BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L08 (1044 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 45 7e-05 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 45 1e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 43 4e-04 At1g61080.1 68414.m06877 proline-rich family protein 43 4e-04 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 42 5e-04 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 42 9e-04 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 41 0.002 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 41 0.002 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 40 0.002 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.003 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 39 0.005 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 39 0.006 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 38 0.011 At4g18570.1 68417.m02749 proline-rich family protein common fami... 37 0.025 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 37 0.025 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 36 0.034 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 36 0.044 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 36 0.044 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 36 0.044 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 36 0.044 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.044 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.059 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 36 0.059 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 35 0.077 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 35 0.077 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 35 0.077 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 35 0.077 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 35 0.077 At2g30560.1 68415.m03722 glycine-rich protein 35 0.10 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 35 0.10 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.14 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 34 0.14 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 34 0.14 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 34 0.14 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 34 0.14 At1g02710.1 68414.m00222 glycine-rich protein 34 0.14 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 34 0.18 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 34 0.18 At1g70990.1 68414.m08190 proline-rich family protein 33 0.24 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 33 0.24 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 33 0.31 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 33 0.31 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 33 0.31 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 33 0.31 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.31 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 33 0.31 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 33 0.41 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 32 0.55 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 32 0.55 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 32 0.55 At1g75550.1 68414.m08780 glycine-rich protein 32 0.55 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 32 0.55 At1g26150.1 68414.m03192 protein kinase family protein similar t... 32 0.55 At1g15840.1 68414.m01901 expressed protein 32 0.55 At5g24620.1 68418.m02908 thaumatin-like protein, putative simila... 32 0.72 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 32 0.72 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 32 0.72 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 32 0.72 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 32 0.72 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 0.95 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 31 0.95 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.95 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 31 0.95 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 31 0.95 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 31 0.95 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 31 0.95 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 31 0.95 At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family... 31 0.95 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.3 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 31 1.3 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 31 1.3 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 31 1.3 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 31 1.3 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 1.7 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 31 1.7 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 31 1.7 At3g18810.1 68416.m02389 protein kinase family protein contains ... 31 1.7 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 31 1.7 At1g49270.1 68414.m05524 protein kinase family protein contains ... 31 1.7 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 30 2.2 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 30 2.2 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 30 2.2 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 30 2.2 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 30 2.2 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.2 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 30 2.2 At1g27710.1 68414.m03387 glycine-rich protein 30 2.2 At4g33660.1 68417.m04781 expressed protein 30 2.9 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 2.9 At4g01985.1 68417.m00265 expressed protein 30 2.9 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 30 2.9 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 30 2.9 At1g29380.1 68414.m03592 hypothetical protein 30 2.9 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 30 2.9 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 25 3.5 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 25 3.5 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 3.8 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 3.8 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 3.8 At3g24540.1 68416.m03082 protein kinase family protein contains ... 29 3.8 At2g05440.2 68415.m00575 glycine-rich protein 29 3.8 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 3.8 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 3.8 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 29 3.8 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 5.1 At5g38560.1 68418.m04662 protein kinase family protein contains ... 29 5.1 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 5.1 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 5.1 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 29 5.1 At4g15460.1 68417.m02363 glycine-rich protein 29 5.1 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 5.1 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 5.1 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 5.1 At3g50180.1 68416.m05486 hypothetical protein 29 5.1 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 5.1 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 29 5.1 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 5.1 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 5.1 At5g46730.1 68418.m05757 glycine-rich protein 29 6.7 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 6.7 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 6.7 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 6.7 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 29 6.7 At3g51290.1 68416.m05614 proline-rich family protein 29 6.7 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 29 6.7 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 6.7 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 6.7 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 6.7 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 6.7 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 29 6.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 6.7 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 28 8.9 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 28 8.9 At4g30460.1 68417.m04325 glycine-rich protein 28 8.9 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 28 8.9 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 28 8.9 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 8.9 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 28 8.9 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 28 8.9 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 28 8.9 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 28 8.9 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 28 8.9 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 28 8.9 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 28 8.9 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 28 8.9 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 45.2 bits (102), Expect = 7e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP A LP PPPP R L PPPP P Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP A LP PPPP R PPPP Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGP 824 P PPPP R PPPP P Sbjct: 27 PPPPPPPMRRRAPLPPPPPPP 47 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP ++ PPPP P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP ++ PPPP P P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP P ++ PPPP P P Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PPPP ++ PPPP P Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + +PPPP S PPPP P P Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSS---PPPPPSPAPTP 531 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 L PPP P P + P PPPP S PPPP P Sbjct: 423 LTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPPP PPPP P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP F PPPP P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PPPP ++ PPPP P P Sbjct: 428 PPSPPPPVYSPPPPPPPPP-----PVYSPPPPPPPPPP 460 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 726 PPPPXPX-SXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P S T PPP ++ PPPP P P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P P PP PPP P PPP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Query: 476 KKKKXXXGXXXPPPPPXH 529 PPPPP H Sbjct: 526 SPAPTPVYCTRPPPPPPH 543 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXX---RXSXLFXPPPPGPXGXP 836 PPPPP P P+PPPP PPPP P P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPP---PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP PP P + P PP P PPPP P P Sbjct: 506 PPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPP 546 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPP---PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P S +PPPP L PPPP P P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIY--PYLSPPPPPTPVSSP 601 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPX---SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PPPP P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSX---LFXPPPPGP 824 PP P LP+PPPP S L PPPP P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSP 431 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPP--PXPXSXAXLPTPPPPXXRXSX----LFXPPPPGPXGXP 836 PPPP P P L PPPP S ++ PPPP P P Sbjct: 575 PPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEP 618 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPPPGP 824 PPPPP P S PTP PPP PPPP P Sbjct: 591 PPPPPTPVSSPP-PTPVYSPPPPP---PCIEPPPPPP 623 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P PPPP S PPPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSS--PPPPP 645 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/76 (26%), Positives = 22/76 (28%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P + P PP + PPP P PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPP-----VYSPPPPSPPPPPPPVYSPPPPPPPPPPPPV 509 Query: 476 KKKKXXXGXXXPPPPP 523 PPPPP Sbjct: 510 YSPPPPPVYSSPPPPP 525 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P PPP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPP 478 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PPPP S PPPP P Sbjct: 609 PPPPPPCIE---PPPPPPCIEYS----PPPPPP 634 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP P P Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPP 462 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPP---PXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P +PPPP PPP P Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSP 581 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP S P PPPP S PPPP Sbjct: 651 PPPPPVYYSS---PPPPPPVHYSS----PPPP 675 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P PP P S PPPP Sbjct: 539 PPPPHSPPPPQFSPPPPEPYYYSS----PPPP 566 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/76 (25%), Positives = 20/76 (26%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PP P F P + P PP PH PPP P Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP--PIYPYLSPPPPPTPV 598 Query: 476 KKKKXXXGXXXPPPPP 523 PPPPP Sbjct: 599 SSPPPTPVYSPPPPPP 614 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPP-----PXXRXSXLFXPPPPGP 824 PPPP P P PPP P PPPP P Sbjct: 629 PPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/76 (25%), Positives = 20/76 (26%), Gaps = 1/76 (1%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXP-HXPPPXSXXXKXXGXXXPXXX 472 PPP P P PP PPP P + PPP P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Query: 473 XKKKKXXXGXXXPPPP 520 PPPP Sbjct: 470 PPPPPPPPPVYSPPPP 485 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P+PPPP PPPP P P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYP 435 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP ++ PPP P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP P PP P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP----PXXRXSXLFXPPPPGP 824 PPPPP P P PPP P ++ PPPP P Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PPPP PPPP P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPP--PPPPPPPYVYP 411 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P PPP Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPPP 422 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPP 421 PPP P P PP + + PPP P PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP P P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A P PPPP + PPPP P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A P PPPP PPPP P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PPPP + + PPPP P G Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPG 544 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + A P PPPP + PPPPG P Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAP 562 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P A + PPPP + PPPP P G Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPG 557 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRX-SXLFXPPPPGPXGXP 836 PPPPP P + A P PPPP + PPPPG P Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAP 549 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + PPPP PPPP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXP-XSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A P PPPP + PPPP P Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P+PPP S PPPP P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P + A P PPPP + PPP P G Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRA--PSPPPMPMG 583 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 4/37 (10%) Frame = +3 Query: 726 PPPPXPXSXAXL----PTPPPPXXRXSXLFXPPPPGP 824 PPPP P + L P PPPP + + PPPP P Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPPPXPXSXAX-----LPTPPP--PXXRXSXLFXPPPPGPXGXP 836 PPPPP P S LP+PPP P + PPPP P P Sbjct: 420 PPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P S + P PPPP + PPPP P Sbjct: 577 PPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +3 Query: 702 SXLLXXXPPPPPXP-------XSXAXLPTPPP-PXXRXSXLFXPPPPGPXGXP 836 S L PPPPP P + LP+PPP P + PPPP P P Sbjct: 411 SSQLFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPP 463 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPXSXAXL-----PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + L P P PP + PPPP P P Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLP 517 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP F PPPP P Sbjct: 454 PPPPPPP--------PPPPAVMPLKHFAPPPPPP 479 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGP 824 P PPP P + P PPPP + PPPP P Sbjct: 575 PSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P + P PPPP + PPPP P Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + A P PPPP + PPP P Sbjct: 605 PPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPP--PPXXRXSXLFXPPPPGP 824 PPPPP P P PP PP F PPPP P Sbjct: 460 PPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 3/79 (3%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXP---HXPPPXSXXXKXXGXXXPX 466 PPP P PG PP PPP P P P G P Sbjct: 536 PPPPPP----PPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Query: 467 XXXKKKKXXXGXXXPPPPP 523 G PPPPP Sbjct: 592 PPPPPMPLANGATPPPPPP 610 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PPP P PPP K P PPPPP Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPP 458 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/76 (25%), Positives = 19/76 (25%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXX 475 PPP P PP PP P PP K P Sbjct: 440 PPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPA 499 Query: 476 KKKKXXXGXXXPPPPP 523 K PPPPP Sbjct: 500 FKPLKGSAPPPPPPPP 515 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P S A P PPPP + PPPPG G Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKG 418 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PPPP + PPPP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP A P PPPP + + PPP G P Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPP 433 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P + P PPPP S PPPP P P Sbjct: 372 PPAPPGPANQTSPPPPPPP----SAAAPPPPPPPKKGP 405 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG-PXG 830 PPPPP P P PPPP + P PPG P G Sbjct: 408 PPPPPPPGKKGAGPPPPPPMSKKG---PPKPPGNPKG 441 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXPXXKKK 485 PP A P PPP PPP K P P KK Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKK 417 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +3 Query: 327 PRGXXKXXXXPPPXAFXXFXXPXPPPX---P-TXPPPXXXXKXXXGXXXPXPXXKK 482 P G PPP P PPP P PPP K G P P KK Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKK 430 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 395 PPPXPH--XPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PPP P PPP K P KK G PPPPP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKK----GAGPPPPPP 426 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP PPPP P P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 G L+ PPPPP A LP PPPP PPPP Sbjct: 8 GAYSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 G+ L PPPPP P P PPPP PPPP P Sbjct: 8 GAYSLVPLPPPPP-PLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP 812 PPPPP P P PPPP PP Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPPG 821 PPPPP P S A +PPPP + ++ PPPPG Sbjct: 52 PPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPPG 87 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PP + PPP P PPP S P K G PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSK-----YGRVYPPPPP 86 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXL--FXPPPP 818 PPPPP P S P PPPP + + PPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPP 73 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP + PPPP P Sbjct: 246 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXP---XSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P A P PPPP + + PPPP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL----FXPPPPGPXG 830 PPPPP + P PPPP + + L PPP P G Sbjct: 261 PPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAPRG 300 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 P P P PPP K P K K G PPPPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKN--NGPSPPPPPP 279 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +3 Query: 726 PPPPXPXSXAXLP-TPPPPXXRXSXLFXPPPPGP 824 PPPP P + A TPPPP + ++ PPPP P Sbjct: 179 PPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP S PPPP P Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPPP PPPP + ++ PPPPG Sbjct: 208 PPPPPQAARSYKRSPPPPPPSKYGRVYSPPPPG 240 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPP 818 L+ PPPPP S P +PPPP S PPPP Sbjct: 39 LVDLSPPPPPVNISSPPPPVNLSPPPPPVNLS---PPPPP 75 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 8/40 (20%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXS-----XLFXPPPP 818 PPPPP S P +PPPP S LF PPPP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P L +PPPP S PPPP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLS---PPPPP 111 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P L +PPPP S PPPP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLS---PPPPP 147 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPP 818 PPPPP S P +PPPP S PPPP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLS---PPPPP 93 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P L +PPPP L PPPP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPP----PVLLSPPPP 137 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPP 818 PPPPP S P +PPPP L PPPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPP----PVLLSPPPP 101 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPP 818 PPPPP S P +PPPP S PPPP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLS---PPPPP 120 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPP 818 PPPPP S P +PPPP L PPPP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPP----PVLLSPPPP 128 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP S PPPP P Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRS----PPPPRP 184 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 708 LLXXXPPP----PPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 +L PPP PP P + P PP P PPPP Sbjct: 157 VLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPP 197 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P PPP +F PPPP P P Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSP 618 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = +3 Query: 723 PPP----PPXPXSXAXLPTPPPPXXRXSX--LFXPPPP 818 PPP PP P + P+PPPP +F PPPP Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + +PPPP S ++ PPPP P Sbjct: 594 PPPPPVFSPPPPVFSPPPP----SPVYSPPPPSHSPPP 627 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-PPXXRXSXLFXPPPP 818 PPPP + P PP P S ++ PPPP Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPP 555 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPP---PXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P S P PPP ++ PPPP Sbjct: 602 PPPPVFSPPPPSPVYSP-PPPSHSPPPPVYSPPPP 635 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP S PPP + PPPP P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP + +PPPP PPPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/32 (59%), Positives = 19/32 (59%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P A P PPPP S LF PPPP Sbjct: 230 PPPPPPPPHQAQ-PPPPPP----SGLFPPPPP 256 Score = 31.9 bits (69), Expect = 0.72 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 696 GGSXLLXXXPPPP-----PXPXSXAXLPTPPPPXXRXSXLFXP-PPPGPXGXP 836 G + L PPPP P P P PPPP F P PP G G P Sbjct: 225 GANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNG--FRPMPPAGGFGHP 275 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 726 PPPPXPXSXAX---LPTPPPPXXRXSXLFXPPPPGPXG 830 P P P S LP PPPP + PPPP P G Sbjct: 215 PEPNKPQSAVGANGLPPPPPPPPHQA---QPPPPPPSG 249 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 21/40 (52%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 S L PPPPP P S P PPPP + + PPPPG Sbjct: 708 STRLGAPPPPPPPPLSKT--PAPPPPPLSKTPV-PPPPPG 744 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 L P PPP P S +P PPPP PPP G G Sbjct: 722 LSKTPAPPPPPLSKTPVP-PPPPGLGRGTSSGPPPLGAKG 760 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXL------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A + P PPP + L PPPP P Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPP 719 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P S L PPPP PPP P Sbjct: 699 PAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + PPP + PPPP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 11/54 (20%) Frame = +3 Query: 708 LLXXXPPPPPXPX---------SXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 LL PPPPP P S P PPPP + F P PPP P P Sbjct: 480 LLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPPGP 824 PPPPP P S +P+P PPP PPPP P Sbjct: 600 PPPPPPPPSSRSIPSPSAPPP---------PPPPPP 626 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +3 Query: 723 PPPPPXPXSXAXL---------PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P S + P PPPP + + P PP P P Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLP 705 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PP R PPPP P Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPP---PPPPPPP 607 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXR--XSXLFXPPPPGP 824 PPPP P P PPPP R S PPPP P Sbjct: 594 PPPPRPPP----PPPPPPSSRSIPSPSAPPPPPPP 624 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PPP L PPPP P P Sbjct: 573 PPPPPPPPPLPSRSIPPP-------LAQPPPPRPPPPP 603 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPXPX-----SXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P PPPP + PP P P Sbjct: 642 PPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPP 684 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 11/45 (24%) Frame = +3 Query: 723 PPPPPXPXSXAXL-----------PTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S P PPPP + PPPP P Sbjct: 619 PPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 8/42 (19%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLF------XPPPPGP 824 PPPPP P + P PPPP S PPPP P Sbjct: 644 PPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXPXXXXXXXRG 863 L P PPP P + PPP PPPP P G RG Sbjct: 733 LSKTPVPPPPPGLGRGTSSGPPPLGAKGS-NAPPPPPPAGRGRASLGLGRG 782 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXPXXXXXXXRG 863 PPPP PPP + S PPPP G RG Sbjct: 739 PPPPPGLGRGTSSGPPPLGAKGSNAPPPPPPAGRGRASLGLGRGRG 784 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS--XLFXPPPPGP 824 PPP P P PPPP S PPPP P Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/78 (24%), Positives = 22/78 (28%), Gaps = 2/78 (2%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHX--PPPXSXXXKXXGXXXPXX 469 PPP P F P + PPP P PPP + P Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Query: 470 XXKKKKXXXGXXXPPPPP 523 + PPPPP Sbjct: 606 PPSSRSIPSPSAPPPPPP 623 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP S PPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPP PPPP P Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 6/40 (15%) Frame = +3 Query: 723 PPPPPXPXSX-----AXLPTPPPPXX-RXSXLFXPPPPGP 824 PPPPP P + +P PPPP L PPPP P Sbjct: 57 PPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPPXXXXKXXXGXXXPXP 470 PPP P PPP P PPP G P P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP L +PPPP P PP Sbjct: 76 PPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 LL PP P S P PPPP PPPP Sbjct: 28 LLVQSQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 L PPP P P S P P PP PPP P Sbjct: 88 LSSPPPPQPPPRSQ---PPPKPPQKNLPRRHPPPPRSP 122 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P PP + PPP P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P PPPP + PPPP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPP 779 L PPPPP S A P PPPP Sbjct: 320 LLQQPPPPP-SVSKAPPPPPPPP 341 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLF-XPPPPGPXGXP 836 PPPPP P +PPPP + + PPPP P P Sbjct: 523 PPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYP 561 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 726 PPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P + P PP P + PPPP P P Sbjct: 567 PPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYP 606 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLP----TPPPPXXRXSXLFXPPPPGP 824 PPPPP S P +PPPP S PPPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSP--PPPPPSP 529 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPX----PXSXAXLPTPPPPXXRXSXLF--XPPPPGPXGXP 836 PPPPP P A P PPPP + S PPPP P P Sbjct: 424 PPPPPSSKMSPSVRAYSP-PPPPYSKMSPSVRAYPPPPPPSPSP 466 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 726 PPPPXPXSXAXL-PTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P+PPPP P PP P Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P +PPPP S PPPP Sbjct: 460 PPPSPSPPPPYVYSSPPPPYVYSS---PPPPP 488 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 726 PPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P + P PP P PPPP P P Sbjct: 552 PPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYP 591 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 726 PPPPXPXSXAXL---PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P + P PP P PPPP P P Sbjct: 582 PPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYP 621 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 726 PPPPXPXSXAXL-PTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P+PPPP P PP P Sbjct: 612 PPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 726 PPPPXPXSXAXL-PTPPPPXXRXSXLFXPPPPGP 824 PPPP P + P+PPPP P PP P Sbjct: 627 PPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 726 PPPPXPXSXAXL-PTPPP--PXXRXSXLFXPPPP 818 PPPP P + P+PPP P S PPPP Sbjct: 642 PPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS---XLFXPPPPGPXGXP 836 PPPP S + TPPPP + S + PPPP P P Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEP 511 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A PPPP + PPP P Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP S + TPPPP + S F PP P Sbjct: 456 PPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPP 489 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP S TPPPP + S F PP P Sbjct: 441 PPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP 474 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + PPPP PPPP P P Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYP 684 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP S PPPP + PPP P P Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYP 698 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP-PPPGPXGXP 836 PPPPP P P+PPPP S PPP P P Sbjct: 501 PPPPPPPEYE---PSPPPPSSEMSPSVRAYPPPPPLSPP 536 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP +PPPP + + PPP P Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P S P+PPPP S PPPP P P Sbjct: 528 PPPPPLSPPP-PSPPPPYIYSS----PPPPSPSPPP 558 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P A PPPP + PPPP P P Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYP 641 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P PPPP PPPP P P Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYP 727 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P P PP P ++ PPP Sbjct: 536 PPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P PP P PPPP P P Sbjct: 705 PPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYP 742 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAX--LPTPPPPXXRXSXLFXPPPPGP 824 PPPP S LP PPPP + S F PP P Sbjct: 425 PPPPSFKMSPTVRVLP-PPPPSSKMSPTFRATPPPP 459 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP S + PPPP PPPP P Sbjct: 513 PPPPSSEMSPSVRAYPPPPP------LSPPPPSP 540 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP + + P PPPP + PPPP Sbjct: 607 PPPPTYYATQS--PPPPPPPTYYAVQSPPPPP 636 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPX---PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P A P PPPP S PPPP P Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPS----PPPPSSEMSP 522 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP +PPP + PPP P Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPP 708 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P +PPP PPPP Sbjct: 550 PPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXS 794 S L PPPPP P A P PPPP + S Sbjct: 319 SSLRSQPPPPPPSPEHKAPAPPPPPPMSKAS 349 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP PT + S PPPP P Sbjct: 297 PPPPPLTSPQTPSPTVSTFNTKSSLRSQPPPPPP 330 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P P PPPP + PPPP P Sbjct: 22 PPPPPPSLPP--PVPPPPPSHQPYSYPPPPPPP 52 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 10/48 (20%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP----------XXRXSXLFXPPPPGPXGXP 836 PPPPP + P PPPP + + L PPPP P P Sbjct: 34 PPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAP 81 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP P P S L PPPP + PPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P P + P PPPP PPPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPP--VPPPPP 38 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXS---XAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP + A P+PPPP + S PPPP Sbjct: 238 PPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXL---FXPPPPGP 824 PPPP + P PPPP + L PPP P Sbjct: 256 PPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + P PPPP S PPPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPS----PPPP 92 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPP-PPGPXGXP 836 P PPP P + P+PPPP PP PP P P Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P S P PP P PPPP Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PPPP S PPPP P P Sbjct: 62 PPPPPPP------PCPPPP----SPPPCPPPPSPPPSP 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPX---SXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GGG+ PPP P P A P PPPP PPPP P P Sbjct: 39 GGGND---NNPPPSPSPEPEPEPADCPPPPPPPP------CPPPPSPPPCP 80 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P P PP PPP P P Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPP--------XXRXSXLFXPPPPGP 824 L PPPPP P + P+PPPP S L PPPP P Sbjct: 45 LQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 PPPP S P PPPP PPG Sbjct: 69 PPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPG 100 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPP 523 PPP P PPP P KK PPPPP Sbjct: 49 PPPPPSPPPPSCTP----SPPPPSPPPPKKSSCPPSPLPPPPP 87 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTP---PPPXXRXSXLFXPPP 815 PP PP P + P+P PPP + +F PP Sbjct: 66 PPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L PPPP P + LP PPP + LF P PP P P Sbjct: 1075 LPPSPPPPSPPLPPSSLPPPPP-----AALFPPLPPPPSQPP 1111 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + P PPPP PPP P P Sbjct: 1092 PPPPP---AALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P S P PP P S L PPPP P Sbjct: 1070 PPLPPLPPS----PPPPSPPLPPSSL-PPPPPAALFPP 1102 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP + P PPPP Sbjct: 1110 PPPPPLSPPPSPPPPPPPP 1128 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 708 LLXXXPPPP--PXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 L PPPP P P + P+PPPP PPPP Sbjct: 1099 LFPPLPPPPSQPPPPPLSPPPSPPPP---------PPPP 1128 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 35.5 bits (78), Expect = 0.059 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P S P PPP S + PP P P Sbjct: 139 PPPAPASPPPAPVSPPPVQAPSPISLPPAPAP 170 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P A PT PP PPP P P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPP 133 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PP--PPPXPXSXAXLP-TPPPPXXRXSXLFXPPPPGPXGXP 836 PP PPP P S P +PPP PPP P P Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP S +P PPPP F PPPP Sbjct: 42 PPPPPYRSPVTIP-PPPPVYSRPVAFPPPPP 71 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = +3 Query: 723 PPPPPXPXSXAXLP------TPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP ++ PPPP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPP P + +PPPP ++ PPP Sbjct: 75 PPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + TPPPP PPPP P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP PTP P PPPP P P Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAX-LP-TPPPPXXR--XSXLFXPPPPGP 824 PPPPP P + P TPPPP + + PPPP P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXR---XSXLFXPPPPGPXGXP 836 PPPPP P + PPPP + + PPPP P P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PP +P PPPP PPPP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXR---XSXLFXPPPPGPXGXP 836 PPPPP P + PPPP + + PPPP P P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPP 131 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 154 PPPTPTPEAPCPPPPPTPYPPPP 176 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 35.1 bits (77), Expect = 0.077 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P S +P PPPP Sbjct: 10 PPPPPPPPSFRSIPRPPPP 28 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPPGPXGXP 836 PPPPP + +PPPP ++ PPPP P P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP 625 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + + +PPPP ++ PPPP P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPP-----VYSPPPPPPVYSP 527 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPP---PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P P PPPP ++ PPPP P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPP------VYSPPPPPPVHSP 545 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPP P P PPPP +F PPPP Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP + +PPPP ++ PPPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 726 PPPPXPXSXAXLP---TPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P +PPPP ++ PPPP P P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPP----PPVYSPPPPPPVYSP 536 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP + +PPPP + PPPP Sbjct: 537 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP PPP P P Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP S P PPP + PPPP Sbjct: 527 PPPPPPVYSP---PPPPPVHSPPPPVHSPPPP 555 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP PPP P P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSP 661 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P PPP + PPPP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP P + +PPPP + PPPP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP PP P PPPP + S PPPP Sbjct: 66 PPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 726 PPPPXPXSXAXLPTP--PPPXXRXSXLFXPPPP 818 PPPP P A P P PPP + + PPPP Sbjct: 64 PPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P+PPPP PPPP Sbjct: 59 PPPPSPPP-----PSPPPPACPPPPALPPPPP 85 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG K+ GGGG G+ G GGGG Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXG--XGGGGG 722 G GGGG R GGGG + G GGGGG Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GG + GGGG G+ G GGGG K Sbjct: 89 GISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGK 129 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGG---GGVGRXAXEXGXGGGGG 722 G G GGGG GG GG G G GGGGG Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 GG G GGGG G G GGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGG 32 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 +L PPPPP P + TP P S PPP P P Sbjct: 567 ILSRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPP 609 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXHHN 535 PPP P PP S P KK PPPPP H+ Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHS 647 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 7/41 (17%) Frame = +3 Query: 723 PPPPPXPX-------SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S + LP P PP + PPPP P Sbjct: 603 PPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 32.3 bits (70), Expect = 0.55 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 2/82 (2%) Frame = +2 Query: 296 PPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXX--PXX 469 PPP P P P T PP P PPP P Sbjct: 571 PPPPPP----PPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPL 626 Query: 470 XXKKKKXXXGXXXPPPPPXHHN 535 KK PPPPP H N Sbjct: 627 PPKKLLATTNPPPPPPPPLHSN 648 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P PP P S PPPP P P Sbjct: 708 PPPPPAP------PAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P PTP P PP P P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLP 764 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +3 Query: 723 PPPPPXPXSXAXL--------PTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + + P PP P PPPP P P Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L PPPPP P T PP PPPP P P Sbjct: 686 LPRPPPPPPPPPMQHSTVTKVPP---------PPPPAPPAPP 718 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + A PPPP + L P GP P Sbjct: 776 PPPPPLGQTRAPSAPPPPPPKLGTKL---SPSGPNVPP 810 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 723 PPPPPXP--XSXAXLPTPPP--PXXRXSXLFXPPPPGPXG 830 PPP P P S A P PPP P PPPPGP G Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P + P PPPP PPPP G Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGP--RPPPPMSLG 420 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PP GP Sbjct: 402 PPPPPGPKG----PRPPPP-MSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = +3 Query: 723 PPPPPXP--XSXAXLPTPPP--PXXRXSXLFXPPPPGPXG 830 PPP P P S A P PPP P PPPPGP G Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKG 410 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P + P PPPP PPPP G Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGP--RPPPPMSLG 420 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P P PPPP PP GP Sbjct: 402 PPPPPGPKG----PRPPPP-MSLGPKAPRPPSGP 430 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P+PPP R PPPP P P Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVP---PPPPPPPMFDP 57 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 P PPP S P PPPP + PPP Sbjct: 638 PSPPPPSMSGGAPPPPPPPPMLVASRTAPPP 668 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPXSXAXLPTPPPP 779 G L+ PPPPP P P PPPP Sbjct: 142 GADALVPLPPPPPPMPRRS---PPPPPP 166 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 L+ P PP P P PPPP PPP Sbjct: 632 LVRVGSPSPPPPSMSGGAPPPPPPPPMLVASRTAPPP 668 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP S P PPPP PPPP Sbjct: 34 PPPPTNQYSAPYYPYPPPPYATPPPYASPPPP 65 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P S P PPPP + S + P PP P P Sbjct: 22 PAPYRPPSSE--PYPPPPTNQYSAPYYPYPPPPYATP 56 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGGG K GG G G+ + G GGGG Sbjct: 57 GEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG K + GGGG G GGGGG Sbjct: 51 GGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG 88 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G GG K GGGG G E G G GGG K Sbjct: 31 GNGGGSGKGQWLHGGGGEG-GGGEGGGGEGGGGQK 64 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 GGGG G GG G+ + G GGG G +R Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQR 79 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/83 (28%), Positives = 26/83 (31%) Frame = +2 Query: 287 KKXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPX 466 KK PPP P P P + PPP P PPP P Sbjct: 96 KKSPPPPTPKKSPSPPSLTPFVPHPTPKKS----PSPPPTPSLPPPAPKKSPSTPSLPPP 151 Query: 467 XXXKKKKXXXGXXXPPPPPXHHN 535 K PPPPP HH+ Sbjct: 152 TPKKS---------PPPPPSHHS 165 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +3 Query: 699 GSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GS P P P S P+PPPP + S PPPP P P Sbjct: 68 GSAPAISISPSTPIP-STPSTPSPPPPAPKKS----PPPPTPKKSP 108 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P+ PPP + S PPPP Sbjct: 135 PPPAPKKSPSTPSLPPPTPKKS---PPPPP 161 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GGG +D + GGGG G A + G GGGG Sbjct: 290 GKNGGGGHPQDGKNGGGGG-GPNAGKKGNGGGG 321 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P P PP P + PPPP Sbjct: 96 PPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L PPP P P P+PPPP PPPP P P Sbjct: 88 LQNIPPPSPPP------PSPPPPSQAC-----PPPPLPPSPP 118 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P P + A P PP P + PPPP P Sbjct: 249 PPLPPPGTAALPPPPPLPMAAGKGVAAPPPPPP 281 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP---PXXRXSXLFXPPPPGPXGXP 836 PPPPP P + A +P PP + S PPPPG P Sbjct: 194 PPPPPPPGN-AAIPVEPPLTMSAEKESYAPLPPPPGRAALP 233 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + PP + PPPP P Sbjct: 233 PPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLP 266 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGPXGXP 836 P PP P A P PP P + P PPPG P Sbjct: 222 PLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALP 260 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 723 PPPPPXPXSXAX---LPTPPPPXXR 788 PPPPP P + P PPPP R Sbjct: 260 PPPPPLPMAAGKGVAAPPPPPPGAR 284 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P PPP P PPPP S PPPPG G Sbjct: 223 PGPPPKEQDFVRPPLPPPPQLPQSS--QPPPPGLSG 256 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLP--TPPPPXXRXSXLFXPPPPGP 824 PPPPP P P +PPPP ++ PPPP P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPP-----VYSPPPPPP 563 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPP---PPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP PP P + P PPP +F PPPP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLP--TPPPPXXRXSX-LFXPPPP 818 PPPPP P P +PPPP + PPPP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP S PPP ++ PPP P Sbjct: 612 PPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSX-LFXPPPPGPXGXP 836 PPPP + +PPPP + PPPP P P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSP 605 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 726 PPPPXPXSXAXLP--TPPPPXXRXSXLFXPPPP 818 PPPP P P +PPPP ++ PPPP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPP----VYSPPPP 624 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPPGPXGXP 836 PPP P P PP P + PPPP P P Sbjct: 583 PPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP 621 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXL-FXPPPPGP 824 PPPPP P P PPPP L F P P P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P S A LP PP P PPPP P P Sbjct: 42 PLPSPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSP 79 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP S PPPP S PPP P P Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPP 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP + +PPPP + ++ PPP P Sbjct: 97 PPPQAYQAYYYRKSPPPPPSKYGKVYPPPPAKP 129 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP +F PPPP P P Sbjct: 720 PPPPVHSPPPPVQSPPPPP-----VFSPPPPAPIYSP 751 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP + +PPPP ++ PPPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPP 680 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPP---PXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P P + P PPP + PPPP P Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPP 775 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P P PPP + PPPP Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSX-LFXPPPPGPXGXP 836 PPPP + +PPPP + PPPP P P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSP 811 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP + +PPPP S ++ PPPP Sbjct: 788 PPPPVHSPPPPVHSPPPP----SPIYSPPPP 814 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP + +PPPP + PPPP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR-XSXLFXPPPP 818 PPPPP + +PPPP + PPPP Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP PPP P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXH 529 PP PPP H PPP P PPPPP H Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVH 757 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP PPP P P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P PPP + PPPP Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + +PPPP + ++ PPPP P Sbjct: 727 PPPPVQSPPPPPVFSPPPP----APIYSPPPPPVHSPP 760 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P S P+PPPP PPPP P Sbjct: 64 PPPPPPTSPPP-PSPPPPSPPPP---SPPPPSP 92 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P PP P PPPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P P+P P S L P P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLP 202 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PPP P + LP PP P P PGP Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGP 195 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP-PGPXGXP 836 PPP P P P P P L PPP P P P Sbjct: 176 PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPPP S L PPPP P P Sbjct: 162 PLPPPPPPYPSPL--PPPPSPSPTP 184 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP-----PGP 824 G S L PPP P P P P P L PPP PGP Sbjct: 194 GPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGP 242 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G G GG G R GGGG GGGGG +RR Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERR 128 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKR 710 G G GGG GGGG G G G GGG R Sbjct: 100 GYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGR 141 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG + GGGG GR G GGG Sbjct: 116 GYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGG 153 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG G G GGGGG Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG GGGG G G GG GG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGG 178 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT--PPPPXXRXSXLFXPPPPGPXGXP 836 PP PP P P PPPP R PPP P P Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREP 103 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +3 Query: 708 LLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 LL PPP P P S + P PPP LF P PP P Sbjct: 36 LLPLSPPPSP-PPSPSSPPRLPPP---FPALFPPEPPLP 70 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP P L PP R PPPP P P Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPP---PPPPPPEEPP 114 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G GGGG GGGG G G GGGGG K Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYK 106 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG GGGG G + G GGGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG G G GGGGG Sbjct: 68 GWGGGGGGGGG---GGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GG G GGGG G G GGGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGG 91 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 32.3 bits (70), Expect = 0.55 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPP 422 PPP F F P PPP P PP Sbjct: 52 PPPLYFSYFSLPPPPPPPHLPP 73 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P P PPPP S PPPP P P Sbjct: 42 PHPPPP------PPPPPPPLYFSYFSLPPPPPPPHLP 72 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP S LP PPPP Sbjct: 50 PPPPPLYFSYFSLPPPPPP 68 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P P PPPP PPPP P P Sbjct: 42 PHPPPPP------PPPPPPLYFSYFSLPPPPPPPHLPP 73 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P S P+PPPP + PPP P P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEA----PPPANPVSSP 118 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP--PXXRXSXLFXPPPPGPXGXP 836 PPP P P PPP P PPPP P P Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAP 133 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P S + L PPP S P PP P Sbjct: 71 PPPEPSPPSPS-LTGPPPTTIPVSPPPEPSPPPP 103 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 732 PPXPXSXAXLPTPPPPXXRXSXLFXPPPPG 821 P P S + P+PPPP PPPPG Sbjct: 207 PSTPPSDSEHPSPPPP-GHPKRREQPPPPG 235 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G GG G K GGGG G+ G GGGG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGG 46 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGG K K+ GGGG G + E G GGG G Sbjct: 30 GGGEGKKKNGGGEGGGGEG-TSGEGGGGGGDG 60 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 814 GGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 GGG + K G GG G G GGGG K Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTK 62 >At5g24620.1 68418.m02908 thaumatin-like protein, putative similar to thaumatin-like protein [Arabidopsis thaliana] GI:2435406; contains Pfam profile PF00314: Thaumatin family Length = 420 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PP PP P TPPP F PPP Sbjct: 338 PPTPPPPGPNEDSMTPPPQNQNGDGQFMPPP 368 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXR---XSXLFXPPPPGPXG 830 PPPPP P PPPP + + PPP P G Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKG 303 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = +3 Query: 723 PPPPPXPX--------SXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P S + LP P PP + PPPP P Sbjct: 13 PPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPP 54 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 395 PPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXHHN 535 PPP P P S P KK PPPPP H N Sbjct: 15 PPPPPLLQPHHSALSS--SPLPPPLPPKKLLATTNTPPPPPPPLHSN 59 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP P P+PP P PPPP P Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPP-PGPXGXP 836 PPP P P P PP P + PPP P P P Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP---PXXRXSXLFXPPPPGPXGXP 836 P PPP P S + P+PPP P P PP P P Sbjct: 40 PKPPPAP-SPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXP---XSXAXLPTPPPPXXRXSXLFXP---PPPGPXGXP 836 PPP P P A PTPP P + + P PPP P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P P +P P PP PPPP P Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP + + PP P P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAP 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP + PP P P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAP 70 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP + + PP P P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAP 81 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP + + PP P P P Sbjct: 77 PAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P P PP + PP P P P Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAP 103 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P P PP + + PP P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAP 59 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P P PTP P + P PP P P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P PTPP P + + P P P P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTP 72 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P + P PPPP Sbjct: 102 PPPPPQPLNLFSPPPPPPP 120 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP + LF PPPP P P Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP P L +PPPP PPPP P Sbjct: 99 PPQPPPPPQPLNLFSPPPP---------PPPPDP 123 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGGG + + GG G G GGGGG K Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 G G GGGG + + GG G G GGGGG K Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGG-----GVGRXAXEXGXGGGGG 722 G GPGGGG + GGG G G + GGGGG Sbjct: 321 GKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGG 363 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPPP P PPPP PPPPG G Sbjct: 679 PPPPPPPPGGG---PPPPPGGGPPP--PPPPPGALG 709 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P + +PPP +F PPP P P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPP----VFSPPPSPPVYSP 445 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP S PPPP S PPPP P Sbjct: 445 PPPPP---SIHYSSPPPPPVHHSS----PPPPSP 471 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GGGS P P P LP PPPP PPPP P P Sbjct: 39 GGGSDSTNYNSPAPS-PEPEDYLPLPPPPQT------PPPPPPPQSLP 79 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 693 GGGSXLLXXXPPPPPXPXSXAXLPTPP--PPXXRXSXLFXPPPPGP 824 GG P P P P LP PP PP PP P P Sbjct: 40 GGSDSTNYNSPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSP 85 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P + PPP PPPP Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 >At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 340 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP S + LP+PP P S P PP Sbjct: 196 PPPPPQSLSLS-LPSPPQPPPSSSFHAEPIPP 226 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 PPPP P + P PP S + PPP G Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGG 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXS---XLFXPPPPGPXG 830 PPP P P S PPPP S + PPP G Sbjct: 51 PPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSG 89 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPP 432 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P PTPP P + PPPP Sbjct: 153 PPPPTPTPSVPSPTPPVP---TDPMPSPPPP 180 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PP P P PTPP P P PP P P Sbjct: 202 PPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVP 239 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLP--TPPPPXXRXSXLFXPPPPGP 824 PPPP P + P +PPPP S PP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 117 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPP----PPXXRXSXLFXPPPPGP 824 PPPP P PTPP PP S PP P Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPP----PPXXRXSXLFXPPPPGP 824 PPPP P PTPP PP S PP P Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 P PP P +P+P PP PPP P Sbjct: 150 PVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP 183 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 723 PPPPPXPXSXAXLP--TPPPPXXRXSXLFXPPPPGP 824 PPP P P + P +PPPP S + P PP P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTPTPS-VPSPTPPVP 170 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 GGGG R GGGG G G GGGGG Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G GGGG + GGGG GR G GGGG R Sbjct: 88 GSGGGGGH-RGGGSYGGGG-GRREGGGGYSGGGGGYSSR 124 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGG--GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG GG R GGG G E G G GGG Sbjct: 106 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 145 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 GGGG R GGGG G G GGGGG Sbjct: 142 GGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 GGGG GGGG GR G GGGG R Sbjct: 106 GGGGGYSGGGGSYGGGG-GRREGGGGYSGGGGGYSSR 141 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGG--GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GG GG R GGG G E G G GGG Sbjct: 123 GRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGG 162 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/60 (25%), Positives = 19/60 (31%) Frame = +2 Query: 359 PPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXXXXKKKKXXXGXXXPPPPPXHHNK 538 P + + PPP P PPP KK PPPPP + + Sbjct: 374 PQYQSLIPPPSPPPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYTQ 433 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPP-----PPXXRXSXLFXPPPP 818 PPPPP P + P+PP P + + PPPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTP-----PPPXXRXSXLFXPPPPGPXGXP 836 L PPP P S P P PPP + PPPP P P Sbjct: 699 LASPPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSP 745 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P + +PPP + PPPP Sbjct: 735 PPPPPTP-----IHSPPPQSHPPCIEYSPPPP 761 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXP--TXPPP 425 PPP A + P PPP P + PPP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPP 726 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP + P PPP P PP Sbjct: 724 PPPTPTYHYISPPPPPTPIHSPP 746 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXG 830 P PPP P + P+PPPP + PPPP G Sbjct: 45 PSPPPPPSN----PSPPPPSPTTTA--CPPPPSSSG 74 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPP 779 PPPP P S P PPPP Sbjct: 267 PPPPPPGSWQPSPPPPPP 284 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +3 Query: 729 PPPXPXSXAXLPTPP------PPXXRXSXLFXPPPPGPXGXP 836 PPP P P PP PP + PPPP G P Sbjct: 251 PPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGP 292 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PP P S T PPP PPP P P Sbjct: 17 PSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAP 54 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 726 PPPPXPXSXAX---LPTPPPPXXRXSXLFXPPPP 818 PPPP P + + +PPPP S PPPP Sbjct: 63 PPPPLPENSSDGSSSSSPPPPSDSSSQSQSPPPP 96 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP PP P S T PP PPPP Sbjct: 16 PPSPPSPPSSNDQQTTSPPPSDNQETTSPPPP 47 Score = 28.7 bits (61), Expect = 6.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPP 779 PPPP P + +P+PP P Sbjct: 265 PPPPPPGNWQPMPSPPAP 282 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 P PP S L TPPPP L PPPP Sbjct: 365 PVPPPRRSPPPLQTPPPPPP-PPPLAPPPPP 394 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 723 PPPPPXPXSXAXLP---TP-PPPXXRXSXLFXPPPPGP 824 PPPPP + + +P PPP L PPPP P Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPP 384 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP P +PPPP S PPPP Sbjct: 264 PPPPYSPSPKVEFKSPPPPYIYNS----PPPP 291 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP F PPPP Sbjct: 185 PPPPPYYSPSPKVEYKSPPPPYV---YSFPPPPP 215 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 159 PPPPPYYSPSPKVDYKSPPPPYVYSS---PPPPP 189 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 237 PPPPPYYSPSPKVNYKSPPPPYVYSS---PPPPP 267 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 349 PPPPPYYSPSPTVNYKSPPPPYVYNS---PPPPP 379 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 375 PPPPPYYSPFPKVEYKSPPPPYIYNS---PPPPP 405 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG G G G G GGGGG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGG 47 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 G GG G + G G G G GGGGG +R Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGGDSQR 54 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP PTP PP + S + PPP Sbjct: 136 PPPVYTPPVYKPTPSPPVYKKSPSYSSPPP 165 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P GGGG + + R GGG GR G GGGG Sbjct: 3 PPMRGGGGFRGRGGRDGGGG--GRFGGGGGRFGGGG 36 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P P P S A P+PPPP + P P P P Sbjct: 131 PASSPKPESLADSPSPPPPPPQPESPSSPSYPEPAPVP 168 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG + R GGG GR G GGG Sbjct: 487 GGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGG 518 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/61 (34%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -3 Query: 535 VVVXGG-GGGXXXTXXXFFFFXXGXGXXXPXXFXXXXXGGGXVGXGGGXGXXXKXXAXGG 359 VV+ GG GGG + G G P GGG +G GGG G GG Sbjct: 128 VVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGY----GSGGGGIGGGGGIGGGVIIGGGGG 183 Query: 358 G 356 G Sbjct: 184 G 184 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG GGGG + G GGGGG Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP P PPP P PPP Sbjct: 21 PPPVGVPPQYYPPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPP P PPPP PPPP P Sbjct: 20 PPPPVGVPPQYYPPPPPP--------PPPPPPP 44 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 P GGGG GGGG G G GGGG Sbjct: 118 PRAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGGG 152 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K + R GGG G G GGG G Sbjct: 95 GGASGGAGGGGKGR-GRKGGGGAGGGVGGGVGAGGGAG 131 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGG K + + GG G G GG GG Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGG 187 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP----PPPGPXGXP 836 PP P P + + +PPPP P PPP P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP S + T PPP + PPP P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXP----PPPGPXGXP 836 PP P P + + +PPPP P PPP P P Sbjct: 78 PPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPP S + T PPP + PPP P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GGGG A G G GGG Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGG 134 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G P G GGGG GGGG G + G GGG G Sbjct: 110 GTPGGGGGGG--GDTGAGAGGGGYG-GGGDTGAGGGVG 144 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPP P A +P+P PP S LF P Sbjct: 57 PPPNPSQEAPVPSPYPPPPPPSPLFTNLP 85 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 25.0 bits (52), Expect(2) = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGR 758 G GGGG + D G GG GR Sbjct: 63 GGGGGGYQGGDRGGRGSGGGGR 84 Score = 23.0 bits (47), Expect(2) = 3.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGG 722 GGGG R + GGG G Sbjct: 125 GGGGYSRGGGDSDRGGGRG 143 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 25.0 bits (52), Expect(2) = 3.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGR 758 G GGGG + D G GG GR Sbjct: 63 GGGGGGYQGGDRGGRGSGGGGR 84 Score = 23.0 bits (47), Expect(2) = 3.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGG 722 GGGG R + GGG G Sbjct: 125 GGGGYSRGGGDSDRGGGRG 143 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPP 815 PPPP P LP P PP + PP Sbjct: 349 PPPPPPVIQPELPQPQPPPPQLEIEVEAPP 378 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGV--GRXAXEXGXGGGGG 722 G G GG G R GGGG G G GGGGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPP + P PPPP PPPP P P Sbjct: 54 PPPPACAITLKDSPPPPPP---------PPPPPPLQQP 82 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PP A P PPP P PPP Sbjct: 56 PPACAITLKDSPPPPPPPPPPPP 78 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 357 PPPXAFXXFXXPXPPPXPTXPPP 425 PPP A PPP P PPP Sbjct: 54 PPPPACAITLKDSPPPPPPPPPP 76 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 7/47 (14%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPP-------XXRXSXLFXPPPPGPXG 830 L PPPPP L PPPP R PPP P G Sbjct: 53 LFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSG 99 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGG 725 G G GGGG GGGG G G GG G Sbjct: 107 GGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GGGG GGGG G GGGGG Sbjct: 98 GGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP S PPPP PPP P P Sbjct: 68 PPPPPLDSS-----PPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP + P PPPP PP P G P Sbjct: 126 PPPPPADEDESP-PAPPPPEQ-----LPPPASSPQGGP 157 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 723 PPPP----PXPXSXAXLPTPPPPXXRXSXLFXPPPPG---PXGXP 836 PPPP P P PPPP + PPPPG P G P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAY-PPPPGAYPPAGYP 73 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +3 Query: 708 LLXXXPPPPPXPXS----XAXLPTPPPP 779 LL PPPPP P LP PPPP Sbjct: 217 LLPLQPPPPPPPSQPLPRPLLLPPPPPP 244 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGG-GGVGRXAXEXGXGGGGG 722 G G GGGG + GG GG G G GG GG Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGG 397 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP PP +PPPP PPP P Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXS 794 P PP P LP PPPP + S Sbjct: 88 PQPPPPPPIENLPPPPPPLPKFS 110 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPP---PXXRXSXLFXPPPPGP 824 P PPP P S P+ PP P S PPP P Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPP A P P PP PPPP Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + GGGG G E G G G G Sbjct: 75 GGGHASGGGGHAVEGGGHAGGGGGGHGEEEGGHGIGRG 112 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P TPP PPP P Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPP 184 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P + P PPPP P Sbjct: 152 PPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP P A T R PPPP P Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPPPPPP 130 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPP-----XXRXSXLFXPPPPGP 824 S L PPPPP + P PPPP R ++ PPP P Sbjct: 58 SPYLYSSPPPPPYVYNS---PPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 11/45 (24%) Frame = +3 Query: 723 PPPPPXPXSXAXLPT-----PPPP------XXRXSXLFXPPPPGP 824 PPPPP S PT PPPP R + ++ PPP P Sbjct: 96 PPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPP 140 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +3 Query: 681 RAXRGGGSXLLXXXPPPPPXPX--SXAXLPTPPPP--XXRXSXLFXPPPPGP 824 R G + PPPP S P+PPPP S PPPP P Sbjct: 109 RPMNGHDPLAITPSPPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPP 160 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +3 Query: 723 PPPPPXP------XSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPPPP P A P PPPP PPPP P P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPP-----PPPPPPPRLGP 46 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPP P P P PPP L PPP Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGG 722 GGGG GR G GGGGG Sbjct: 160 GGGGGGRYGSGGGGGGGGG 178 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 P G G GG GGGG G GGG G Sbjct: 213 PGGYGSGGGGGSGGGSVGGGGSSSNVVVLGGGGGSG 248 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 823 GPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G GGGG + G GG R G GGGG Sbjct: 117 GGGGGGFARRGGYGGGRGGYARGGFGRGGFGGGG 150 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXK 713 GGGG G G G G GGGGG K Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGGFSK 220 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG GG G G E G GGGG Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGYG--GGEGGGAGGGG 201 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 817 GGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GG G + GGGG A G GGGGG Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 P GGGG R GG G G GGGGG R Sbjct: 58 PPSSGGGGASGGGYRNDGGR-TGYGYGAGGGGGGGGGWNNR 97 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGGXXKRR 707 P GGGG R GG G G GGGGG R Sbjct: 58 PPSSGGGGASGGGYRNDGGR-TGYGYGAGGGGGGGGGWNNR 97 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 671 PPPPPCYSPSPKVVYKSPPPPYVYNS----PPPP 700 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 696 PPPPPCYSPSPKVVYKSPPPPYVYSS----PPPP 725 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 P PPP P S T S L PPPP P P Sbjct: 79 PRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPP 116 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P S PT PPP PPP P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTP 151 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P S + LP PP P Sbjct: 23 PPPPPPPPS-SSLPPPPLP 40 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P S + LP PP P Sbjct: 23 PPPPPPPPS-SSLPPPPLP 40 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 711 LXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 L PP P P S PPPP + PPP P P Sbjct: 36 LEETPPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPP 77 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 829 PXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGG 728 P GGGG K GG G G+ G GGG Sbjct: 41 PQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGG 74 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G GGGG + R GGG GR GG G Sbjct: 18 GRGYGGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRG 55 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 743 PPPPPYYSPSPKVEYKSPPPPYVYSS----PPPP 772 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 723 PPPPPX--PXSXAXLPTPPPPXXRXSXLFXPPPP 818 PPPPP P +PPPP S PPPP Sbjct: 794 PPPPPYYSPSPKVEYKSPPPPYVYSS----PPPP 823 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPP 818 PP P S P PPPP PPPP Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/48 (33%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 696 GGSXLLXXXPPPPPXPX-SXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 GGS PP P S + P PPPP + F P P P Sbjct: 65 GGSRFTTPPPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPP 112 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 835 GXPXGPGGGGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 G G G GG GGG G G GG GG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGG 137 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 811 GGXKXKDXRXXGGGGVGRXAXEXGXGGGGG 722 GG D GGGVG G GGGGG Sbjct: 21 GGLVQTDASFGVGGGVGVGIGGGGGGGGGG 50 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P + +P PPP S P P P Sbjct: 69 PPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXP--PPPGP 824 P PP P + + TPPP P PPP P Sbjct: 13 PSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSP 47 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 778 GGGGVGRXAXEXGXGGGGGXXKR 710 GGGG+G G GGGGG R Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGR 234 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPP 779 PPPPP P P PPP Sbjct: 125 PPPPPYPRQVHPQPPAPPP 143 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 702 SXLLXXXPPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 S +L PPPPP PTP PP S PPP P P Sbjct: 188 SAILLPPPPPPP--------PTPRPPRLLSSQP-APPPTPPVSLP 223 >At2g23990.2 68415.m02866 plastocyanin-like domain-containing protein Length = 226 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P A P PP P + S P P P Sbjct: 165 PPKPSTTPAAPAPAPPTPSPKSSTSTMAPAPAP 197 >At2g23990.1 68415.m02865 plastocyanin-like domain-containing protein Length = 207 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 726 PPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PP P A P PP P + S P P P Sbjct: 146 PPKPSTTPAAPAPAPPTPSPKSSTSTMAPAPAP 178 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 762 PTPPPPXXRXSXLFXPPPP 818 PT PPP + S + PPPP Sbjct: 174 PTLPPPVYKKSPSYSPPPP 192 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 28.3 bits (60), Expect = 8.9 Identities = 20/78 (25%), Positives = 21/78 (26%) Frame = +2 Query: 290 KXPPPXXPGGGFXPGXXKXXXXXPPXRXXFXXXTXPPPXPHXPPPXSXXXKXXGXXXPXX 469 K PPP P P PP PPP + PPP P Sbjct: 128 KSPPPP-PYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYV 186 Query: 470 XXKKKKXXXGXXXPPPPP 523 PPPPP Sbjct: 187 YSSPPPPPYVYKSPPPPP 204 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPPPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGP 824 PPPPP S P PPPP ++ PPP P Sbjct: 160 PPPPPYVYS----PPPPPPY-----VYQSPPPPP 184 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 729 PPPXPXSXAXLPTPPPPXXRXSXLFXPPPPGPXGXP 836 PPP P P PPPP + PP G P Sbjct: 546 PPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAP 581 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,432,738 Number of Sequences: 28952 Number of extensions: 306578 Number of successful extensions: 8623 Number of sequences better than 10.0: 145 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5240 length of database: 12,070,560 effective HSP length: 82 effective length of database: 9,696,496 effective search space used: 2569571440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -