BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_L04 (859 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 26 0.51 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.7 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 8.3 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 8.3 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 25.8 bits (54), Expect = 0.51 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 471 SHVLSCVIPLILWITVLPPLSELIPLAA 388 S +LS V+ L+L +LPP S ++PL A Sbjct: 270 SILLSLVVFLLLVSKILPPTSLVLPLIA 297 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 492 GLLLAFCSHVL-SCVIPLILWITVLPPLSELIPL 394 G ++ CS +L S + +L ++PP S IPL Sbjct: 278 GEKVSLCSSILLSLTVFFLLLAEIIPPTSLAIPL 311 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 471 SHVLSCVIPLILWITVLPPLSELIPL 394 S +LS + +L ++PP S ++PL Sbjct: 277 SILLSLTVFFLLLAEIIPPTSLVVPL 302 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 8.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 669 LTGYPVRLSPFGKRGAFLIAHAVGISVPVXVVRSQAGLC 785 L G+P + SP+ A LIA +G S+ V V +C Sbjct: 26 LQGFPGKNSPYTVTQAILIALVLG-SIIVGTVIGNILVC 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,195 Number of Sequences: 438 Number of extensions: 5550 Number of successful extensions: 13 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27673956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -