGVLVMPRPPPPPPPAGGVLVMPPPPP 257 Score = 31.9 bits (69), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP PTPPPP + PPPP P Sbjct: 211 PMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPPP 244 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP + P P P P Sbjct: 154 PPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYP 191 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 586 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 620 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 623 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 594 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 621 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 547 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 581 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 584 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 555 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 582 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 392 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 426 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 403 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 429 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 400 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 427 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 547 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 581 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 584 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 555 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 582 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 586 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 620 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 623 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 594 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 621 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 36.7 bits (81), Expect = 0.053 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P +P PPPP S + PPPP P P Sbjct: 888 PPPAPPMLKAIP-PPPPPMAPSMMPPPPPPCPGAPP 922 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +P PPPP PPPP Sbjct: 899 PPPPPPMAPSMMPPPPPPCPGA----PPPPP 925 Score = 30.3 bits (65), Expect = 4.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 342 KXXXXPPPXAFXXFXXPXPPPXPTXPPP 425 K PPP P PPP P PPP Sbjct: 896 KAIPPPPPPMAPSMMPPPPPPCPGAPPP 923 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + P PPPP + PPPP P G Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PPPP PPPP P Sbjct: 357 PPPPNRPPPISTAP-PPPPVSAPVVAPPPPPPPP 389 Score = 33.1 bits (72), Expect = 0.65 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P A P PPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + PPP R + PPP P P Sbjct: 342 PPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + P PPPP + PPPP P G Sbjct: 337 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 371 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PPPP PPPP P Sbjct: 324 PPPPNRPPPISTAP-PPPPVSAPVVAPPPPPPPP 356 Score = 33.1 bits (72), Expect = 0.65 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P A P PPPP Sbjct: 349 PPPPPPPPPAAVPPPPPPP 367 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + PPP R + PPP P P Sbjct: 309 PPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 345 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + P PPPP + PPPP P G Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PPPP PPPP P Sbjct: 357 PPPPNRPPPISTAP-PPPPVSAPVVAPPPPPPPP 389 Score = 33.1 bits (72), Expect = 0.65 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P A P PPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + PPP R + PPP P P Sbjct: 342 PPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 36.3 bits (80), Expect = 0.070 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP + P PPPP + PPPP P G Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PPPP PPPP P Sbjct: 357 PPPPNRPPPISTAP-PPPPVSAPVVAPPPPPPPP 389 Score = 33.1 bits (72), Expect = 0.65 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P A P PPPP Sbjct: 382 PPPPPPPPPAAVPPPPPPP 400 Score = 31.9 bits (69), Expect = 1.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + PPP R + PPP P P Sbjct: 342 PPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAP 378 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 36.3 bits (80), Expect = 0.070 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G+ + G GGGGG Sbjct: 24 GGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGG 57 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + + GGGG G+ G GGGGG Sbjct: 38 GGGGGGGQGGWQKGGGGGGGGK---HGGGGGGGG 68 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG K G GG G+ G GGGGG Sbjct: 58 GKHGGGGGGGGK----HGGGNGGGGKHGGGGGGGGGGG 91 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 35.9 bits (79), Expect = 0.092 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + PPP + + PPPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP PPPP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 34.3 bits (75), Expect = 0.28 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P P PPPP + PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAP 63 Score = 34.3 bits (75), Expect = 0.28 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PPPP + PP P P Sbjct: 58 PPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP +P P P P P P P Sbjct: 72 PPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIP 109 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P S P PPPP S + PPPP P G Sbjct: 435 PPPPPPSGNYGPPPPPP----SGNYGPPPPPPSG 464 Score = 35.9 bits (79), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP PP P LP PPPP L PPPP Sbjct: 642 PPGPPPPPEPQYLP-PPPPLANVRPLGPPPPP 672 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P S P PPPP PPP G G P Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGP--PPPPSGNYGPP 479 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP-----PPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + P P PPP + PPP G G P Sbjct: 457 PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPP 499 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P P P P + PPPP Sbjct: 140 PPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 35.9 bits (79), Expect = 0.092 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPP P S P PPPP S + PPPP P G Sbjct: 435 PPPPPPSGNYGPPPPPP----SGNYGPPPPPPSG 464 Score = 35.9 bits (79), Expect = 0.092 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP PP P LP PPPP L PPPP Sbjct: 642 PPGPPPPPEPQYLP-PPPPLANVRPLGPPPPP 672 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P S P PPPP PPP G G P Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGP--PPPPSGNYGPP 479 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP-----PPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + P P PPP + PPP G G P Sbjct: 457 PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPP 499 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P P P P + PPPP Sbjct: 140 PPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 35.9 bits (79), Expect = 0.092 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + PPP + + PPPP P Sbjct: 43 PPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 34.7 bits (76), Expect = 0.21 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP PPPP P P Sbjct: 42 PPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 34.3 bits (75), Expect = 0.28 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P P PPPP + PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAP 63 Score = 34.3 bits (75), Expect = 0.28 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PPPP + PP P P Sbjct: 58 PPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 Score = 29.5 bits (63), Expect = 8.0 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP +P P P P P P P Sbjct: 72 PPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIP 109 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 398 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 446 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 447 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 483 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 401 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 449 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 450 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 486 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 544 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 592 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 593 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 629 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G L P P P P S P PPPP + + + PPPP P P Sbjct: 188 GPEYLPPDQPKPRPTP-SRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXL---PTPPPPXXRXSXLFXP--PPPGP 824 PPPPP P P PPPP + + + P PPPGP Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PP PP P + P PP PP + P PP P Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAP 382 Score = 33.5 bits (73), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PPPP P P PP PP + P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAP 335 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P A P+ PP + P PP P P Sbjct: 152 PRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGP 189 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PTPPP PP P P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQP 262 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPP-PPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PP PP + P PP P P Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPP 355 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P P PP P + + P PP P Sbjct: 332 PPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAP 366 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT-------PPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P+ PP P + + PPP G P Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP 122 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-PPPGP 824 P PPP P A P PPPP P PPP P Sbjct: 101 PRPPPQPTPSA--PAPPPPSYGPPQTPPPRPPPQP 133 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P P P P S PPPP P P Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQP 218 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP-PPGP 824 PP PP P P PP P + PP PP P Sbjct: 351 PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAP 385 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGG + R GGGG G GGGGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PP L PPPP P Sbjct: 647 PPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PP PPPP P P Sbjct: 646 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 683 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 35.5 bits (78), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PP L PPPP P Sbjct: 787 PPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PP PPPP P P Sbjct: 786 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVP 823 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGG + R GGGG G GGGGG Sbjct: 333 GPPGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G L P P P P S P PPPP + + + PPPP P P Sbjct: 188 GPEYLPPDQPKPRPTP-SRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 35.5 bits (78), Expect = 0.12 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPPPPXPXSXAXL---PTPPPPXXRXSXLFXP--PPPGP 824 PPPPP P P PPPP + + + P PPPGP Sbjct: 210 PPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGP 248 Score = 33.9 bits (74), Expect = 0.37 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PP PP P + P PP PP + P PP P Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAP 382 Score = 33.5 bits (73), Expect = 0.49 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGP 824 PPPP P P PP PP + P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAP 335 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P A P+ PP + P PP P P Sbjct: 152 PRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGP 189 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PTPPP PP P P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQP 262 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPP-PPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PP PP + P PP P P Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPP 355 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPX-SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P P PP P + + P PP P Sbjct: 332 PPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAP 366 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT-------PPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P+ PP P + + PPP G P Sbjct: 78 PPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP 122 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-PPPGP 824 P PPP P A P PPPP P PPP P Sbjct: 101 PRPPPQPTPSA--PAPPPPSYGPPQTPPPRPPPQP 133 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P P P P S PPPP P P Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQP 218 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP-PPGP 824 PP PP P P PP P + PP PP P Sbjct: 351 PPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAP 385 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 543 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 591 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 592 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 628 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 398 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 446 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 447 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 483 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 398 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 446 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 447 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 483 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 398 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 446 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 447 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 483 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 35.5 bits (78), Expect = 0.12 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +GG PPPPP A PPPP PPPP G P Sbjct: 401 QGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGP 449 Score = 33.1 bits (72), Expect = 0.65 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PP P + PPPPG G P Sbjct: 450 PPAPPAPPAMGGGP-PPAPGGPGAPPPPPPPPGLGGAP 486 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + R GGGG G G GGGGG Sbjct: 195 GGGGGRGGGGFRGGAGRNGGGGG-GGGGFNRGRGGGGG 231 Score = 33.9 bits (74), Expect = 0.37 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = -3 Query: 835 GXPXGPGGGGXKX----KDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG + R GGGG GR G GGGGG Sbjct: 4 GKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGG-GGRGGGGG 44 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGG--GGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG R GG GG GR G GGGGG + R Sbjct: 184 GRGGGRGGGGRGGGGGRGGGGFRGGAGRNGG--GGGGGGGFNRGR 226 Score = 30.7 bits (66), Expect = 3.5 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGGG + R G GG GR G GGGG Sbjct: 173 GGGGGGFGGRGGRGGGRGGGGRGGG-GGRGGGG 204 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPPGP P Sbjct: 87 PPPPQRPWGPPPPPGPPPPGP-------PPPPGPYYNP 117 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 231 GGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GG G + GGGG G + G GGGGG R Sbjct: 218 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDR 259 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + R GGGG G GGGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG D GGGG G GGGGG + R Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 316 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 356 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 248 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGP-GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGG G + G GGGGG Sbjct: 228 GRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPPGP P Sbjct: 117 PPPPQRPWGPPPPPGPPPPGP-------PPPPGPYYNP 147 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 231 GGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GG G + GGGG G + G GGGGG R Sbjct: 218 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDR 259 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + R GGGG G GGGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG D GGGG G GGGGG + R Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 316 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 356 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 248 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGP-GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGG G + G GGGGG Sbjct: 228 GRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 35.1 bits (77), Expect = 0.16 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG GR G GGGGG Sbjct: 231 GGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GG G + GGGG G + G GGGGG R Sbjct: 218 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDR 259 Score = 33.5 bits (73), Expect = 0.49 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + R GGGG G GGGGG Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GGGG D GGGG G GGGGG + R Sbjct: 233 GGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 316 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 356 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 248 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGP-GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGG G + G GGGGG Sbjct: 228 GRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPPGP P Sbjct: 117 PPPPQRPWGPPPPPGPPPPGP-------PPPPGPYYNP 147 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 35.1 bits (77), Expect = 0.16 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPPGP P Sbjct: 87 PPPPQRPWGPPPPPGPPPPGP-------PPPPGPYYNP 117 >BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p protein. Length = 489 Score = 34.3 bits (75), Expect = 0.28 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P S P PPPP P PP Sbjct: 451 PPPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 481 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP + LP PPP + PP Sbjct: 452 PPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 481 >AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p protein. Length = 380 Score = 34.3 bits (75), Expect = 0.28 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P S P PPPP P PP Sbjct: 342 PPPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 372 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP + LP PPP + PP Sbjct: 343 PPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 372 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 34.3 bits (75), Expect = 0.28 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P P PPPP + S + PPP Sbjct: 335 PPPPPPPPP----PPPPPPPAQTSAIPSPPP 361 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG + GGGG G G GGGGG Sbjct: 4 GKPRGGGGGGGRGFGG-GGGGGGRGFGGGGGGRGGGGG 40 Score = 30.7 bits (66), Expect = 3.5 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG R GGGG GR G GGGGG Sbjct: 12 GGGRGFGGGG--GGGGRGFGGGGGGRGGG-GGRGGGGG 46 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A +P PPP PPPP P Sbjct: 383 PPPPPAP--PAGVPPAPPPMPVFGAGGAPPPPPP 414 Score = 33.1 bits (72), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P A PPPP PPPP Sbjct: 395 PAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 34.3 bits (75), Expect = 0.28 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P G P Sbjct: 73 PPPPPPPPP----PPPPPP---------PPPPSPPGVP 97 Score = 33.5 bits (73), Expect = 0.49 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 L PPPPP P P P PP + + PP P Sbjct: 72 LPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A +P PPP PPPP P Sbjct: 383 PPPPPAP--PAGVPPAPPPMPVFGAGGAPPPPPP 414 Score = 33.1 bits (72), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P A PPPP PPPP Sbjct: 395 PAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 34.3 bits (75), Expect = 0.28 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A +P PPP PPPP P Sbjct: 499 PPPPPAP--PAGVPPAPPPMPVFGAGGAPPPPPP 530 Score = 33.1 bits (72), Expect = 0.65 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P A PPPP PPPP Sbjct: 511 PAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 >AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC, isoform C protein. Length = 475 Score = 34.3 bits (75), Expect = 0.28 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P S P PPPP P PP Sbjct: 437 PPPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 467 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP + LP PPP + PP Sbjct: 438 PPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 467 >AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA, isoform A protein. Length = 489 Score = 34.3 bits (75), Expect = 0.28 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P S P PPPP P PP Sbjct: 451 PPPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 481 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP + LP PPP + PP Sbjct: 452 PPPPPPSLTLPPLPPPPPTTHQQQQQPAPP 481 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 34.3 bits (75), Expect = 0.28 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P P PPPP + S + PPP Sbjct: 335 PPPPPPPPP----PPPPPPPAQTSAIPSPPP 361 >BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p protein. Length = 157 Score = 33.9 bits (74), Expect = 0.37 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPG--GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPG GGG ++ GG GR A G GGGGG Sbjct: 77 GGRGGPGGKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 >AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-PA protein. Length = 157 Score = 33.9 bits (74), Expect = 0.37 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPG--GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPG GGG ++ GG GR A G GGGGG Sbjct: 77 GGRGGPGGKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + G GG G + G GGGGG Sbjct: 234 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 321 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 361 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 247 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GG G + GGGG G + G GGGG Sbjct: 217 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGG 253 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + G GG G + G GGGGG Sbjct: 196 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 233 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 283 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 323 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 209 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GG G + GGGG G + G GGGG Sbjct: 179 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGG 215 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + G GG G + G GGGGG Sbjct: 234 GGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGG 271 Score = 33.1 bits (72), Expect = 0.65 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV---GRXAXEXGXGGGGG 722 G G GGGG + R GGGG R G GGGGG Sbjct: 321 GYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 361 Score = 31.1 bits (67), Expect = 2.6 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGGG R GGGG G G GGGGG R Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGG------GGGGGGGRFDR 247 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GG G + GGGG G + G GGGG Sbjct: 217 GGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGG 253 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG GG G G G GGGGG Sbjct: 166 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGG 203 Score = 32.7 bits (71), Expect = 0.86 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 388 GAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGG 427 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G + G G GGG Sbjct: 175 GGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG 208 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 280 GGGGGRGGGGAPGAPGSP-GGGGFGGQGGGGGFGGGGG 316 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 292 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 331 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 358 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 397 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 G GPGGGG G GG GR G GGGGG Sbjct: 1 GFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 40 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P PGGGG + GGGG G G GG G Sbjct: 418 GAPGSPGGGGFGGQ----GGGGGFGAGGGRGGAGGAPG 451 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P G G GG GGG GR G G GGGG Sbjct: 227 GAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGG 266 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXX--GGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 343 GGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGG 382 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP PPPPGP Sbjct: 52 PPPPPSPPCGRPPPGSPPP--------GPPPPGP 77 Score = 30.7 bits (66), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPPGPXGXP 836 P P P P P PP PP R PP P P G P Sbjct: 40 PNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPP 78 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PT PPP PPPP P Sbjct: 466 PPPPPPPPPPPPPPTEPPPP-------PPPPPEP 492 Score = 33.1 bits (72), Expect = 0.65 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR 788 PPPPP P + P PPPP R Sbjct: 472 PPPPPPPPTEPPPPPPPPPEPR 493 Score = 32.7 bits (71), Expect = 0.86 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 463 PPPPPPPPPP---PPPPPPPTEP-----PPPPPPPPEP 492 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 33.5 bits (73), Expect = 0.49 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG GG G G G GGGGG Sbjct: 238 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGG 275 Score = 32.7 bits (71), Expect = 0.86 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 460 GAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGG 499 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G + G G GGG Sbjct: 247 GGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG 280 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 352 GGGGGRGGGGAPGAPGSP-GGGGFGGQGGGGGFGGGGG 388 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 364 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 403 Score = 31.5 bits (68), Expect = 2.0 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P PGGGG + GGG GR G GGGG Sbjct: 430 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 469 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 G GPGGGG G GG GR G GGGGG Sbjct: 73 GFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 112 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P PGGGG + GGGG G G GG G Sbjct: 490 GAPGSPGGGGFGGQ----GGGGGFGAGGGRGGAGGAPG 523 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXG--GGGG 722 G P G G GG GGG GR G G GGGG Sbjct: 299 GAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGG 338 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXX--GGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 415 GGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGG 454 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G + GGGG G G GGGGG Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGG 67 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 33.1 bits (72), Expect = 0.65 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP P PPGP G P Sbjct: 54 PPPPPPP--------PPPPQHCNCPPGPPGPPGPPGLP 83 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PP P P P GP G Sbjct: 58 PPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGPKG 93 Score = 31.5 bits (68), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P P PPPP P PP Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPP 181 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PP P P PGP G Sbjct: 55 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQG 90 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP P PPPGP P Sbjct: 239 PPPPPPPPPPPSYPYPPYPY---------PPPGPYPGP 267 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PP PPPP P P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 249 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP-PPPXXRXSXLFXPPPPGP 824 PPPPP P S P P PPP P P P Sbjct: 242 PPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 276 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P + P PPPP P PP P P Sbjct: 224 PGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 261 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 33.1 bits (72), Expect = 0.65 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPPP P PPGP G P Sbjct: 56 PPPPPPP--------PPPPQHCNCPPGPPGPPGPPGLP 85 Score = 33.1 bits (72), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P P PP P P P GP G Sbjct: 60 PPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGPKG 95 Score = 31.5 bits (68), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PPP P P PPPP P PP Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPP 183 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PP P P PGP G Sbjct: 57 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQG 92 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP P PPPGP P Sbjct: 241 PPPPPPPPPPPSYPYPPYPY---------PPPGPYPGP 269 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PP PPPP P P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 251 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP-PPPXXRXSXLFXPPPPGP 824 PPPPP P S P P PPP P P P Sbjct: 244 PPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 278 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P + P PPPP P PP P P Sbjct: 226 PGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 263 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG + GGGG G G GGGG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG 53 Score = 31.5 bits (68), Expect = 2.0 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGG--VGRXAXEXGXGGGG 725 G G GGGG R GGGG GR G GGGG Sbjct: 31 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGG 69 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGG Sbjct: 67 GGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGG 104 Score = 31.1 bits (67), Expect = 2.6 Identities = 20/39 (51%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGG-GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG GG + R GGGG GR A G GGGGG Sbjct: 53 GDRGGRGGFGGGRGGGGRGGGGGG-GRGAF-GGRGGGGG 89 Score = 29.5 bits (63), Expect = 8.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG R GGGG G G G GG R Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDR 55 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG + GGGG G G GGGG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG 46 Score = 29.5 bits (63), Expect = 8.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG R GGGG G G G GG R Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDR 48 >AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA protein. Length = 559 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P GPGG G G GG G G GG GG Sbjct: 404 GGPGGPGGPGGPGGPGMPWGPGGPGGPGGPNGPGGPGG 441 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P GPGG G G GG G G GG GG Sbjct: 392 GGPMGPGGPGGPGGPGGPGGPGGPGGPGMPWGPGGPGG 429 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P GPGG G G GG G G GG GG Sbjct: 407 GGPGGPGGPGGPGMPWGPGGPGGPGGPNGPGGPGGPGG 444 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P GPGG G G GG G GG GG Sbjct: 410 GGPGGPGGPGMPWGPGGPGGPGGPNGPGGPGGPGGPGG 447 Score = 29.9 bits (64), Expect = 6.0 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGG--GGGXXKRR 707 G P GPGG G G GG G G GG G G K R Sbjct: 419 GMPWGPGGPGGPGGPNGPGGPGGPGGPGGPGGPGGPCGPGCEKAR 463 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GPGG G G GG G G GG GG Sbjct: 397 PGGPGGPGGPGGPGGPGGPGGPGMPWGPGGPGGPGG 432 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 32.7 bits (71), Expect = 0.86 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG + GGGG G G GGGG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG 46 Score = 31.5 bits (68), Expect = 2.0 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGG--VGRXAXEXGXGGGG 725 G G GGGG R GGGG GR G GGGG Sbjct: 24 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGG 62 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + GGGG G G GGGG Sbjct: 60 GGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGG 97 Score = 31.1 bits (67), Expect = 2.6 Identities = 20/39 (51%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGG-GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG GG + R GGGG GR A G GGGGG Sbjct: 46 GDRGGRGGFGGGRGGGGRGGGGGG-GRGAF-GGRGGGGG 82 Score = 29.5 bits (63), Expect = 8.0 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G GGGG R GGGG G G G GG R Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDR 48 >Z11743-1|CAA77802.1| 1403|Drosophila melanogaster prospero protein. Length = 1403 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >M81389-1|AAA28841.1| 1407|Drosophila melanogaster Pros protein protein. Length = 1407 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1069 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1114 >D10609-1|BAA01464.1| 1403|Drosophila melanogaster prospero protein. Length = 1403 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >BT015263-1|AAT94492.1| 1374|Drosophila melanogaster LD37627p protein. Length = 1374 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P + A P PPPP + + PPPP P Sbjct: 182 PAPPPPAAGAPKP-PPPPPPKAAP--RPPPPAP 211 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P + A P PPPP + + PPPP P Sbjct: 182 PAPPPPAAGAPKP-PPPPPPKAAP--RPPPPAP 211 >AY060680-1|AAL28228.1| 598|Drosophila melanogaster GH11848p protein. Length = 598 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 454 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 499 >AF190403-1|AAF05703.1| 1403|Drosophila melanogaster homeodomain transcription factorProspero protein. Length = 1403 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 32.3 bits (70), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GG GG Sbjct: 26 GGRGGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGG 63 >AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA, isoform A protein. Length = 2602 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 287 KKXPPPXXPGGGFX----PGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 K PPP P GG+ P PP R PPP P PP Sbjct: 1414 KLSPPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1462 >AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB, isoform B protein. Length = 2693 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 287 KKXPPPXXPGGGFX----PGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 K PPP P GG+ P PP R PPP P PP Sbjct: 1505 KLSPPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1553 >AE014297-1287|AAN13500.2| 1374|Drosophila melanogaster CG17228-PD, isoform D protein. Length = 1374 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >AE014297-1286|AAF54628.2| 1403|Drosophila melanogaster CG17228-PC, isoform C protein. Length = 1403 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1065 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1110 >AE014297-1285|AAN13501.2| 1535|Drosophila melanogaster CG17228-PA, isoform A protein. Length = 1535 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPP 818 R G PPPPP P LPT P P S +F P P Sbjct: 1226 RSSGGAAYHPQPPPPPPPMMPVSLPTSVAIPNPSLHESKVFSPYSP 1271 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P + A P PPPP + + PPPP P Sbjct: 182 PAPPPPAAGAPKP-PPPPPPKAAP--RPPPPAP 211 >BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p protein. Length = 758 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G K R GGGGV G GGGGG Sbjct: 241 PDGSGAEITLTKSRRAGGGGGVDGGGGGGGAGGGGG 276 >BT011330-1|AAR96122.1| 504|Drosophila melanogaster SD21550p protein. Length = 504 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 759 LPTPPPPXXRXSXLFXPPPPGPXG 830 + TPPPP S + PPP GP G Sbjct: 444 IDTPPPPPQDGSVVIPPPPVGPEG 467 >BT010018-1|AAQ22487.1| 605|Drosophila melanogaster RE15062p protein. Length = 605 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 759 LPTPPPPXXRXSXLFXPPPPGPXG 830 + TPPPP S + PPP GP G Sbjct: 545 IDTPPPPPQDGSVVIPPPPVGPEG 568 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 508 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 558 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA, isoform A protein. Length = 758 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G K R GGGGV G GGGGG Sbjct: 241 PDGSGAEITLTKSRRAGGGGGVDGGGGGGGAGGGGG 276 >AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC, isoform C protein. Length = 702 Score = 31.9 bits (69), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G K R GGGGV G GGGGG Sbjct: 185 PDGSGAEITLTKSRRAGGGGGVDGGGGGGGAGGGGG 220 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 538 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 538 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 31.9 bits (69), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXSXAXLPTPP-PPXXRXSXLFXPP-PPGPXGXP 836 +G G P PP P P PP P F PP PPGP G P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 >AE013599-1291|AAM68734.1| 504|Drosophila melanogaster CG13204-PB, isoform B protein. Length = 504 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 759 LPTPPPPXXRXSXLFXPPPPGPXG 830 + TPPPP S + PPP GP G Sbjct: 444 IDTPPPPPQDGSVVIPPPPVGPEG 467 >AE013599-1290|AAF58652.1| 605|Drosophila melanogaster CG13204-PA, isoform A protein. Length = 605 Score = 31.9 bits (69), Expect = 1.5 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 759 LPTPPPPXXRXSXLFXPPPPGPXG 830 + TPPPP S + PPP GP G Sbjct: 545 IDTPPPPPQDGSVVIPPPPVGPEG 568 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 723 PPP-----PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP PP P P PPPP + PPPGP Sbjct: 539 PPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGP 577 >AE014297-996|AAF54422.3| 4671|Drosophila melanogaster CG9492-PA protein. Length = 4671 Score = 31.5 bits (68), Expect = 2.0 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GG K +D GGGG G A GGGGG Sbjct: 903 GSGGRKPEDG---GGGGGGAAAPSTSGGGGGG 931 >X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein protein. Length = 850 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 72 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 105 >U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa protein. Length = 1028 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 72 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 105 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GG GG + F G G F GG G GGG G GGG Sbjct: 66 GGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 >BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p protein. Length = 512 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G+ P P P A PPPP + PPP P P Sbjct: 172 GAAAAPAAPAAAPAPAPAAAAAPPPPPPPAAAPAAAAPPPAPAAAP 217 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + GGGG G G G GGG Sbjct: 668 GGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG R G GG G GGGGG Sbjct: 774 GPGPGPGGGG----SGRGAGSGGWSSGPGGGGSGGGGG 807 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGG-GGGXXKR 710 G GGGG GGGG G G GG GGG K+ Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKK 839 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG GGGG G G GG GG Sbjct: 792 GWSSGPGGGGS-------GGGGGSGGWGSGTGGGGSGG 822 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P + P PPPP PPPP P Sbjct: 1271 PTPPKPVAA---PVPPPPLPLTPPAAPPPPPPP 1300 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GG GG + F G G F GG G GGG G GGG Sbjct: 66 GGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 >BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p protein. Length = 739 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXG-GGGVGRXAXEXGXGGGGG 722 G GG G + D R G GG G G GGGGG Sbjct: 456 GGGGSGSRGYDNRNRGYAGGSGGGGGGGGGGGGGG 490 >AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p protein. Length = 981 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G GGGG Sbjct: 823 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 860 >AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p protein. Length = 975 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 72 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 105 >AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p protein. Length = 469 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXG-GGGVGRXAXEXGXGGGGG 722 G GG G + D R G GG G G GGGGG Sbjct: 186 GGGGSGSRGYDNRNRGYAGGSGGGGGGGGGGGGGG 220 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P A PT PP S PP P Sbjct: 154 PPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 >AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p protein. Length = 1351 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 573 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 606 >AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein protein. Length = 1222 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 444 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 477 >AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby protein. Length = 1354 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 573 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 606 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GG GG + F G G F GG G GGG G GGG Sbjct: 66 GGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG R G GG G GGGGG Sbjct: 774 GPGPGPGGGG----SGRGAGSGGWSSGPGGGGSGGGGG 807 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGG-GGGXXKR 710 G GGGG GGGG G G GG GGG K+ Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKK 839 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG GGGG G G GG GG Sbjct: 792 GWSSGPGGGGS-------GGGGGSGGWGSGTGGGGSGG 822 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + GGGG G G G GGG Sbjct: 668 GGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 >AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB, isoform B protein. Length = 2309 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G GGGG Sbjct: 2151 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 2188 >AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA, isoform A protein. Length = 2309 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G G GGGG Sbjct: 2151 GSGSGNGGGGGGGAGGSQVGGNGGGNGVGSVGQSGGGG 2188 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P + P PPPP PPPP P Sbjct: 1331 PTPPKPVAA---PVPPPPLPLTPPAAPPPPPPP 1360 >AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA protein. Length = 1027 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P A P PPPP S + PPPP Sbjct: 465 PPARSPTPAAAAPPPPPPPPSPS--YEPPPP 493 >AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA, isoform A protein. Length = 975 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 72 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 105 >AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD, isoform D protein. Length = 1028 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 72 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 105 >AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC, isoform C protein. Length = 1222 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 444 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 477 >AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB, isoform B protein. Length = 1351 Score = 31.1 bits (67), Expect = 2.6 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G A G GGGGG Sbjct: 573 GSGGGGCTGNGGGGASGPGGGPSANSGGGGGGGG 606 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 523 GGGGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGGG 356 GG GG + F G G F GG G GGG G GGG Sbjct: 66 GGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + GGGG G G G GGG Sbjct: 668 GGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGG 699 >AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-PA protein. Length = 329 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG D GGG G + G GGGGG Sbjct: 295 GKGGGGGGG-DGGGGGGGDDGGEGDDGGDGGGGG 327 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P A PT PP S PP P Sbjct: 154 PPPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 >AE014296-365|AAF47576.2| 451|Drosophila melanogaster CG13923-PA protein. Length = 451 Score = 31.1 bits (67), Expect = 2.6 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPP 779 PPPP P S A LP PPPP Sbjct: 202 PPPPFPLSTA-LPLPPPP 218 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG R G GG G GGGGG Sbjct: 774 GPGPGPGGGG----SGRGAGSGGWSSGPGGGGSGGGGG 807 Score = 31.1 bits (67), Expect = 2.6 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGG-GGGXXKR 710 G GGGG GGGG G G GG GGG K+ Sbjct: 801 GSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKK 839 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GPGGGG GGGG G G GG GG Sbjct: 792 GWSSGPGGGGS-------GGGGGSGGWGSGTGGGGSGG 822 >AE014134-1275|AAF52515.1| 421|Drosophila melanogaster CG5261-PA, isoform A protein. Length = 421 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G+ P P P A PPPP + PPP P P Sbjct: 81 GAAAAPAAPAAAPAPAPAAAAAPPPPPPPAAAPAAAAPPPAPAAAP 126 >AE014134-1274|AAF52514.1| 512|Drosophila melanogaster CG5261-PB, isoform B protein. Length = 512 Score = 31.1 bits (67), Expect = 2.6 Identities = 14/46 (30%), Positives = 16/46 (34%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 G+ P P P A PPPP + PPP P P Sbjct: 172 GAAAAPAAPAAAPAPAPAAAAAPPPPPPPAAAPAAAAPPPAPAAAP 217 >AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-PB protein. Length = 1271 Score = 31.1 bits (67), Expect = 2.6 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXG-GGGVGRXAXEXGXGGGGG 722 G GG G + D R G GG G G GGGGG Sbjct: 989 GGGGSGSRGYDNRNRGYAGGSGGGGGGGGGGGGGG 1023 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 31.1 bits (67), Expect = 2.6 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 G GPGGGG G GG GR G GGGGG Sbjct: 73 GFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGG 112 Score = 29.9 bits (64), Expect = 6.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G + GGGG G G GGGGG Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGG 67 >X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. Length = 326 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP protein) protein. Length = 386 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. Length = 386 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 30.7 bits (66), Expect = 3.5 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXL---FXPPPP 818 GGG + PPPP P P PPP + PPPP Sbjct: 159 GGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 203 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 30.7 bits (66), Expect = 3.5 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GP GG + R GGGG G + G G GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGG 240 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 30.7 bits (66), Expect = 3.5 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXL---FXPPPP 818 GGG + PPPP P P PPP + PPPP Sbjct: 1343 GGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 1387 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 30.7 bits (66), Expect = 3.5 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXL---FXPPPP 818 GGG + PPPP P P PPP + PPPP Sbjct: 1385 GGGGGHMGMRGPPPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 1429 >M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein protein. Length = 1638 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 269 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 306 >BT011082-1|AAR82748.1| 468|Drosophila melanogaster RH73646p protein. Length = 468 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P A +P PP + ++ P Sbjct: 86 PPPPPLPIKGAPVPQPPAVMPHSAGIYGRAP 116 >BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p protein. Length = 1634 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p protein. Length = 1638 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa protein. Length = 145 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GPGG G G GG G G GG GG Sbjct: 57 PGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGGPGG 92 >AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-PA protein. Length = 145 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GPGG G G GG G G GG GG Sbjct: 57 PGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGGPGG 92 >AE014297-2419|AAO41573.1| 1513|Drosophila melanogaster CG31247-PD, isoform D protein. Length = 1513 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P A +P PP + ++ P Sbjct: 1131 PPPPPLPIKGAPVPQPPAVMPHSAGIYGRAP 1161 >AE014297-2418|AAO41572.1| 1513|Drosophila melanogaster CG31247-PA, isoform A protein. Length = 1513 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPPP P A +P PP + ++ P Sbjct: 1131 PPPPPLPIKGAPVPQPPAVMPHSAGIYGRAP 1161 >AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB, isoform B protein. Length = 1638 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA, isoform A protein. Length = 1638 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD, isoform D protein. Length = 1634 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC, isoform C protein. Length = 1634 Score = 30.3 bits (65), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGPXG 830 P P P S + P+P P P + L PPPPG G Sbjct: 17 PSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPGHPG 53 >AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA protein. Length = 242 Score = 30.3 bits (65), Expect = 4.6 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = +3 Query: 723 PPPPPX----PXSXAXLPTPPPPXXRXS---XLFXPPPP 818 PPPPP P A LP PPPP + + + PPPP Sbjct: 112 PPPPPVVKVNPPKPAYLP-PPPPVVKVNPPKPSYLPPPP 149 Score = 29.5 bits (63), Expect = 8.0 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 7/39 (17%) Frame = +3 Query: 723 PPPPPX----PXSXAXLPTPPPPXXRXS---XLFXPPPP 818 PPPPP P + LP PPPP + + + PPPP Sbjct: 129 PPPPPVVKVNPPKPSYLP-PPPPVVKVNPPKPAYVPPPP 166 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 30.3 bits (65), Expect = 4.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PP PP P S P PPPP Sbjct: 1259 PPLPPLPPSRTSAPPPPPP 1277 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 30.3 bits (65), Expect = 4.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K GGGG G GGGGG Sbjct: 255 GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGG 292 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PP S + PPP GP Sbjct: 590 PPPPPIGPPQAYPPQTPP----YSYMNNPPPQGP 619 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 G L+ P P LP PPP + P PPPGP G P Sbjct: 545 GHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGP 592 >BT004502-1|AAO42666.1| 741|Drosophila melanogaster GH07373p protein. Length = 741 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP S + +PTP P + PPPP P Sbjct: 675 PPGAPSHSSMPTPTPTPAEAVVVVLPPPPLP 705 >BT003322-1|AAO25082.1| 575|Drosophila melanogaster AT02511p protein. Length = 575 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG GGG GR + G GGGG Sbjct: 106 GAPGG-GNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGG 142 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G P G GG GGG GR + G GGG Sbjct: 203 GAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PP S + PPP GP Sbjct: 590 PPPPPIGPPQAYPPQTPP----YSYMNNPPPQGP 619 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 22 GGGGGGGYGGGGSSHGGGGDG--GYSYGGGGGGG 53 >AY075346-1|AAL68207.1| 1052|Drosophila melanogaster GH20978p protein. Length = 1052 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PPPP + PPP P Sbjct: 120 PPPQPITSCPLSPPPPPPPQQQQQLPQQLPPPTP 153 >AY071657-1|AAL49279.1| 208|Drosophila melanogaster RE73905p protein. Length = 208 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + LP PP P PGP Sbjct: 61 PPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGP 94 >AY058699-1|AAL13928.1| 600|Drosophila melanogaster LD42024p protein. Length = 600 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + LP PP P PGP Sbjct: 453 PPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGP 486 >AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p protein. Length = 581 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PP S + PPP GP Sbjct: 124 PPPPPIGPPQAYPPQTPP----YSYMNNPPPQGP 153 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 G L+ P P LP PPP + P PPPGP G P Sbjct: 253 GHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGP 300 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 G L+ P P LP PPP + P PPPGP G P Sbjct: 545 GHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGP 592 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 G L+ P P LP PPP + P PPPGP G P Sbjct: 545 GHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGP 592 >AE014298-3195|AAF50943.2| 208|Drosophila melanogaster CG17600-PB, isoform B protein. Length = 208 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + LP PP P PGP Sbjct: 61 PPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGP 94 >AE014298-3192|AAF50946.2| 600|Drosophila melanogaster CG17600-PA, isoform A protein. Length = 600 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP + LP PP P PGP Sbjct: 453 PPPPPGARAGLLLPVPPLPAQYRGMTLPYMRPGP 486 >AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC, isoform C protein. Length = 2148 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 808 GXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G ++ R GGGG G A G GGGG Sbjct: 11 GAAARNKRAGGGGGAGGGAVGSGGAGGGG 39 >AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB, isoform B protein. Length = 2196 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 808 GXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G ++ R GGGG G A G GGGG Sbjct: 11 GAAARNKRAGGGGGAGGGAVGSGGAGGGG 39 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 29.9 bits (64), Expect = 6.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 G L+ P P LP PPP + P PPPGP G P Sbjct: 545 GHSLMPPHMGPHQPPPGMPGLPPPPPHTGYANYGGPPHGPPPGPPGGP 592 >AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-PA protein. Length = 695 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 690 RGGGSXLLXXXPPPPPXPXS---XAXLPTPPPPXXR 788 R S L PPPPP P + A P PPPP R Sbjct: 348 RTTSSDNLPPPPPPPPPPATSTIPATPPLPPPPISR 383 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 22 GGGGGGGYGGGGSSHGGGGDG--GYSYGGGGGGG 53 >AE014296-1367|AAN12011.1| 1052|Drosophila melanogaster CG7915-PB, isoform B protein. Length = 1052 Score = 29.9 bits (64), Expect = 6.0 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P PPPP + PPP P Sbjct: 120 PPPQPITSCPLSPPPPPPPQQQQQLPQQLPPPTP 153 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 29.9 bits (64), Expect = 6.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A P PP S + PPP GP Sbjct: 590 PPPPPIGPPQAYPPQTPP----YSYMNNPPPQGP 619 >AE014134-2898|AAF53643.2| 741|Drosophila melanogaster CG15151-PA protein. Length = 741 Score = 29.9 bits (64), Expect = 6.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP S + +PTP P + PPPP P Sbjct: 675 PPGAPSHSSMPTPTPTPAEAVVVVLPPPPLP 705 >AE013599-2343|AAS64829.1| 575|Drosophila melanogaster CG15920-PB, isoform B protein. Length = 575 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG GGG GR + G GGGG Sbjct: 106 GAPGG-GNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGG 142 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G P G GG GGG GR + G GGG Sbjct: 203 GAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 >AE013599-2342|AAF57953.1| 620|Drosophila melanogaster CG15920-PA, isoform A protein. Length = 620 Score = 29.9 bits (64), Expect = 6.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G G GG GGG GR + G GGGG Sbjct: 106 GAPGG-GNGGRPSDTYGAPGGGNGGRPSDTYGAPGGGG 142 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G P G GG GGG GR + G GGG Sbjct: 203 GAPGGGNNGGRPSSSYGAPGGGNGGRPSDTYGAPGGG 239 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT--PPPPXXRXSXLFXPPPPGP 824 PPPPP +PT PPPP + P P P Sbjct: 60 PPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTP 95 >BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p protein. Length = 1312 Score = 29.5 bits (63), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP 776 PPPPP P P+PPP Sbjct: 342 PPPPPPPPDSRSPPSPPP 359 >BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p protein. Length = 1327 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PP PP P A P PPPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 >BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p protein. Length = 756 Score = 29.5 bits (63), Expect = 8.0 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXPXS------XAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S A PPPP + S L PP G P Sbjct: 106 PPPPPQPQSGKNGTQGASAAPPPPPPQQPSTL--APPTGRLSVP 147 >AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p protein. Length = 836 Score = 29.5 bits (63), Expect = 8.0 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXPXS------XAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S A PPPP + S L PP G P Sbjct: 183 PPPPPQPQSGKNGTQGASAAPPPPPPQQPSTL--APPTGRLSAP 224 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PP P PPPP P Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGG---GPPPPRP 205 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PP P P S P PP PPPPG Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 491 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PP P P S P PP PPPPG Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 673 >AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease protein. Length = 1327 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PP PP P A P PPPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 29.5 bits (63), Expect = 8.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + F P PPP PPP Sbjct: 151 PPPPSPPLFHPPDPPPEDQPPPP 173 >AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-PA protein. Length = 1311 Score = 29.5 bits (63), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP 776 PPPPP P P+PPP Sbjct: 341 PPPPPPPPDSRSPPSPPP 358 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PP P PPPP P Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGG---GPPPPRP 205 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 29.5 bits (63), Expect = 8.0 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXL-PTPPPPXXRXSXLFXPP---PPGP 824 PPPPP P + P PP R + PP PP P Sbjct: 314 PPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPP 351 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 29.5 bits (63), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PP P P S P PP PPPPG Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 673 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,410,606 Number of Sequences: 53049 Number of extensions: 859626 Number of successful extensions: 20347 Number of sequences better than 10.0: 257 Number of HSP's better than 10.0 without gapping: 3445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13575 length of database: 24,988,368 effective HSP length: 86 effective length of database: 20,426,154 effective search space used: 5331226194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -