BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L07 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 64 2e-10 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 50 3e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 47 2e-05 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 43 4e-04 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 42 7e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 42 9e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.003 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 40 0.003 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 40 0.003 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 40 0.003 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 39 0.005 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 38 0.011 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.014 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.014 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 37 0.019 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 37 0.019 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 37 0.025 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 37 0.025 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.025 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 37 0.025 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 36 0.033 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 36 0.043 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.057 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 35 0.075 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 35 0.075 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 35 0.099 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 34 0.13 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.13 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.17 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 34 0.17 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 33 0.23 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 33 0.30 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 33 0.40 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.40 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.53 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 32 0.70 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 32 0.70 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 0.93 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 1.2 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 31 1.2 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.2 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.6 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.6 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 30 2.1 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 30 2.1 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 30 2.1 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 23 2.2 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 2.8 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 30 2.8 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 2.8 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 30 2.8 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 2.8 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 30 2.8 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 3.7 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 3.7 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 4.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 4.9 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 29 4.9 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 4.9 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 29 6.5 SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) 29 6.5 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 28 8.6 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 63.7 bits (148), Expect = 2e-10 Identities = 27/66 (40%), Positives = 27/66 (40%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP PPP P Q PPP PPP P PP P PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 848 PXPXXP 865 P P P Sbjct: 427 PPPPPP 432 Score = 58.4 bits (135), Expect = 7e-09 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP PP PPP P PPP PPP P PP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 836 PPXXP 850 PP P Sbjct: 428 PPPPP 432 Score = 58.0 bits (134), Expect = 9e-09 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP PPP P PPP PPP P PP PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 848 PXPXXP 865 P P P Sbjct: 426 PPPPPP 431 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP PP P P P PPP PPP P PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 836 PPXXPXP 856 PP P P Sbjct: 426 PPPPPPP 432 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P P P PPP PP PPP P PPP PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 794 XXXXXXXXPPXPXPPP 841 PP P PPP Sbjct: 425 --------PPPPPPPP 432 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP PPP P PPP PPP PP P PPP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPX 836 P PP P P PP P P PPP PPP P PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 837 RXXXPXP 857 P P Sbjct: 425 PPPPPPP 431 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +3 Query: 636 PXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXX 815 P P PP P P PP P P PPP PPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 816 XXPPPPXRXXXPXP 857 PPP R P Sbjct: 428 PPPPPALRLACAPP 441 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P P P PP PP PPP P PPP PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 794 XXXXXXXXPP 823 PP Sbjct: 432 PALRLACAPP 441 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP PP P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 853 XPPPP 867 PPPP Sbjct: 425 PPPPP 429 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 669 PPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPXRXXX 848 PP P P P P P PPP PPP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 849 PXPXXP 866 P P P Sbjct: 425 PPPPPP 430 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P P P P PPP PP P P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 853 XPPPP 867 PPPP Sbjct: 427 PPPPP 431 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +3 Query: 585 PPXXXXPXXXXXXXXXXPXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXX 764 PP P P P PP P P PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA------- 419 Query: 765 PPPXXPPPXPXXXXXXXXXPPPPXRXXXP 851 PPP PPP P PP R P Sbjct: 420 PPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +1 Query: 652 PXXXXXXPXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPX 831 P P P PP P P PPP PP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 832 PXAXXPXXPPPP 867 P P PPPP Sbjct: 425 P----PPPPPPP 432 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = +2 Query: 551 PQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPX 730 P P P P P P P P PPP PP PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP-------PPPPPPPPP 417 Query: 731 XXXXPXQXXKXPPPXXPPPXP 793 P PPP PPP P Sbjct: 418 PAPPP------PPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +3 Query: 585 PPXXXXPXXXXXXXXXXPXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXX 764 PP P P P P P P PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 765 PPPXXPPP 788 PPP PPP Sbjct: 425 PPPPPPPP 432 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/73 (24%), Positives = 19/73 (26%) Frame = +2 Query: 551 PQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPX 730 P P P P P P P P PPP PP PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 731 XXXXPXQXXKXPP 769 + PP Sbjct: 429 PPPPALRLACAPP 441 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/74 (24%), Positives = 18/74 (24%) Frame = +2 Query: 551 PQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPX 730 P P P P P P P P PPP P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 731 XXXXPXQXXKXPPP 772 P PP Sbjct: 428 PPPPPALRLACAPP 441 Score = 31.5 bits (68), Expect = 0.93 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +1 Query: 652 PXXXXXXPXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPX 831 P P P P P P PPP PP P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 832 PXAXXPXXPPP 864 P A PP Sbjct: 431 PPALRLACAPP 441 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 53.2 bits (122), Expect = 3e-07 Identities = 40/153 (26%), Positives = 41/153 (26%), Gaps = 1/153 (0%) Frame = +2 Query: 410 PXXPPPKIFFPXXGXXXXXPPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXXPX 589 P PPP +P PPPP P P P P P Sbjct: 92 PPYPPPP--YPPYPPPPPYPPPPNP-PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPY 148 Query: 590 XXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPP 769 P P P P PPP PP PP P PP Sbjct: 149 PPPPNPPYP--PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Query: 770 PXXP-PPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P P PP P PP P P P P P Sbjct: 207 PNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P + P P P PP PPP P PPP P P P Sbjct: 70 PDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPY--PPPPPYPPPPNPPYPPPPNAPYPPP 127 Query: 794 XXXXXXXXPPXPXPP-PXXPXPXXP 865 P P PP P P P P Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 37.1 bits (82), Expect = 0.019 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +1 Query: 592 PXPXPXXXXXXXXPHXXXXXPXXXXXXPXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPP 771 P P P P P P P PP P P PP Sbjct: 139 PYP-PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Query: 772 PXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP P P P P A P PPPP Sbjct: 198 ---PPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P P P P PPP PP P P P A P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Query: 853 XPPPP 867 PPPP Sbjct: 233 YPPPP 237 Score = 36.3 bits (80), Expect = 0.033 Identities = 23/92 (25%), Positives = 24/92 (26%) Frame = +1 Query: 592 PXPXPXXXXXXXXPHXXXXXPXXXXXXPXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPP 771 P P P P+ P P P P P P PP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP--NAPYPPPPNPPYPPPLYPPP 164 Query: 772 PXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 P PP P P P P P PP P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP 196 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPX 836 P P P P PP P P PPP P P P PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP----PNAPYPPSPN 145 Query: 837 RXXXPXPXXP 866 P P P Sbjct: 146 APYPPPPNPP 155 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 703 PPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP P P PPP PP P P P P A P P PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPP---YPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/93 (23%), Positives = 23/93 (24%), Gaps = 1/93 (1%) Frame = +1 Query: 592 PXPXPXXXXXXXXPHXXXXXPXXXXXXPXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXP- 768 P P P P+ P P P P P P P Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 769 PPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP P P P P P PPPP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P PPPP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXP-PXXXXXPXXXXPXXPXPXAXXP 849 P P PP P P PPP P P P P P P + Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYP---PPPNAPYPPPPNPPYPPPPNAPYPPSPNA 146 Query: 850 XXPPPP 867 PPPP Sbjct: 147 PYPPPP 152 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/76 (27%), Positives = 21/76 (27%), Gaps = 6/76 (7%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXX----PPPXXP--PPXPXXXXXXXX 818 P PP P P PP P P PPP PP P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 819 XPPPPXRXXXPXPXXP 866 PP P P P P Sbjct: 153 NPPYPPPLYPPPPNPP 168 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 49.6 bits (113), Expect = 3e-06 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 1/106 (0%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXG-GGXXXXXXGXXXXXGGGXXXGGXXXXX 688 G G G GGG G GG G GGG G GG G GGG GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGY 830 Query: 687 XXGGGXGXXXGXXXXXXVXXXGXXGXXXXXXXXXGXXXXGXXGXXG 550 GGG G G G G G G G G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXX 661 GGG G GG G GGG GGG G G G GG GGG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 660 XG 655 G Sbjct: 830 YG 831 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGG--XXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G GGG G G G GGG GGG G GGG GG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 675 GXGXXXG 655 G G G Sbjct: 829 GYGDGGG 835 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -2 Query: 865 GXXGXGXXXRXGGGGXXXXXXXXXGXGGGXXGGGXFXXLXXXXXXGXGXXXXGGXXXXXG 686 G G G GGGG G GGG GGG G G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 685 XXGXGG 668 G GG Sbjct: 829 GYGDGG 834 Score = 36.7 bits (81), Expect = 0.025 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXX 661 GGG G G G GGG GGG G G G GG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDG-GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 660 XGXXXXXXVXXXGXXGXXXXXXXXXGXXXXGXXGXXG 550 G G G G G G Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP PPP P PPP PP P PP P PP Sbjct: 204 PPPPPPR-----PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Query: 848 PXP 856 P P Sbjct: 259 PPP 261 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 P P PPP PPP P PP P PPP P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPP-PPPPPSPPRP 240 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 743 PXQXXKXPPP-XXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P Q + PPP PPP P P P PPP P P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP-PPPPSPP 238 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 764 PPPXXPP-PXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PP P P PP P PPP P P P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRP-PPPPPPSPPRP 240 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 722 PPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXP 850 P P + PP PPP P PP P P P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P P PP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP P P P P P P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 703 PPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPP 864 PP P P PPP PP P P P PPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXP-PPXXPPPXPXXXXXXXXPPXPX 832 P P P PP PPP P + P PP PP PP Sbjct: 160 PIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 219 Query: 833 PPPXXPXPXXP 865 PPP P P P Sbjct: 220 PPPIFPQPTTP 230 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/60 (28%), Positives = 17/60 (28%), Gaps = 1/60 (1%) Frame = +3 Query: 657 PXXXPPX-PXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPP 833 P PP P P PP P PP PPP P PP P Sbjct: 152 PMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP P P PP PPP P PP P PP P P Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPP-PIPPIDPPRTQPP 208 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/76 (25%), Positives = 20/76 (26%), Gaps = 2/76 (2%) Frame = +3 Query: 636 PXXXXXXPXXXPPX--PXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXX 809 P P PP P P PP P PP PPP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Query: 810 XXXXPPPPXRXXXPXP 857 PP + P P Sbjct: 217 RTQPPPIFPQPTTPAP 232 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GGG GG Sbjct: 252 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Query: 684 XGGGXGXXXGXXXXXXVXXXGXXG 613 GGG G V G G Sbjct: 312 VGGGATGGGGGATGGGVGATGGGG 335 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GGG GG Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATG 353 Query: 684 XGGGXG 667 GGG G Sbjct: 354 GGGGPG 359 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GGG GG Sbjct: 245 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 304 Query: 684 XGGG 673 GGG Sbjct: 305 GGGG 308 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GGG GG Sbjct: 273 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATG 332 Query: 684 XGGG 673 GGG Sbjct: 333 GGGG 336 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GGG GG Sbjct: 287 GATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTG 346 Query: 684 XGGG 673 GGG Sbjct: 347 GGGG 350 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GG GGG G GGG GG GG Sbjct: 243 GGGATGGGGGATGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 675 GXGXXXG 655 G G Sbjct: 302 ATGGGGG 308 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GG GGG G GGG GG GG Sbjct: 250 GGGATGGGGGATGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Query: 675 GXGXXXG 655 G G Sbjct: 309 ATGVGGG 315 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GG GGG G GGG GG GG Sbjct: 278 GGGATGGGGGATGGGGGATGGG-GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGG 336 Query: 675 GXGXXXG 655 G G Sbjct: 337 ATGGGGG 343 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G G G G G GGG GGG G GGG G Sbjct: 308 GATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSG 361 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG G G G GG GG Sbjct: 280 GATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATG 339 Query: 684 XGGG 673 GGG Sbjct: 340 GGGG 343 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G G G GGG G GGG GG Sbjct: 301 GATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGS 360 Query: 684 XGGG 673 G G Sbjct: 361 GGCG 364 Score = 32.7 bits (71), Expect = 0.40 Identities = 26/109 (23%), Positives = 26/109 (23%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXGXXXXXXVXXXGXXG 613 G GG GGG G GGG GG GG G G G G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Query: 612 XXXXXXXXXGXXXXGXXGXXGXXXXXXXXXXXXGXXKXXFXSQXKGGGG 466 G G G G GGGG Sbjct: 302 ATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G G GGG GGG G GG G Sbjct: 315 GATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSLE 374 Query: 684 XGGG 673 G G Sbjct: 375 FGSG 378 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G GG GGG GG G GGG GG GG Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGG 1829 Query: 675 GXG 667 G G Sbjct: 1830 GMG 1832 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG--XXXXXXGXXXXXGGGXXXGGXXXX 691 G G G GGG G GG G GGG GGG G GGG GG Sbjct: 1756 GGFGGGGGGGGMGGGG-----GMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGM 1810 Query: 690 XXXGGGXG 667 GGG G Sbjct: 1811 GGGGGGMG 1818 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G GG G GGG GGG G GG G GG Sbjct: 1788 GGGEFGGGEGMGGGGMA----GGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Query: 675 GXG 667 G G Sbjct: 1844 GGG 1846 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 G G G GGG G GG G G G GGG G GGG Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 36.7 bits (81), Expect = 0.025 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = -3 Query: 864 GXXGXGXXGGGXG--XGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXX 691 G G G GGG G GG GGG GGG G GGG GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG--EGMGGGGMAGGGGGMGGGGGGM 1817 Query: 690 XXXGGGXGXXXG 655 G G G G Sbjct: 1818 GGGGEGMGAAGG 1829 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G GGG GG G GGG G GG Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Query: 675 GXGXXXG 655 G G Sbjct: 1836 EGGGAGG 1842 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXGXXXXXXVXXXGXXG 613 G GGG GG G GGG GG G G G G G G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Query: 612 XXXXXXXXXGXXXXGXXG 559 G G G Sbjct: 1820 GGEGMGAAGGGMGAGGEG 1837 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = -1 Query: 866 GGGGXXGXXAXGXGXXGXXXXGXXXXXGGXXGGGXXXXXXXXXXXXXGXGXXXGGXXXXX 687 GGGG G G G GG GGG G G GG Sbjct: 1781 GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGA 1840 Query: 686 XXGXG 672 G G Sbjct: 1841 GGGGG 1845 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G G G GGG G GG G GGG GGG G GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 37.5 bits (83), Expect = 0.014 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGX 670 G GGG G GG G GGG GGG G GGG G GGG Sbjct: 62 GGGGGGGGGGG--------GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGV 113 Query: 669 G 667 G Sbjct: 114 G 114 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GGG GGG G GGG GG GGG G G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GGG GGG G GGG GG GGG G G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GGG GGG G GG GG GGG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.5 bits (93), Expect = 9e-04 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G GGG G GG G GG GG G GGG GG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRS 224 Query: 684 XGGG 673 GGG Sbjct: 225 GGGG 228 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GG GG G GGG G G G GGG GG GG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Query: 675 GXGXXXG 655 G G G Sbjct: 195 GYGGGGG 201 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGG-GXXGGGXXXXXXGXXXXXGGGXXXGGXXXXX 688 G G G GG G GG G GG GGG G GGG GG Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGG 185 Query: 687 XXGGGXG 667 GGG G Sbjct: 186 HGGGGYG 192 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG GG GGG GGG G GGG GG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYG 204 Query: 675 GXGXXXG 655 G G G Sbjct: 205 GSGYGGG 211 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GGG G GG GGG GGG G GGG GG Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRG---RGGGGYGGGGYGGGGY 181 Query: 684 XGGGXG 667 GGG G Sbjct: 182 GGGGHG 187 Score = 37.9 bits (84), Expect = 0.011 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G GGG G GG G GGG GGG G GGG GG Sbjct: 160 GYRGRGRGGGGYGGGGYGGG----GYGGGGHGGG----GYGGGGYGGGGGGYGGSGYGGG 211 Query: 684 XGGGXGXXXG 655 G G G G Sbjct: 212 GGYGGGGYGG 221 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GGG GG G G GGG G GGG GG Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGY 196 Query: 684 XGGGXG 667 GGG G Sbjct: 197 GGGGGG 202 Score = 35.9 bits (79), Expect = 0.043 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GGG GGG GGG GG G Sbjct: 151 GGGYRGGGGGYRGRGRGGG--GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGY 208 Query: 675 GXGXXXG 655 G G G Sbjct: 209 GGGGGYG 215 Score = 31.9 bits (69), Expect = 0.70 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = -2 Query: 865 GXXGXGXXXRXGGGGXXXXXXXXXGXGGGXXGGGXFXXLXXXXXXGXGXXXXGGXXXXXG 686 G G R GGGG G GGG GGG + G G GG G Sbjct: 146 GGYRGGGGYRGGGGGYRGR-----GRGGGGYGGGGYGG-GGYGGGGHGGGGYGGGGYGGG 199 Query: 685 XXGXGGXXXG 656 G GG G Sbjct: 200 GGGYGGSGYG 209 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = -1 Query: 866 GGGGXXGXXAXGXGXXGXXXXGXXXXXGGXXGGGXXXXXXXXXXXXXGXGXXXGG 702 GGGG G G G G G GG GGG G GG Sbjct: 157 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 837 GGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXG 667 GG G G G GG GGG G GGG G GGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGG--YRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = -2 Query: 832 GGGGXXXXXXXXXGXGGGXXGGGXFXXLXXXXXXGXGXXXXGGXXXXXGXXGXGGXXXG 656 GGG G GGG GG + G G G G G GG G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPP---PXPXXXXXXXXPPXPXPP 838 P PPP PP PP P PPP PP P P PP P P Sbjct: 346 PPPPPTNN----PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPT 401 Query: 839 PXXPXPXXP 865 P P P Sbjct: 402 NGPPPPPPP 410 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PP PP PPP P PP PPP P PP P Sbjct: 350 PTNNPPSPPPPTNNTPPP---PPPTNKPPPPPPPTNGPP--PPPPPTNGPPPPPPPTNGP 404 Query: 836 PPXXPXPXXP 865 PP P P Sbjct: 405 PPPPPPTNGP 414 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP P P PPP P P PP P P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Query: 848 P 850 P Sbjct: 415 P 415 Score = 35.1 bits (77), Expect = 0.075 Identities = 22/75 (29%), Positives = 22/75 (29%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P P PPP PP PPP P PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPP---PPPTNGPPPPPPPTNGPP--PPPPP 400 Query: 794 XXXXXXXXPPXPXPP 838 PP PP Sbjct: 401 TNGPPPPPPPTNGPP 415 Score = 31.5 bits (68), Expect = 0.93 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = +1 Query: 706 PXXXPXPXXXXXXXXXXXXXPPPXXPP---XXXXXPXXXXPXXPXPXAXXPXXPPPP 867 P P P PPP PP P P P P P PPPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP P P P P P P PPPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPP-TNKPPPPPPP 380 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PPP PPP P PP P PPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PPP P PP P PPP P P P Sbjct: 464 PPPPPPPPPP---PPPPPPPPPPPPPPFPPPPPP 494 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 PP PPP P PPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 PP PPP P PPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P PPP PP PPP P PPP PPP P Sbjct: 464 PPPPP-------PPPPPPPPPPPPPPPPPPPFPPP--PPPTP 496 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 769 PPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP PP P P P P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 PPP PPP PPP P PP P PPP Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP-- 841 P PPP PPP P P PPP P PP P P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 842 -XXPXPXXP 865 P P P Sbjct: 737 AGLPPPPPP 745 Score = 36.3 bits (80), Expect = 0.033 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 7/86 (8%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXX--PPXXXPPPXXXXXPXQXXKXPP-----P 772 P P P P PPP PP PPP P P P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLP 740 Query: 773 XXPPPXPXXXXXXXXPPXPXPPPXXP 850 PPP P PP P P P Sbjct: 741 PPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 35.9 bits (79), Expect = 0.043 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 3/73 (4%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP P PPP P PPP P P PP P P Sbjct: 694 PPPPPPPPPPLLSGTLP---MPPPPPPPPPGCAGLPPPP----PSPQPGCAGLPPPPPPP 746 Query: 836 PP---XXPXPXXP 865 PP P P P Sbjct: 747 PPGCAGLPPPPPP 759 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/70 (25%), Positives = 18/70 (25%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPX 836 P PP P P P P PPP PPP P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 837 RXXXPXPXXP 866 P P P Sbjct: 737 AGLPPPPPPP 746 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 706 PXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 P P P PPP PP P P P PPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +1 Query: 703 PPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP P P PPP P P P P PPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 758 KXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 K PPP P P PP P PPP Sbjct: 675 KVPPPPPPLPVIEGSSLSVPPPPPPPPP 702 Score = 27.1 bits (57), Expect(2) = 1.9 Identities = 20/78 (25%), Positives = 20/78 (25%) Frame = +2 Query: 560 PXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXX 739 P P P P P P P P P PP PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP-GCAGLPPPPPPPPPGCAG 752 Query: 740 XPXQXXKXPPPXXPPPXP 793 P PPP P P Sbjct: 753 LP----PPPPPIDVPMKP 766 Score = 21.8 bits (44), Expect(2) = 1.9 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = +2 Query: 404 KXPXXPPPKIFFPXXGXXXXXPPPP 478 K P PPP PPPP Sbjct: 675 KVPPPPPPLPVIEGSSLSVPPPPPP 699 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G GGG G G G GG GGG G GGG GG Sbjct: 55 GATGGGATGGGGGATGGGGGATG-GHGGATGGGGGATGDGGGATGGGGGATGGGGGATGG 113 Query: 684 XGGGXGXXXG 655 GG G G Sbjct: 114 HGGATGGGVG 123 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GG G GG G GGG GGG GGG G GGG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG 102 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGG-GXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GG G G G GGG GG G G GGG GG GG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 672 XGXXXG 655 G G Sbjct: 111 TGGHGG 116 Score = 33.5 bits (73), Expect = 0.23 Identities = 30/126 (23%), Positives = 30/126 (23%), Gaps = 1/126 (0%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXG-GGXXXGGXXXXXXXGGGXGX 664 GG G G GGG GGG G G GG GG GG G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 663 XXGXXXXXXVXXXGXXGXXXXXXXXXGXXXXGXXGXXGXXXXXXXXXXXXGXXKXXFXSQ 484 G G G G G G G Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 483 XKGGGG 466 GGGG Sbjct: 160 TGGGGG 165 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GG G G GG G G G GGG GG GG Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Query: 675 GXG 667 G Sbjct: 166 ATG 168 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXG-GGXXXXXXGXXXXXGG-GXXXGGXXXX 691 G G GG G GG GGG GG G GG G GG Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGA 152 Query: 690 XXXGGG 673 GGG Sbjct: 153 TGGGGG 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G G G G GG GGG G GGG GG Sbjct: 116 GATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP P PPP P PPP P P P PP P Sbjct: 1051 PSAVPIPPP-RKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP-PRQ 1108 Query: 836 PPXXPXP 856 P P P Sbjct: 1109 PKPTPAP 1115 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXP-PPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPX 832 P P PPP PP P PP P PPP PPP P P P Sbjct: 1036 PSAQPLPPP--RKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP-PSTSQPVPPPRQPD 1092 Query: 833 PPPXXP 850 P P P Sbjct: 1093 PIPTNP 1098 Score = 35.5 bits (78), Expect = 0.057 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPP--XXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXP 829 P P PP PP PPP P PPP P P P PP Sbjct: 1022 PTEQPVPP---KRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP---SEPAPPPRQ 1075 Query: 830 XPPPXXPXPXXP 865 PPP P P Sbjct: 1076 PPPPSTSQPVPP 1087 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP PP P P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 853 XP--PPP 867 P PPP Sbjct: 1100 HPTEPPP 1106 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P P PP P PP P PPP P P Sbjct: 999 PAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVP-IP 1057 Query: 794 XXXXXXXXPPXPXPPPXXPXP 856 P P PPP P P Sbjct: 1058 PPRKPSPPPSEPAPPPRQPPP 1078 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/71 (26%), Positives = 19/71 (26%), Gaps = 1/71 (1%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPP-XXPPPXPXXXXXXXXPPXPX 832 P PP P PPP P PPP PP P P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Query: 833 PPPXXPXPXXP 865 P P P P Sbjct: 1088 PRQPDPIPTNP 1098 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 5/86 (5%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPX-PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPX 790 P P P P PPP PP P P P + PPP P P Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDP-IPTNPAHPTE-PPPRQPKPT 1112 Query: 791 PXXXXXXXXPPXP----XPPPXXPXP 856 P P PPP P P Sbjct: 1113 PAPRPRSWVESQPELHRPPPPIKPKP 1138 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G GGG G GG G GGG GGG G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G GG G GGG GGG G GGG GG G Sbjct: 657 GDGGDGGGGGGGGG-------GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Query: 675 GXGXXXG 655 G G Sbjct: 710 GDDDGDG 716 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 G G G GGG G GG G GGG GGG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPX 853 PPP P PPP PP PPP P P P PPP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPL--------PAPPPPPAQPA 102 Query: 854 PXXP 865 P P Sbjct: 103 PQPP 106 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXP--PXPXPPP 841 P PPP P PP P PP PPP P P P P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAA--PPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Query: 842 XXP 850 P Sbjct: 108 APP 110 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PP PP P PPP P P P PP P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP-PAP 109 Query: 836 PPXXP 850 P P Sbjct: 110 PHFLP 114 Score = 31.5 bits (68), Expect = 0.93 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 766 PPPXXPPXXXXX---PXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P A P PPPP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/77 (25%), Positives = 21/77 (27%) Frame = +3 Query: 636 PXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXX 815 P P PP P PP P PPP PP P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAP----------PPPAAPPAAPPPPPPLP 92 Query: 816 XXPPPPXRXXXPXPXXP 866 PPPP + P P Sbjct: 93 APPPPPAQPAPQPPPAP 109 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P P P PP PP PPP P P P PP P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAA---PPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 781 PPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PP P P P P A P PPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPP 78 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP P P P P P PPPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P PP P Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP P PP PP P PP P PPP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Query: 848 P 850 P Sbjct: 993 P 993 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP P PPP PP PP P PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGS 980 Query: 848 PXPXXP 865 P P Sbjct: 981 APPPPP 986 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P PPP PP PP PPP PPP P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 35.1 bits (77), Expect = 0.075 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 4/70 (5%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPP----XPXP 835 P PPP P PPP P PPP P P PP P P Sbjct: 931 PLPPPPPGGSA--PSQPPPPGGNAPPPP----PPPGGSAPPPGGGAPPLPPPPGGSAPPP 984 Query: 836 PPXXPXPXXP 865 PP P P P Sbjct: 985 PPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 766 PPPXXPPXXXXXP--XXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P P PPPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +3 Query: 636 PXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXX 815 P P PP P P P PPP P P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP--GGGAP 971 Query: 816 XXPPPPXRXXXPXPXXP 866 PPPP P P P Sbjct: 972 PLPPPPGGSAPPPPPPP 988 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXG-GGXXXGGXXXXXXXG 679 G G GGG GG G GGG GGG G G GG GG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Query: 678 GGXG 667 G G Sbjct: 240 GSKG 243 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GGG GG G GG G G G GGG GG GGG Sbjct: 176 GDSGGGGSQGG-GYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 G G G GGG G GG G GGG GGG G GGG Sbjct: 200 GGYGGGSGGGGYG-GGRGGGGYGGGHGGGGYGGGGRHDYGG--GSKGGG 245 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G G GG G GGG GGG G GG GG Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -3 Query: 786 GGGXXGGGXXXXXXGXXXXXG--GGXXXGGXXXXXXXGGGXGXXXG 655 GGG GGG G G GG GG GGG G G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = -2 Query: 865 GXXGXGXXXRXGGGGXXXXXXXXXGXGGGXXGGGXFXXLXXXXXXGXGXXXXGGXXXXXG 686 G G R GGGG G GG GG G G GG G Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Query: 685 XXGXGG 668 GG Sbjct: 240 GSKGGG 245 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 3/87 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGG---GXXGGGXXXXXXGXXXXXGGGXXXGGXXX 694 G G G GGG G GG G G G GG G GGG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 693 XXXXGGGXGXXXGXXXXXXVXXXGXXG 613 G G G G V G G Sbjct: 88 AGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 38.3 bits (85), Expect = 0.008 Identities = 36/159 (22%), Positives = 42/159 (26%), Gaps = 5/159 (3%) Frame = +2 Query: 404 KXPXXPPPKIFFPXXGXXXXXPPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXX 583 + P P P++ P G PPP + P+ P P Sbjct: 422 RPPGAPHPRV--PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP-PGAPH 478 Query: 584 PXXXXXXXXXPXXPXXXTXXXXXXPXXXPXP---PPXXXXXXXPPXXXPPPXXXXXPXQX 754 P P P P P P PP PP P P Sbjct: 479 PRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 538 Query: 755 XKXPPPXXPPPX--PXXXXXXXXPPXPXPPPXXPXPXXP 865 + PPP P P P PP P P P P P Sbjct: 539 PRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 34.3 bits (75), Expect = 0.13 Identities = 27/108 (25%), Positives = 29/108 (26%), Gaps = 3/108 (2%) Frame = +2 Query: 551 PQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXP---PPXXXXXXXPPXXXP 721 P+ P P P P P P P P PP PP P Sbjct: 389 PRVPS-PGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAP 447 Query: 722 PPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P + PPP P P P PPP P P P Sbjct: 448 HPRVPPPGAPHPRVPPPGAPHPR---VPPPGAPHPRVPPPGAPHPRVP 492 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGAPHPRVPPPGAPHPR 490 Query: 853 XPPP 864 PPP Sbjct: 491 VPPP 494 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHQRVPPPGAPHPRVPPPGAPHPR 520 Query: 853 XPPP 864 PPP Sbjct: 521 VPPP 524 Score = 33.9 bits (74), Expect = 0.17 Identities = 35/155 (22%), Positives = 40/155 (25%), Gaps = 3/155 (1%) Frame = +2 Query: 410 PXXPPPKIFFPXXGXXXXXPPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXXPX 589 P P P++ P G PPP + P+ P P P Sbjct: 464 PGAPHPRV--PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPP-PGAPHPR 520 Query: 590 XXXXXXXXPXXPXXXTXXXXXXPXXXPXP---PPXXXXXXXPPXXXPPPXXXXXPXQXXK 760 P P P P P PP PP P P + Sbjct: 521 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPR 580 Query: 761 XPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP P P PP P P P P P Sbjct: 581 VPPPGTPHPR--------VPPPGAPHPKVPPPGAP 607 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRV-PPPGAPHPRVPPPGAPHPRVPPPGAPHPR 530 Query: 853 XPPP 864 PPP Sbjct: 531 VPPP 534 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGAPHPRVPPPGAPHPR 550 Query: 853 XPPP 864 PPP Sbjct: 551 VPPP 554 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGAPHPRVPPPGASHPR 560 Query: 853 XPPP 864 PPP Sbjct: 561 VPPP 564 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P A P Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRV-PPPGAPHPRVPPPGASHPRVPPPGAPHPR 570 Query: 853 XPPP 864 PPP Sbjct: 571 VPPP 574 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRV-PPPGAPHPRVPPPGAPHPRVPPPGTPHPR 590 Query: 853 XPPP 864 PPP Sbjct: 591 VPPP 594 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPP 864 PPP P P P P P A P PPP Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PP P P P P P A P Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPP-GAPHPRVPPPGAPHPRFPPPGAPHPR 450 Query: 853 XPPP 864 PPP Sbjct: 451 VPPP 454 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPP--XPXXXXXXXXPPXPXPPPXX 847 PPP PP P P + PPP P P P P P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRL 621 Query: 848 PXPXXP 865 P P P Sbjct: 622 PPPGPP 627 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPP 838 P PPP P PPP P PPP PPP P PP P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPP------PPPPPPPPPP---GDGGAPPPPPPP 337 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 707 PXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PPP P PP PPP P PP P PP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPP--------PPPPPPPGDGGAPPPP 334 Score = 32.3 bits (70), Expect = 0.53 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P PPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPP 787 P P PPP PP PPP P PPP PPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAP------PPP--PPP 337 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +3 Query: 687 PXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPP 830 P P P P PPP PPP P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 P P PP P P P P PPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 723 PXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPXRXXXPXPXXP 866 P P PPP PPP PPPP P P P Sbjct: 290 PVPPPPPADGSAPAPPP-PPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 P P PP P P P P PPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.5 bits (83), Expect = 0.014 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXP 850 PPP PPP P PP P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PP PPP P PP P PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 PP PPP PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.5 bits (83), Expect = 0.014 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPP----PXPXXXXXXXXPPXPX- 832 P PPP P PPP P PPP P P P PP P Sbjct: 138 PPPPPPIA----PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSG 193 Query: 833 -PPPXXPXPXXP 865 PPP P P P Sbjct: 194 GPPPPPPPPPPP 205 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 P PPP PP PPP P PP P PP P PPP Sbjct: 152 PPPPPIAPATGGPPP--PPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 35.5 bits (78), Expect = 0.057 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 6/72 (8%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXX------PPPXPXXXXXXXXPPXP 829 P PPP P PP P PPP PPP P P P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP--P 165 Query: 830 XPPPXXPXPXXP 865 PPP P P Sbjct: 166 PPPPIAPAATVP 177 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXP 829 P PPP P P P PPP PPP P P P Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P PPP P P P PPP PPP P P P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.9 bits (64), Expect = 2.8 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 14/84 (16%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXX-------PPPXPXXXXXXX 814 P P PPP P PPP P PPP PPP P Sbjct: 120 PSQAPSPPPPPTS---PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATV 176 Query: 815 XPP-------XPXPPPXXPXPXXP 865 P P PP P P P Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPP 200 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPX-PPPX 844 P P P P PPP P Q PPP P P PPP Sbjct: 96 PTPTPMVAQSVAPTPP-PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 Query: 845 XP 850 P Sbjct: 155 PP 156 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 37.1 bits (82), Expect = 0.019 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXG-GGXXXXXXGXXXXXGGGXXXGGXXXXX 688 G G G G G G GG G GGG G GG G GGG G Sbjct: 131 GWRGRGG-GEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGS 189 Query: 687 XXGGGXGXXXG 655 GGG G G Sbjct: 190 RGGGGDGRGRG 200 Score = 31.5 bits (68), Expect = 0.93 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GGG G GG G GG G G G GGG GG Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWG--GRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGR 199 Query: 684 XGGG 673 GG Sbjct: 200 GRGG 203 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPX 853 PPP PP P P PPP P PP P PP P Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Query: 854 PXXP 865 P P Sbjct: 376 PPPP 379 Score = 35.5 bits (78), Expect = 0.057 Identities = 25/105 (23%), Positives = 26/105 (24%) Frame = +2 Query: 551 PQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPX 730 P P P P P + P PPP P PP Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP- 364 Query: 731 XXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PPP PP PP P PP P P Sbjct: 365 --PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +3 Query: 669 PPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPXRXXX 848 PP P PP P P P P P PPPP R Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 849 PXP 857 P P Sbjct: 347 PPP 349 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/68 (26%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +1 Query: 673 PXPXXXXXXXPPXXX---PXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAX 843 P P PP P P PPP PP P P P + Sbjct: 329 PPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSS 388 Query: 844 XPXXPPPP 867 PPPP Sbjct: 389 LGNPPPPP 396 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 37.1 bits (82), Expect = 0.019 Identities = 31/137 (22%), Positives = 33/137 (24%) Frame = +2 Query: 440 PXXGXXXXXPPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXXPXXXXXXXXXPX 619 P G P PP E + + PQ P P P Sbjct: 394 PVPGLPGALPAPPAEKEDQGDYFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQ 453 Query: 620 XPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXX 799 P P PP PP PPP P PPP PP P Sbjct: 454 LPPNLPPP----PGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQ 509 Query: 800 XXXXXXPPXPXPPPXXP 850 PP P P Sbjct: 510 RMPSQGPPQVHYPSQDP 526 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 4/58 (6%) Frame = +2 Query: 704 PPXXXPPPXXXXX--PXQXXKXPPPXX--PPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP PPP P PPP PPP PP P P P P Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMP 512 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 37.1 bits (82), Expect = 0.019 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGX--GGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXX 691 G G G GGG GG G GGG GGG GGG GG Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Query: 690 XXXGGG 673 GGG Sbjct: 393 GDHGGG 398 Score = 34.3 bits (75), Expect = 0.13 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGX--GGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXX 691 G G G GGG GG G GGG GGG GGG GG Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Query: 690 XXXGGG 673 G G Sbjct: 398 GDYGDG 403 Score = 32.7 bits (71), Expect = 0.40 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G GGG GG GGG GGG GGG GG Sbjct: 328 GDHGDGDHGGGDPGGGDP--------GGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGD 379 Query: 684 XGGG 673 GGG Sbjct: 380 HGGG 383 Score = 31.5 bits (68), Expect = 0.93 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGX--GGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXX 691 G G G GGG GG G GGG G G GGG GG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGD 402 Query: 690 XXXGGG 673 G G Sbjct: 403 GDHGDG 408 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GG GGG G GGG GG GG Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGG-CDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 675 GXG 667 G Sbjct: 108 DGG 110 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G GGG GGG G GGG GG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG---GGDGGGGG 107 Query: 684 XGGGXGXXXG 655 GGG G Sbjct: 108 DGGGGNDDDG 117 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGG-GXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GGG G G G G GG G G GGG G GGG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Query: 672 XG 667 G Sbjct: 108 DG 109 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGG--GXXXXXXGXXXXXGGGXXXGG 703 G G G GG G GG G GGG GG G G GGG GG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -3 Query: 855 GXGXXGGG-XGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G GGG GG G GGG GGG G GG GG Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GGG G G G GG GGG G GGG GG GG Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGG-CDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 675 GXG 667 G Sbjct: 123 DGG 125 Score = 33.5 bits (73), Expect = 0.23 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G G G G GGG GGG G GGG GG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG---GGDGGGGG 122 Query: 684 XGGGXGXXXG 655 GGG G Sbjct: 123 DGGGGNDDDG 132 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGG-GXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GGG G G G G GG G G GGG G GGG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Query: 672 XG 667 G Sbjct: 123 DG 124 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXP--PXP 829 P P PP PP PP P PP P P P P P P Sbjct: 2588 PIVAPMQPPFFGPQLPPPDMFPPQMM---PPMVPMMLPPMLPLPPPGLPMQPEAPVQPPP 2644 Query: 830 XPPPXXPXP 856 PPP P P Sbjct: 2645 LPPPGGPFP 2653 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPP--XPXXXXXXXXPPXPXPPP 841 P P P P P P + PPP PP P P P PPP Sbjct: 2571 PPPQPQMNAAMSPDRRWPIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPP 2630 Query: 842 XXP 850 P Sbjct: 2631 GLP 2633 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G GGG G GG G GGG GGG G GGG GG Sbjct: 104 GGSSRGGYGGGRGGGGYGG-----GRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG G GG G GGG GGG G GGG G Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG--RGGGGYGGGRGGGYGGGRRDYGGG 147 Query: 684 XGGG 673 GG Sbjct: 148 SKGG 151 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G GG GG G GGG GGG G G G GG G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGS 148 Query: 675 GXG 667 G Sbjct: 149 KGG 151 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 35.9 bits (79), Expect = 0.043 Identities = 25/102 (24%), Positives = 25/102 (24%) Frame = +2 Query: 560 PXXPXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXX 739 P P P P P P P P P P P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLF 304 Query: 740 XPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PP PP P PP P PP P P P Sbjct: 305 IP----SAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP 342 Score = 31.5 bits (68), Expect = 0.93 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 1/85 (1%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXP-PXXXPPPXXXXXPXQXXKXPPPXXPPPX 790 P P P P PP P P P P P PP PP Sbjct: 280 PAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTA----PPNPSIPPA 335 Query: 791 PXXXXXXXXPPXPXPPPXXPXPXXP 865 P PP P PP P P Sbjct: 336 PPNPSIPPAPPNPSIPPAPPNLFIP 360 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 7/73 (9%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXP-----PPXPXXXXXXXXPPXPX 832 P PP PP P P P P P P PP P PP P Sbjct: 191 PPAPPSPPIPTAPPTP-PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPE 249 Query: 833 P--PPXXPXPXXP 865 PP P P P Sbjct: 250 TPLPPATPNPFIP 262 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PP PP PP PP P P PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTA-----PPTPPMPETPLPPGSPHIPPAPLH 226 Query: 836 PPXXPXPXXP 865 P P P P Sbjct: 227 PHIPPAPPNP 236 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +2 Query: 677 PPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PP P PP PP PP P P P PP P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Query: 857 XXP 865 P Sbjct: 222 PAP 224 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 1/85 (1%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXP-PPX 790 P P P P PP PP P P P P P PP Sbjct: 200 PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATP----NPPMPETPLPPA 255 Query: 791 PXXXXXXXXPPXPXPPPXXPXPXXP 865 P P PP P P P Sbjct: 256 TPNPFIPPASPNPSIPPAPPNPSIP 280 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPX 853 P P PP P P PP P P PP P PP P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 854 PXXP 865 P Sbjct: 303 LFIP 306 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG G GG G GGG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG G GG G GGG GGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG G GG G GGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXG 724 G GGG G GG G GGG GGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXG 667 G GGG GGG G GGG GG GGG G Sbjct: 132 GGGGGGGGGG-----GGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 GGG G GG G GGG GGG G GGG Sbjct: 132 GGGGGGGGGG------GGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 P P P P PPP PPP P PP P PP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.1 bits (77), Expect = 0.075 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 743 PXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P Q PPP PPP P PP P P P P P P Sbjct: 677 PIQTMVPPPPPPPPPPP------PPPPPPPPQPSTPPPPPP 711 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PPP PPP P P P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P PP PPP P Q PPP PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP--PPSTP 714 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPP 784 P PPP PP PPP P PPP PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTP----PPPPPSTPP 715 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG GG G GG GG G GG GG Sbjct: 539 GGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNT---GGNNNGGNTGGNN 595 Query: 684 XGGGXGXXXG 655 GG G G Sbjct: 596 NGGNTGGNNG 605 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP P PPP PPP P PP P P P Sbjct: 683 PPPPPPPPP------PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/65 (24%), Positives = 17/65 (26%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP PP PP + P P P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Query: 836 PPXXP 850 P P Sbjct: 744 PGQLP 748 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 785 PXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P P PP P PPP P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPP 701 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.5 bits (78), Expect = 0.057 Identities = 27/104 (25%), Positives = 27/104 (25%), Gaps = 5/104 (4%) Frame = +2 Query: 569 PXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXP---PPXXXXXXXPPXXXPPPXXXX 739 P P P P T P P P PP PP P P Sbjct: 15 PNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPP 74 Query: 740 XPXQXXKXPPPXXPPPX--PXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP P P P PP P P P P P Sbjct: 75 PNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP P P P P P P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGD-PPPNTPIPGNPPPNTPIPGDPPPNTPIPG 111 Query: 853 XPPP 864 PPP Sbjct: 112 DPPP 115 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPX 836 P PP P PP P P PP P P PPPP Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGP-PSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPS 324 Query: 837 RXXXPXPXXP 866 R P P P Sbjct: 325 RDQVPLPPPP 334 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 PP PP P + PPP PP P PP PP Sbjct: 244 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPP 838 PPP PPP P Q PPP PPP PP P PP Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAP-QPLGGPPP--PPPGRRPPSGKINPPPPPPP 393 Score = 31.9 bits (69), Expect = 0.70 Identities = 32/138 (23%), Positives = 32/138 (23%), Gaps = 5/138 (3%) Frame = +2 Query: 467 PPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXX 646 PPPP P K P P P P P Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 309 Query: 647 XXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXP-- 820 P PPP P PPP Q PPP PP P Sbjct: 310 PPPPLNATPPPPPPSRDQVP---LPPPPLRG---QIAPPPPPISKPPTSTRSAPPPPPGR 363 Query: 821 ---PXPXPPPXXPXPXXP 865 P PPP P P Sbjct: 364 APQPLGGPPPPPPGRRPP 381 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 5/56 (8%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPP-----XPXPPPXXPXP 856 PP PPP P PPP P PP P PPP P Sbjct: 169 PPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/77 (23%), Positives = 18/77 (23%) Frame = +3 Query: 636 PXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXX 815 P P PP PP P PPP P Sbjct: 208 PPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 267 Query: 816 XXPPPPXRXXXPXPXXP 866 PPPP R P P Sbjct: 268 NAPPPPKRGSSNPPPPP 284 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 657 PXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXXXXPPPPX 836 P PP P PP P P PP P P PPPP Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGP-PSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPS 236 Query: 837 RXXXPXPXXP 866 R P P P Sbjct: 237 RDQVPLPPPP 246 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 PP PP P + PPP PP P PP PP Sbjct: 156 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPP 838 PPP PPP P Q PPP PPP PP P PP Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAP-QPLGGPPP--PPPGRRPPSGKINPPPPPPP 305 Score = 31.9 bits (69), Expect = 0.70 Identities = 32/138 (23%), Positives = 32/138 (23%), Gaps = 5/138 (3%) Frame = +2 Query: 467 PPPPXFWEXKXXFXLPXKXXXXXXXXXXPQXPXXPXXXXPXXXXXXXXXPXXPXXXTXXX 646 PPPP P K P P P P P Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPA 221 Query: 647 XXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXP-- 820 P PPP P PPP Q PPP PP P Sbjct: 222 PPPPLNATPPPPPPSRDQVP---LPPPPLRG---QIAPPPPPISKPPTSTRSAPPPPPGR 275 Query: 821 ---PXPXPPPXXPXPXXP 865 P PPP P P Sbjct: 276 APQPLGGPPPPPPGRRPP 293 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 5/56 (8%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPP-----XPXPPPXXPXP 856 PP PPP P PPP P PP P PPP P Sbjct: 81 PPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/77 (23%), Positives = 18/77 (23%) Frame = +3 Query: 636 PXXXXXXPXXXPPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPPPXPXXXXXXX 815 P P PP PP P PPP P Sbjct: 120 PPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 179 Query: 816 XXPPPPXRXXXPXPXXP 866 PPPP R P P Sbjct: 180 NAPPPPKRGSSNPPPPP 196 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G GGG G GG G GGG GG G GGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 G G G GGG G GG G GGG GGG G G G Sbjct: 81 GGRGGG-FGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 792 GXGGGX-XGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GGG GGG G GGG GG GGG G G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GG GGG G GGG GG GGG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGG--GGGFGGGGGGGGGFGGGGG 124 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 722 PPXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP P Q + PP P PP P PP P P P P P Sbjct: 776 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 722 PPXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP P Q + PP P PP P PP P P P P P Sbjct: 691 PPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 722 PPXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPXPPPXXPXP 856 PP P Q + PP P PP P PP P P P P Sbjct: 861 PPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/49 (30%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 722 PPXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP P + + P P PP P PP P P P P P Sbjct: 606 PPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/71 (26%), Positives = 19/71 (26%), Gaps = 5/71 (7%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPP-----PXPXXXXXXXXPPXPX 832 P PP PP PP P P P P P PP Sbjct: 220 PKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDM 279 Query: 833 PPPXXPXPXXP 865 PP P P P Sbjct: 280 GPPGLPGPPGP 290 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PP P PP P PP P P P Sbjct: 32 PPPYEAPPPPPG------PPGPDGPPGFPGPQGP 59 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP P P P PP P P P PP P P P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQG----PNGPKGPPGLPGPPGP 74 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXX-PPXPX 832 P P PPP PP P P P K PP PP P P Sbjct: 34 PYEAPPPPPGPPGPDGPPGF-PGPQGPNGP----KGPPGLPGPPGPPGFQGPPGNPAGAI 88 Query: 833 PPPXXPXP 856 PP P P Sbjct: 89 GPPGLPGP 96 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P P PP Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPX 832 P PP PP P P + PP P PP P PP P Sbjct: 74 PPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQM------PPGPP 127 Query: 833 PPPXXPXPXXP 865 P P P P Sbjct: 128 GLPGPPGPAGP 138 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKX--PPPXXPPPXPXXXXXXXXPPXP 829 P P PP PP PP PPP PPP P P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPP 296 Query: 830 XPPP 841 PPP Sbjct: 297 PPPP 300 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 2/68 (2%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKX--PPPXXPPPXPXXXXXXXXPPXPXPPP 841 P PP P PPP P PPP PP PP PPP Sbjct: 225 PMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMG--MPGMGGMPPPGMPPP 282 Query: 842 XXPXPXXP 865 P P Sbjct: 283 MPPGGMPP 290 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 677 PPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PP PP PP P PP PPP PP PPP P Sbjct: 215 PPIQTSTSLPPMI-PPVGMLGHPPMGAPPPPHSMPPP-------GMPPPGMMPPPGFPPM 266 Query: 857 XXP 865 P Sbjct: 267 GMP 269 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.9 bits (74), Expect = 0.17 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 707 PXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 P PPP P PP PPP P PP P P P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP PPP P PP P P P P P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPP 692 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PPP PP P P P P P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P PPP PP PP P PPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 765 PPPXXPPPXPXXXXXXXXXPPPPXRXXXPXPXXP 866 PPP PPP PPPP P P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 673 PXPXXXXXXXPPXXXPXPXXXXXXXXXXXXXPPPXXPPXXXXXPXXXXPXXPXPXAXXPX 852 P P PP P P PPP PP P P P P + P Sbjct: 270 PIPSASQNATPPPPPPPPSNTPGMFASSGFQPPP--PPPTDFAP---PPPPPEPTSELPP 324 Query: 853 XPPPP 867 PPPP Sbjct: 325 PPPPP 329 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPP 838 P PPP PP P Q PP PP P PP P PP Sbjct: 280 PPPPP-------PPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 4/59 (6%) Frame = +3 Query: 669 PPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXP----PPXPXXXXXXXXXPPPP 833 PP P PP P PPP P PP P PPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXX 661 G G G G G GGG GG G GG GG G G G Sbjct: 137 GDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGD 196 Query: 660 XG 655 G Sbjct: 197 DG 198 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G GG G GG GGG GGG G GG GG Sbjct: 162 GDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G G G G G GGG G G G GGG GG GGG Sbjct: 151 GDGDGGGSDDGGDDDDGDGGGSNGSG-GGDDGGDGGDDGGGSGGGGDDGGSDGGGG 205 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PPP P PP P PPP P P P Sbjct: 5 PPP--PPPPPPIAAEFTAPPAP-PPPPNPAPDVP 35 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 2/68 (2%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPP--XPXPPP 841 P PPP P P P PPP P P PP P PP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPP 1281 Query: 842 XXPXPXXP 865 P P P Sbjct: 1282 GPPGPPGP 1289 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +2 Query: 674 PPPXXXXXXXPPXXX----PPPXXXXXPXQXX-KXPPPXXPPPXPXXXXXXXXPPXPXP 835 PPP PP PPP P Q PPP PP P PP P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGP---PGPPGPPGPQP 1291 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG G GG G GGG GGG GGG GG Sbjct: 216 GGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGG--SGTHSGQAGGGGGSYCGGSSCSAV 273 Query: 684 XGG 676 GG Sbjct: 274 TGG 276 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G GG G GG G GGG GGG G GG GG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGG----RGGGGSYGGGRRDYGG 144 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP P PPP PPP P P P PP P P Sbjct: 123 PPPPTGTLP------PPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPP 823 PPP PP PPP P PP PP P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPP------PPDTPAPPVPPTEAPPTAPP 165 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 7/56 (12%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXP-------XXXXXXXXPPXPXPPPXXPXPXXP 865 PP P PPP PPP P P P PPP P P P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P PPP PP PPP PPP P PP P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPP------PPPPAPCM 150 Query: 836 PP 841 PP Sbjct: 151 PP 152 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P P P PP P PPP P P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 33.1 bits (72), Expect = 0.30 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXX-GXXXXXGGGXXXGGXXXXX 688 G G GGG G GG G GGG GG G GGG GG Sbjct: 157 GYRGGRDRGGGYGGGGEGGY----GMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 Query: 687 XXGGGXG 667 GG G Sbjct: 213 SYSGGGG 219 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGX 670 G GGG G G G GG GG GGG GG GGG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGG 197 Query: 669 GXXXG 655 G Sbjct: 198 DYGGG 202 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG G G GG GGG G GGG GG Sbjct: 148 GGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGG---GPG 204 Query: 684 XGGGXG 667 GGG G Sbjct: 205 YGGGQG 210 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GG G GGG GGG G GG GG Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGG 201 Query: 675 GXGXXXG 655 G G G Sbjct: 202 GPGYGGG 208 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 32.7 bits (71), Expect = 0.40 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXP 829 P P PP P PPP + PPP P P PP P Sbjct: 529 PTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPPAPKRALDLKPNLPPVP 586 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG G GG G GGG GGG GGG G Sbjct: 346 GGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITW--NQAGGGGGSYCAGSSCKGV 403 Query: 684 XGGGXG 667 GG G Sbjct: 404 TGGNSG 409 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXP 850 PP PP PPP P P P P PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P PP P PPP P PP PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PP P P PP P PP PP P P P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 677 PPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PP P PPP P + PPP PPP P P P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAP----EPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRP 949 Query: 857 XXP 865 P Sbjct: 950 TPP 952 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 1/85 (1%) Frame = +2 Query: 614 PXXPXXXTXXXXXXPXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P T P PPP PP P P P PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPP-PPIQTTRPTVPTTPTTQASTTRPTPPPPTS 956 Query: 794 XXXXXXXXPPXPXPP-PXXPXPXXP 865 P PP P P P P Sbjct: 957 ALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PXXXXXPXQXXKXPPPXXP-PPXPXXXXXXXXPPXPXPPP 841 P P P P P PP P PP P PPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.3 bits (70), Expect = 0.53 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G G GGG GGG GGG G GGG GG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYR--GGGGYGGGHRGGGG 787 Query: 684 XGGG 673 GGG Sbjct: 788 YGGG 791 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 837 GGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXG 667 GG G GG G G GG G GG GG GGG G Sbjct: 733 GGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 28.7 bits (61), Expect = 6.5 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = -3 Query: 828 GXGGXXXXXXXXGXGGGXXGGG---XXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXX 658 G GG G GGG GGG G GGG GG GGG G Sbjct: 719 GRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGG----GYGGGGGGYRG 774 Query: 657 G 655 G Sbjct: 775 G 775 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 837 GGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G GG G GGG GGG GGG GG Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -2 Query: 832 GGGGXXXXXXXXXGXGGGXXGGGXFXXLXXXXXXGXGXXXXGGXXXXXGXXGXGGXXXG 656 GG G G GGG GGG G G GG G G GG G Sbjct: 718 GGRGGWQKDYQRGGRGGGGYGGGYND--RRMQQGGYGNRSGGGYRGGGGYGGGGGGYRG 774 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXX-PPPXPXXXXXXXXPPXPXPPPX 844 P P P P PPP P PP PPP P P P P Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPS 356 Query: 845 XP 850 P Sbjct: 357 PP 358 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 P PP P PPP P P PP PP P P Sbjct: 291 PAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G GGG G GG G GGG GG G GG G Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.5 bits (68), Expect = 0.93 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G GGG G GG G GGG GGG G GG G Sbjct: 80 GGGGCGGGGGGGGGVG-----GGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G GG G GG G GGG GGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +3 Query: 669 PPXPXXPXXXXXPPXXXXPXPXXXXXXXXXXXPPPXXPP-PXPXXXXXXXXXPPPP 833 PP P P PP P P PP PP P PPPP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 822 GGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXG 667 GG G GGG GGG G GGG GG GGG G Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYG---GGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGG 778 G G G GGG G GG G GGG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 PP PPP P PP P P PP P PPP Sbjct: 686 PPAPPPPPIGGGDPTIWVSGGPPLSAP--PLSSTLGPPPPAPPPPP 729 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPP 841 PP PPP P PP P PPP Sbjct: 755 PP--PPPPPAVPGEGARPPPPPPPP 777 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 31.5 bits (68), Expect = 0.93 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -3 Query: 840 GGGXGXG-GXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG-GXXXXXXXGGGXG 667 GGG G G G G G G GG G GGG G G GGG G Sbjct: 297 GGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMG 356 Query: 666 XXXG 655 G Sbjct: 357 RGPG 360 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = -3 Query: 864 GXXGXGXXGG-GXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXX 688 G G G GG G G G G G G GG G GGG Sbjct: 258 GGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGR 317 Query: 687 XXGGGXGXXXG 655 GGG G G Sbjct: 318 GPGGGWGRMQG 328 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = -3 Query: 855 GXGXXGGGXGXG-GXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG-GXXXXXXX 682 G GGG G G G G G GG G GGG G G Sbjct: 237 GSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQ 296 Query: 681 GGGXGXXXG 655 GGG G G Sbjct: 297 GGGMGRGPG 305 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.5 bits (68), Expect = 0.93 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGG 766 G G GGG G GG G GGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPP 864 PP PP P P P P A P PPP Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G G GG G GG G GGG GGG GG GG Sbjct: 329 GSGGSGTSEGGFGGGGATVASRPGG-GGGYSGGGLASSGGSTLSSEGGVAGGGG 381 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXX 685 G G GG G GG GGG GGG G GG G Sbjct: 110 GGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGG-GQEGGGQGGAQAGGSTSGSSSGGAT 168 Query: 684 XGGG 673 GGG Sbjct: 169 SGGG 172 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G GG GG GGG GG G GGG GG G Sbjct: 99 GASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGS 158 Query: 675 GXGXXXG 655 G G Sbjct: 159 TSGSSSG 165 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P PPP PP P P P P PPP P Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P PPP PP P P P PPP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +2 Query: 707 PXXXPPPXXXXXPXQXXKXPPPXX-----PPPXPXXXXXXXXPPXPXPPPXXPXP 856 P PPP P PPP PP P PP P PPP P Sbjct: 276 PTSQPPPPP---PLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PP PPP P PP P PPP P P Sbjct: 1307 PPESPPPPP------PPPPPPPPPPLPPTP 1330 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPP-PXXPXPXXP 865 PPP PP P P P PP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 743 PXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 P + PPP PPP P PP P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPP-------PPPPPPPP 885 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 P P PPP P PP P PPP P P Sbjct: 862 PRPRRPPPPPP-------PPPPPPPPPPPPP 885 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 G G GGG G GG G GGG G G GGG GG Sbjct: 41 GGGGGGGGGGGGG--------GGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG G G GGG GGG Sbjct: 49 GGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 GGG G GG G G G G G GGG G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 765 PPPXXPPPXPXXXXXXXXXPPPPXRXXXP 851 PPP PPP P PPPP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 768 PPXXPPPXPXXXXXXXXXPPPPXRXXXPXP 857 PP PPP P PPPP P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPX 853 PPP PP PP P + P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEP-EPE 289 Query: 854 P 856 P Sbjct: 290 P 290 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G G G G G GG G GGG GGG GG G Sbjct: 249 GEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAG 301 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +2 Query: 704 PPXXXPP--PXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXP 850 PP PP P P PP P P P P P PP P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 766 PPPXXPPXXXXXPXXXXPXXPXPXAXXPXXPPPP 867 PPP PP P P P PPPP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPP 810 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 719 PPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PPP P PPP PP P PP P P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP PP + P PPP P PP P PP P P Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPP--GFPQFQPPPPPPPSDAPWIERP 451 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PPP PP P PP P P Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIP 415 Score = 22.2 bits (45), Expect(2) = 5.8 Identities = 12/40 (30%), Positives = 12/40 (30%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 PPP P P P P P PPP P Sbjct: 307 PPPPAASE--PAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -3 Query: 855 GXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGG 676 G G GG GG G GGG GG G G G GG Sbjct: 156 GMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGG 215 Query: 675 GXGXXXG 655 G G G Sbjct: 216 GMGGGMG 222 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGG 766 G G G GGG G G G GGG GG Sbjct: 448 GDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG GG G GG GGG Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXG-GXXXXXXXGGG 673 G GGG GGG G GGG G G GGG Sbjct: 444 GDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 22.6 bits (46), Expect(3) = 2.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 764 PPPXXPPPXP 793 PPP PPP P Sbjct: 819 PPPPPPPPPP 828 Score = 22.2 bits (45), Expect(3) = 2.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 818 PPXPXPPPXXP 850 PP P PPP P Sbjct: 821 PPPPPPPPEEP 831 Score = 21.8 bits (44), Expect(3) = 2.2 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 Query: 743 PXQXXKXPPPXXPPP 787 P + PPP PPP Sbjct: 813 PHEDSPPPPPPPPPP 827 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PP P PP P PPP P P Sbjct: 73 PPPLCAPPPPPPP-----PPPPPPPPGAKKPDDP 101 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 743 PXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P + PPP P P PP P P P P P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 707 PXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPP 841 P PPP P PPP P P PP PPP Sbjct: 550 PSEEPPP-----PPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 PPP PP PP P PP PPP P Sbjct: 554 PPPPPPGVDIPPPL--PPSEDPKPPPPPPEPPEECPPPPP 591 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 828 GXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGG 673 G GG G GG GGG G GGG G GGG Sbjct: 198 GRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGG 249 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PPP PP P PP P PPP P P Sbjct: 274 PPPLCAPPPPPPP-----PPPPPPPPGAKKPDDP 302 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGG 766 G G GGG G GG G GGG GG Sbjct: 49 GGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 834 GXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G G GG G GGG GGG G G G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G G GGG G GG G GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 3/73 (4%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG---GXXX 694 G G G GGG G G G G G GG G G G G G Sbjct: 14 GGWGQGP-GGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGM 72 Query: 693 XXXXGGGXGXXXG 655 GGG G G Sbjct: 73 GRGPGGGLGRGPG 85 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPPXXXXXPXQXXKX-PPPXXPPP 787 PP PP PPP P + PPP PPP Sbjct: 384 PPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPP 422 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P PPP P PP PPP P P PP P Sbjct: 364 PPIIPIPPPAMPAMFNP-HVPPPMIGPVTVPPPPLIPPPQASIPPP--TMIQTLPPPSVP 420 Query: 836 PPXXPXPXXP 865 PP P P Sbjct: 421 PPPIGVPNRP 430 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 840 GGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 GG G GG G GGG GG G GGG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXP 793 P P PP PP PPP Q PP P P Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPP 787 P PP PP PPP + PPP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVAS------RRPPPPLPPP 277 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P P P P PPP P K P PPP PP PP Sbjct: 688 PLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPP-----EEVSLPPPDESPPSS 742 Query: 848 PXP 856 P Sbjct: 743 KHP 745 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPP 841 PP PPP P PP P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 PP PPP P PP P PPP P P Sbjct: 54 PPPPPPPPP--------PPPPPPPPPSSSPSRP 78 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 668 PXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXX 847 P PPP PP P PP PP P P P PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPG-PPGLPGPQGIPGYPGAPAGPPGR 1718 Query: 848 PXPXXP 865 P P Sbjct: 1719 DGPMGP 1724 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 704 PPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXPPPXXP 850 P P P PPP P P PP P PP P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 PPP P P P PP P PPP P Sbjct: 226 PPPAAPAPPPPPAAA---PPPPPPPPPVKKP 253 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXP-XPPPXXP 850 PPP PPP PP P PPP P Sbjct: 514 PPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 770 PXXPPPXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P PPP P P PPP P P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPPP 841 PPP PP P PP PPP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGG 718 G G GGG G GGG GGG G GGG Sbjct: 372 GTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGGHGGG 420 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G GG G GG G GGG GGG Sbjct: 159 GGDGGDDGDGGGDDDDGGDGDGGGDDGGG 187 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/72 (27%), Positives = 20/72 (27%), Gaps = 7/72 (9%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXP-PPXXXXXPXQXXKXPPPXXPPPX------PXXXXXXX 814 P P PP PP P PP P P P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISA 807 Query: 815 XPPXPXPPPXXP 850 PP P P P Sbjct: 808 EPPPPPPVARKP 819 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -3 Query: 849 GXXGGGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXG 706 G GG G GG G GGG GGG GG G Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 837 GGXGXGGXXXXXXXXGXGGGXXGGGXXXXXXGXXXXXGGGXXXGG 703 GG G GG G GGG GG GGG G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 >SB_36932| Best HMM Match : HTH_8 (HMM E-Value=1.4) Length = 721 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 164 KRDAPKEDNSLNTLAESAKKTIEELREKVESR 259 KR APK+ N+ + L +K EELR++ + + Sbjct: 62 KRQAPKDRNTASVLRAKIRKQEEELRKETQRK 93 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 785 PXPXXXXXXXXPPXPXPPPXXPXPXXP 865 P P PP P PPP P P P Sbjct: 291 PTPKPRTPTPSPPTPTPPPRSPTPLHP 317 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGXGGGXXGGG 763 G G GG G GG G GGG GGG Sbjct: 265 GGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/67 (25%), Positives = 17/67 (25%) Frame = +2 Query: 656 PXXXPXPPPXXXXXXXPPXXXPPPXXXXXPXQXXKXPPPXXPPPXPXXXXXXXXPPXPXP 835 P P P P P Q PP PP P PP P Sbjct: 108 PVPLAPPMPLAPPVQQAPCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPMPLA 167 Query: 836 PPXXPXP 856 PP P Sbjct: 168 PPVQQAP 174 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 674 PPPXXXXXXXPPXXXPPP---XXXXXPXQXXKXPPPXXPPPXP 793 PP PP PPP P Q PPP PP P Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_18023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 500 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -3 Query: 267 GPRRDST-FSLNSSIVFFALSASVFRLLSSLGASRLTNACTLARQIANKIISSLFI 103 GP RD+ SL IV AL R+L L S N TLA+ +KII + + Sbjct: 232 GPSRDNRPRSLFECIVCSALLVVRVRVLPKLLESAFFNPATLAKSTQDKIIVQVLV 287 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 764 PPPXXPPPXPXXXXXXXXPPXPXPP 838 PPP PPP P PP P PP Sbjct: 784 PPPEYPPPPP--GLARPNPPPPNPP 806 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = -3 Query: 864 GXXGXGXXGGGXGXGGXXXXXXXXGX--GGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXX 691 G G G G G GG G G G GGG G G G GG Sbjct: 112 GMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGE 171 Query: 690 XXXGG 676 GG Sbjct: 172 GISGG 176 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.3 bits (60), Expect = 8.6 Identities = 23/99 (23%), Positives = 24/99 (24%), Gaps = 3/99 (3%) Frame = +2 Query: 569 PXXXXPXXXXXXXXXPXXPXXXTXXXXXXPXXXPXPP--PXXXXXXXPPXXXPPPXXXXX 742 P P P P P P PP P P P Sbjct: 261 PPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRY 320 Query: 743 PXQXXKXPP-PXXPPPXPXXXXXXXXPPXPXPPPXXPXP 856 P + PP P PP P P PP P P Sbjct: 321 PPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSP 359 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 792 GXGGGXXGGGXXXXXXGXXXXXGGGXXXGGXXXXXXXGGGXGXXXG 655 G GGG G G GGG GG G G G G Sbjct: 11 GEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDG 56 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 767 PPXXPPPXPXXXXXXXXPP-XPXPPPXXPXPXXP 865 PP P P P P P PPP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,305,644 Number of Sequences: 59808 Number of extensions: 329517 Number of successful extensions: 6470 Number of sequences better than 10.0: 112 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2376 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -