Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_L06
         (863 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0625 + 18126856-18127444,18127561-18127725,18127827-18127834     28   8.4  

>04_03_0625 + 18126856-18127444,18127561-18127725,18127827-18127834
          Length = 253

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 13/52 (25%), Positives = 22/52 (42%)
 Frame = +2

Query: 539 GLMNDDDCAKSFPFICXKTLASLEWNVNCDIPNTDYAYXXVLGRCYKMYLTP 694
           G  + D+C +   + C  T  ++  +  C  P        + G C K +LTP
Sbjct: 194 GCQDIDECEEHENYHCYGTCKNILGSFECSCPAGTRGNASIEGACQKNFLTP 245


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,876,175
Number of Sequences: 37544
Number of extensions: 393255
Number of successful extensions: 905
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 883
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 905
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2420970504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)