BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K24 (929 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 51 2e-07 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 48 2e-06 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 44 3e-05 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 42 2e-04 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 40 7e-04 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 37 0.004 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 36 0.006 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 35 0.019 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 35 0.019 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 34 0.025 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 34 0.033 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 32 0.10 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.18 SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces... 31 0.23 SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pom... 30 0.40 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 27 0.45 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 29 0.93 SPAC1B3.14 |vma3||V-type ATPase subunit c|Schizosaccharomyces po... 28 2.2 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 28 2.2 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 28 2.2 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 28 2.2 SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces... 27 2.8 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 27 2.8 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.8 SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|c... 27 3.8 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 3.8 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 27 4.6 SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual 27 5.0 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 26 6.6 SPBP8B7.31 |||acid phosphatase |Schizosaccharomyces pombe|chr 2|... 26 6.6 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 26 6.6 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 26 8.7 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 51.2 bits (117), Expect = 2e-07 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PPPXX--GXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 PPP P P P PPP+ PPPPPPPP PPPP P Sbjct: 735 PPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 47.2 bits (107), Expect = 3e-06 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPP 841 P P P P P G P PP PPPP PPPPPPPP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPP--PPPPGVAGAGPPPPPPPPP 783 Score = 46.4 bits (105), Expect = 6e-06 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPP 842 P PP P P PP PPPP PPPPPPPP Sbjct: 750 PVPPPAPIMGGPPPP---PPPPGVAGAGPPPPPPPP 782 Score = 37.5 bits (83), Expect = 0.003 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 785 PPPPPSXXXXXPPPPP---PPPXXXKXRPPPPXP 877 PPPPP+ P P P PPP PPPP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP 766 Score = 36.3 bits (80), Expect = 0.006 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPP 800 P P P + P PPPP PP PPPP Sbjct: 748 PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.1 bits (72), Expect = 0.057 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 P P P P P P P PPP PPPPP PPPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP------PPPPPGVAGAGPPPPPPPPP 783 Score = 32.3 bits (70), Expect = 0.10 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPS 802 P P P PPP PP PPPPP+ Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPA 784 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 765 SPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 SP PP P P PPP P P P PP Sbjct: 731 SPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +3 Query: 825 PPPPPPXXXKXVPXPRP-PFXXXXPTXRGGAXP 920 PPPPPP P P P P P G P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP 764 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 821 PPPPPPPXXXKXRPPPPXPXXKXXP 895 PPPPPP P P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAP 756 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 48.0 bits (109), Expect = 2e-06 Identities = 28/70 (40%), Positives = 28/70 (40%) Frame = -3 Query: 894 GXXXXXGXGGGGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXK 715 G G GG G GG GG GG EGG GG GG G G G G G Sbjct: 203 GPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFG 262 Query: 714 XGPGXXRGXG 685 GPG G G Sbjct: 263 GGPGGHGGPG 272 Score = 41.5 bits (93), Expect = 2e-04 Identities = 27/67 (40%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Frame = -3 Query: 876 GXGGGGRXXXXXGGGGGGGGXXXXXEGGGG-GXXGGXGXPXXGGGVXXGXXXGXKXGPGX 700 G GGG G GGG GG G GG G GG G G G G G + GPG Sbjct: 184 GHNGGG----FGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGG 239 Query: 699 XRGXGGG 679 G GG Sbjct: 240 FGGGPGG 246 Score = 40.7 bits (91), Expect = 3e-04 Identities = 27/73 (36%), Positives = 27/73 (36%), Gaps = 1/73 (1%) Frame = -3 Query: 894 GXXXXXGXGGGGRXXXXXGGGGGGG-GXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGX 718 G G G GG G GG GG G GG GG GG G G G G G Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGF 247 Query: 717 KXGPGXXRGXGGG 679 G G G GG Sbjct: 248 GGGLGGFGGGPGG 260 Score = 37.5 bits (83), Expect = 0.003 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 919 GXAPPRLVGXXFXXGGRGXGTXFXXXGGGGGGGGXXXXXXGGGGXXXGGXGXXXXGGGGX 740 G PP G G G G GG GGG G GG G GG G G GG Sbjct: 198 GGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGG 257 Query: 739 XG 734 G Sbjct: 258 PG 259 Score = 32.7 bits (71), Expect = 0.076 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -3 Query: 861 GRXXXXXGGGGGGGGXXXXXEGG---GGGXXGGXGXPXXGGGVXXGXXXGXKXGPGXXRG 691 G G GGG G GG G G GG G G G G G GPG G Sbjct: 177 GNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGG-FGGEGHHHGGHGGFGGGPGGFEG 235 Query: 690 XGGG 679 GG Sbjct: 236 GPGG 239 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 44.0 bits (99), Expect = 3e-05 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPXXP---PPPPS--XXXXXPPPPPPPPXXXKXRPPPPX 874 P P P PP P PP P PPPPS PP PPPP P P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPN 1745 Query: 875 P 877 P Sbjct: 1746 P 1746 Score = 29.9 bits (64), Expect = 0.53 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFXXXXPTXRGGAXP 920 P P P P PP PPPP P P P P P + P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 29.9 bits (64), Expect = 0.53 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPP 836 P AP PPP P P PPPP P P P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 27.5 bits (58), Expect = 2.8 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPP--PPPPXXXKXVPX 866 P PAP + P P S P PP P PP VP Sbjct: 1472 PSSAPAPPAPVSQLPPAVPNVPVPSMIPSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPS 1531 Query: 867 PRPP 878 P PP Sbjct: 1532 PAPP 1535 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/39 (28%), Positives = 13/39 (33%) Frame = +1 Query: 475 PPXKXXGEKXPXFXXXXPXPPPFXXPPEKNXFXXXFSPP 591 PP + P P PPP PP + PP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPP 1728 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 41.5 bits (93), Expect = 2e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 767 PXPPXXPPPPPSXXXXXPPPPPPPPXXXKXR 859 P P PPPPP PPPPPPP K R Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPPGYVKKR 36 Score = 38.3 bits (85), Expect = 0.002 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +2 Query: 749 PPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PP G P PP PPPP PPPPPPP K + P Sbjct: 5 PP--GNPPPP--PPPPGFEPPSQPPPPPPPGYVKKRKNKTP 41 Score = 35.1 bits (77), Expect = 0.014 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 818 PPPPPPPPXXXKXRPPPPXP 877 PPPPPPP +PPPP P Sbjct: 10 PPPPPPPGFEPPSQPPPPPP 29 Score = 34.7 bits (76), Expect = 0.019 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 818 PPPPPPPPXXXKXRPPPPXP 877 PPPPPPPP PPP P Sbjct: 9 PPPPPPPPGFEPPSQPPPPP 28 Score = 30.7 bits (66), Expect = 0.31 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 747 PPPXXXSPXPPXXXPPPPXXXXXXPPPPPPP 839 PP P PP PP PPPPPPP Sbjct: 5 PPGNPPPPPPPPGFEPP-----SQPPPPPPP 30 Score = 29.9 bits (64), Expect = 0.53 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 818 PPPPPPPPXXXKXRPPPPXP 877 PPPPPP PPPP P Sbjct: 11 PPPPPPGFEPPSQPPPPPPP 30 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPP 799 PPP G P PPPPP Sbjct: 12 PPPPPGFEPPSQPPPPPP 29 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 722 PXFXPXXTPPPXXGXPXPPXXPPPP 796 P P PPP P P PPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 2.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPP 800 P PPPP P PPPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 39.5 bits (88), Expect = 7e-04 Identities = 26/64 (40%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -3 Query: 876 GXGG--GGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXKXGPG 703 G GG GGR G GG GGG GG GG GG G G G G G G G Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRG----GRGGARGGRGGSSGGRG 65 Query: 702 XXRG 691 +G Sbjct: 66 GAKG 69 Score = 39.1 bits (87), Expect = 9e-04 Identities = 22/54 (40%), Positives = 23/54 (42%) Frame = -3 Query: 840 GGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXKXGPGXXRGXGGG 679 GG GG G GG GG GG G GG G G + G G RG GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGG---RGGARGGRGGRGGARGGRGG 59 Score = 38.7 bits (86), Expect = 0.001 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -3 Query: 864 GGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXKXGPGXXRGXG 685 GGR G GG GG G GG GG G G G G G + G RG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRG-GRGGARGGRGGSSGGRGGA 67 Query: 684 GGG 676 GG Sbjct: 68 KGG 70 Score = 37.9 bits (84), Expect = 0.002 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -3 Query: 870 GGGGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXKXG 709 G GG G GGG GG GG G GG G G G G G K G Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 35.9 bits (79), Expect = 0.008 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -2 Query: 877 GGRGXGTXFXXXGGGGGGGGXXXXXXGGGGXXXGGXGXXXXGGGGXXGXKXRXXXGA 707 GGRG G G GGG GG GG GG G G GG G + GA Sbjct: 16 GGRG-GFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGA 71 Score = 35.5 bits (78), Expect = 0.011 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 894 GXXXXXGXGGGGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGV 742 G G G GG GG GG G GG GG GG G G V Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAKV 73 Score = 35.1 bits (77), Expect = 0.014 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -3 Query: 876 GXGG--GGRXXXXXGGGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXK 715 G GG GGR G GG GG GG GG G G G G G K Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAK 72 Score = 29.1 bits (62), Expect = 0.93 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 906 RXWWGXXXXXGXGGG-GRXXXXXGGGGGGGGXXXXXEGGGGGXXGG 772 R +G GGG G GG GG G GG GG GG Sbjct: 25 RGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 37.1 bits (82), Expect = 0.004 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 7/69 (10%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPX--PPXXPPPPPSXXXXXPPPPPPP-----PXXXKXRPPP 868 P P P P G P PP PP P PP PPP P PP Sbjct: 1170 PVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPV 1229 Query: 869 PXPXXKXXP 895 P P K P Sbjct: 1230 PVPTAKAPP 1238 Score = 32.7 bits (71), Expect = 0.076 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPP---PPPPPXXXKXVPXPRPPFXXXXPTXRGGA 914 PP P S PP P P PPP PP P P P P PT G Sbjct: 1169 PPVPAPSSGIPP--VPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGL 1226 Query: 915 XP 920 P Sbjct: 1227 PP 1228 Score = 32.3 bits (70), Expect = 0.10 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 3/70 (4%) Frame = +3 Query: 708 APXXXLXXXPXXP-PPPXXXSPXP-PXXXPPPPXXXXXXPPPPPPPPXXXKXVP-XPRPP 878 AP L P P P P P P PP P P PPP P +P P P Sbjct: 1021 APPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPS 1080 Query: 879 FXXXXPTXRG 908 P G Sbjct: 1081 GAPPVPAPSG 1090 Score = 31.9 bits (69), Expect = 0.13 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXP 869 PAP + P P P P PP PP PP PPP VP P Sbjct: 1172 PAPSSGI---PPVPKPAAGVPPVPPP-SEAPPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 31.5 bits (68), Expect = 0.18 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 8/63 (12%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPP--------PPPPPPXXXKXV 860 P P + P P P P PP P PP PP PPP V Sbjct: 1141 PVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPV 1200 Query: 861 PXP 869 P P Sbjct: 1201 PKP 1203 Score = 31.5 bits (68), Expect = 0.18 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 9/71 (12%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPP-----XXPPPPPSXXXXXPPP----PPPPPXXXKXRP 862 P P P P G P P P PPPS P P PP PP P Sbjct: 1160 PVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP--PSTAP 1217 Query: 863 PPPXPXXKXXP 895 P P P P Sbjct: 1218 PVPTPSAGLPP 1228 Score = 31.5 bits (68), Expect = 0.18 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXP--PPPXXXXXXPPP----PPPPPXXXKXVPX 866 P P P PP P P P PPP P P PP P K P Sbjct: 1180 PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPV 1239 Query: 867 PRP 875 P P Sbjct: 1240 PAP 1242 Score = 31.1 bits (67), Expect = 0.23 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 6/70 (8%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXP-PXXPPPPPSXXXXXPPPPPP-----PPXXXKXRPP 865 P P P P P P P P PP P PP P P P PP Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 866 PPXPXXKXXP 895 P P P Sbjct: 1123 VPKPSVAAPP 1132 Score = 31.1 bits (67), Expect = 0.23 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPP---PPXXXKXRPPPPX 874 P P P P P P P PP P PP P P PP PP Sbjct: 1077 PAPSGAP---PVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPV 1133 Query: 875 PXXKXXP 895 P P Sbjct: 1134 PVPSGAP 1140 Score = 30.3 bits (65), Expect = 0.40 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 P P P P P P PP P S P PPP P P P P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKS-SSGAPSAPPPVPAPSSEIPSIPAP 1079 Score = 29.9 bits (64), Expect = 0.53 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 7/55 (12%) Frame = +3 Query: 735 PXXPPPPXXXSPXP-PXXXPPPPXXXXXXPPPP------PPPPXXXKXVPXPRPP 878 P P P P P P PP P PP P PP P VP PP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 29.5 bits (63), Expect = 0.71 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 5/64 (7%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXP--PPPXXXSPXPPXXXP---PPPXXXXXXPPPPPPPPXXXKX 857 P PAP + P PP S PP P PP PP P P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 858 VPXP 869 VP P Sbjct: 1123 VPKP 1126 Score = 29.5 bits (63), Expect = 0.71 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 4/68 (5%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPP----PPPXXXKXRPPPP 871 P P P P P P PP P P P P PP PP P Sbjct: 1103 PVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Query: 872 XPXXKXXP 895 P P Sbjct: 1163 KPSVAAPP 1170 Score = 29.5 bits (63), Expect = 0.71 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 7/63 (11%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXP------PXXPPPPPSXXXXXPPPP-PPPPXXXKXRPPP 868 P P PPP P P P PPP + P PP P PP Sbjct: 1180 PVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPV 1239 Query: 869 PXP 877 P P Sbjct: 1240 PAP 1242 Score = 29.1 bits (62), Expect = 0.93 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 2/66 (3%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPP--PPPPPXXXKXRPPPPXP 877 P P P P P P P PS P P PP PP P P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Query: 878 XXKXXP 895 P Sbjct: 1146 SVAAPP 1151 Score = 29.1 bits (62), Expect = 0.93 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXP 869 P P P P P PP PP P P VP P Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXP 869 P P + P P P P P PP PP P P VP P Sbjct: 1122 PVPKPSVAAPPV--PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAP 1174 Score = 27.9 bits (59), Expect = 2.2 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPR 872 PP P S PP P P PP P P P+ Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPK 1054 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +2 Query: 722 PXFXPXXTPP---PXXGXPX-PPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKX 889 P P TPP G P PP P P P PP PP P P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAA 1101 Query: 890 XP 895 P Sbjct: 1102 PP 1103 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 5/67 (7%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPX-XPPPPPSXXXXXPPPPPP----PPXXXKXRPPPPX 874 P P P P P P PP P PP P P PP PP Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPV 1191 Query: 875 PXXKXXP 895 P P Sbjct: 1192 PPPSEAP 1198 Score = 27.5 bits (58), Expect = 2.8 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +3 Query: 735 PXXPPP---PXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXP 869 P PPP P P P PP PP P P VP P Sbjct: 1060 PSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 27.5 bits (58), Expect = 2.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXP--PPPXXXXXXPPPPPPPPXXXKXVPXP 869 PP P PP P PP PP P P VP P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 27.5 bits (58), Expect = 2.8 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPP-----PPPPPXXXKXRPPP 868 P P P PP P P PP P+ P P PP P PP Sbjct: 1126 PSVAAPPVPVPSGAPP----VPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPV 1181 Query: 869 PXPXXKXXP 895 P P P Sbjct: 1182 PKPAAGVPP 1190 Score = 27.1 bits (57), Expect = 3.8 Identities = 18/65 (27%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXPPPPXXXS--PXPPXXXPPPPXXXXXXPPP--PPPPPXXXKXV 860 P P+ + PP P S P P P P P P PP P Sbjct: 1033 PIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIP 1092 Query: 861 PXPRP 875 P P+P Sbjct: 1093 PVPKP 1097 Score = 27.1 bits (57), Expect = 3.8 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPP----PPPPPXXXKXRPPPP 871 P P P PP P P PP P P P PP P PP P Sbjct: 1097 PSVAAPPVPKPSVAVPPV---PAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVP 1153 Query: 872 XP 877 P Sbjct: 1154 AP 1155 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +3 Query: 753 PXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFXXXXPT 899 P SP P PP PP P P +P P PT Sbjct: 999 PVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPT 1047 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 36.3 bits (80), Expect = 0.006 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 870 GGGGRXXXXXGGGGGGGGXXXXXEGG-GGGXXGGXGXPXXGGGVXXGXXXGXKXG 709 G GGR G GG GG GG GGG GG G GG G G + G Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGS-RGGFRGGSRGG 189 Score = 34.7 bits (76), Expect = 0.019 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -3 Query: 834 GGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXKXGP-GXXRGXGGGG 676 G GG G GG G GG GGG G G + G G RG GG Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 31.1 bits (67), Expect = 0.23 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -2 Query: 910 PPRLVGXXFXXGGRGXGTXFXXXGGGGGGGGXXXXXXGGGGXXXGGXGXXXXGG--GGXX 737 P + G GRG F GG GG G GG GG G GG GG Sbjct: 124 PKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFR 183 Query: 736 G 734 G Sbjct: 184 G 184 Score = 29.9 bits (64), Expect = 0.53 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 876 GXGGGGRXXXXXGG--GGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXGXXXGXK 715 G GG G GG GG GG GG G GG GG G G + Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFR 191 Score = 28.7 bits (61), Expect = 1.2 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = -2 Query: 907 PRLVGXXFXXGGRGXGTXFXXXGGGGGGGGXXXXXXGGGGXXXGGXGXXXXGGGGXXG 734 P+ VG G R GG GG G GG G G GGG G Sbjct: 119 PKTVGPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRG 176 Score = 27.5 bits (58), Expect = 2.8 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = -3 Query: 894 GXXXXXGXGG--GGRXXXXXG-GGGGGGGXXXXXEGGGGGXXGGXGXPXXGGGVXXG 733 G G GG GGR G GG GG GG GG G GG G Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 906 RXWWGXXXXXGXGGGGRXXXXXGGGGGGGGXXXXXEGGGGGXXG 775 R +G G GGG R GGG GG G GG G Sbjct: 151 RGGFGGNSRGGFGGGSR--GGFGGGSRGGSRGGFRGGSRGGFRG 192 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 877 GGRGXGTXFXXXGGGGGGGGXXXXXXGGGGXXXGGXGXXXXGGGGXXG 734 GGRG GG GG GGG G GG G Sbjct: 145 GGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 34.7 bits (76), Expect = 0.019 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPHQ 901 PPP P PPP PPPP + PPPP + H+ Sbjct: 300 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPFKHHELEEHE 351 Score = 33.9 bits (74), Expect = 0.033 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPF 881 P P PPPP P PPPP PPPP P PPF Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPF 342 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 209 PPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 250 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 222 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 235 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 248 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 261 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 274 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 33.1 bits (72), Expect = 0.057 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP PPPP + PPPP Sbjct: 287 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PPPP P PPPP PPPP P PP Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 258 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 271 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 284 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 297 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 260 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 310 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 323 Score = 29.5 bits (63), Expect = 0.71 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPH 898 PPP PPPP PPPP PPP + H Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 336 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 752 PXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 P P PPP PPPP + PPPP Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 34.7 bits (76), Expect = 0.019 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +3 Query: 750 PPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFXXXXPTXRGGAXP 920 PP +P P PP P PPP P +P PP P A P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 34.3 bits (75), Expect = 0.025 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPP-PPSXXXXXPPPPPPPPXXXKXRPP--PPX 874 P P P P P P P PPP P+ PP P P PP PP Sbjct: 145 PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Query: 875 P 877 P Sbjct: 205 P 205 Score = 33.9 bits (74), Expect = 0.033 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 735 PXXPPPPXXXSPX-PPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P P PP S PP PP P P PP P +P PP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPP 173 Score = 30.3 bits (65), Expect = 0.40 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFX 884 P P L PP P S PP PP P P PP P PP Sbjct: 131 PTPQSELRPPTSAPPRP---SIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 885 XXXPT 899 P+ Sbjct: 188 PSLPS 192 Score = 29.1 bits (62), Expect = 0.93 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 818 PPPPPPPPXXXKXRPPPP 871 PPPPPP P P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 Score = 28.7 bits (61), Expect = 1.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 819 PPPPPPPPXXXKXVPXPRPP 878 P PPPPPP P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 27.5 bits (58), Expect = 2.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +3 Query: 735 PXXPPP-----PXXXSPXPPXXXP-PPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P PPP P S PP PPP PP P VP P PP Sbjct: 147 PSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVP-PMPP 199 Score = 26.6 bits (56), Expect = 5.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRP--PPPXPXXKXXPHQ 901 PP P P PP S P PPP P P PP P P Q Sbjct: 124 PPSAPAPPTPQSELRPPTS-APPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQ 176 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 776 PXXPPPPPSXXXXXPPPPPP 835 P PPPPP+ P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 25.8 bits (54), Expect = 8.7 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 7/52 (13%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPP--PXXXXXXPPPPPP-----PPXXXKXVPXP 869 P PP +P P PPP P PP P PP K P P Sbjct: 154 PASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 34.3 bits (75), Expect = 0.025 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 P P P PP G PPPPP P PP PPPP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 33.9 bits (74), Expect = 0.033 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 P P P P G P P PP P P PP PPP P Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAP 480 Score = 33.5 bits (73), Expect = 0.043 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PPP S PP PPP + P P Sbjct: 363 PPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALP 404 Score = 32.7 bits (71), Expect = 0.076 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 16/64 (25%) Frame = +2 Query: 734 PXXTPPPXXG-XPXPPXXPPPP-------PSXXXXXPPPPPPPP--------XXXKXRPP 865 P PPP G PP PP P P+ PP PPP K RPP Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPP 312 Query: 866 PPXP 877 PP P Sbjct: 313 PPPP 316 Score = 32.7 bits (71), Expect = 0.076 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 P P G PP PPPP S PPP PP P P Sbjct: 352 PLPPQGRSAPP--PPPPRSAPSTGRQPPPLSSSRAVSNPPAPPP 393 Score = 32.7 bits (71), Expect = 0.076 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPP--PPPPXXXKXRPPPPXPXX 883 P P P P P P PP P P PP P PP P P Sbjct: 432 PPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPVASI 491 Query: 884 KXXPHQXRGRXSL 922 P Q GR +L Sbjct: 492 AELPQQD-GRANL 503 Score = 32.3 bits (70), Expect = 0.10 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 734 PXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPP 868 P TPP P P PPS P PP PP P P Sbjct: 416 PVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLP 460 Score = 31.9 bits (69), Expect = 0.13 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +2 Query: 743 TPPPXXGXPXPPXXP---PPPPSXXXXXP-PPPPPPPXXXKXRPPPPXPXXKXXP 895 TP P PP P PP P PPP PPP PP P P Sbjct: 223 TPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAP 277 Score = 31.9 bits (69), Expect = 0.13 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPP P PP PPPPPP R PPP Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRS-APPPPPPRSAPSTGRQPPP 378 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRP 875 PPPP +P PP PP PPP + P P Sbjct: 362 PPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 Score = 30.7 bits (66), Expect = 0.31 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 8/73 (10%) Frame = +2 Query: 734 PXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPP--------PXXXKXRPPPPXPXXKX 889 P PPP P P S PPPPPPP P + R PP P + Sbjct: 311 PPPPPPPSRRNRGKP--PIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRS 368 Query: 890 XPHQXRGRXSLXS 928 P R L S Sbjct: 369 APSTGRQPPPLSS 381 Score = 30.7 bits (66), Expect = 0.31 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 PPPP S PPP PP PPP PP Sbjct: 361 PPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPP 405 Score = 30.7 bits (66), Expect = 0.31 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 8/66 (12%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPP--PXXGXPXPPXXPPPPPSXXXXXPPPP------PPPPXXXKXR 859 P P P P PP P P PP PPS PP P PP P Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPS-APIAPPLPAGMPAAPPLPPAAPAP 476 Query: 860 PPPPXP 877 PP P P Sbjct: 477 PPAPAP 482 Score = 30.3 bits (65), Expect = 0.40 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 722 PXFXPXXTPP---PXXGXPXPPXXPPPPPSXXXXXPPPPPPP 838 P P PP P P PP P PPPS PP PP Sbjct: 233 PPSIPSSRPPERVPSLSAPAPP--PIPPPSNGTVSSPPNSPP 272 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXP 869 PPPP P PP PPPPP P P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPP 378 Score = 29.9 bits (64), Expect = 0.53 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +2 Query: 743 TPPPXXGXPXPPXXPPP-PPSXXXXXP---PPPPPPPXXXKXRPPPP 871 TPP PP PP PPS P P PP P PP P Sbjct: 414 TPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLP 460 Score = 29.1 bits (62), Expect = 0.93 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +3 Query: 693 PXXXPAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPP 842 P P+ P PP P P PP PPP P P Sbjct: 433 PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAP 482 Score = 28.3 bits (60), Expect = 1.6 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +3 Query: 705 PAPXXXLXXXPXXPP-PPXXXSPXPPXXXPP--PPXXXXXXPPPPPPPPXXXKXVPXPRP 875 P P P PP + PP PP PP PP PP P P Sbjct: 391 PPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLP 450 Query: 876 PFXXXXPTXRGG 911 P P G Sbjct: 451 PSAPIAPPLPAG 462 Score = 27.9 bits (59), Expect = 2.2 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPP 841 P P P P P PP PPP + PP PP P Sbjct: 231 PIPPSIPSSRPPERVPSLSAPAPPPI--PPPSNGTVSSPPNSPPRP 274 Score = 27.9 bits (59), Expect = 2.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 767 PXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXP 895 P P P PPS PP PP PP P P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAP 457 Score = 27.1 bits (57), Expect = 3.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P PPP P PP PP P PP P PP Sbjct: 388 PPAPPPAIPGRSAPAL--PPLGNASRTSTPPVPTPPSLPPSAPPSLPP 433 Score = 26.6 bits (56), Expect = 5.0 Identities = 14/45 (31%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPP-PXP 877 PPP P PPP+ P PP + PP P P Sbjct: 376 PPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTP 420 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 744 PPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPP 878 P PP S PP P PPP PPP P P Sbjct: 231 PIPPSIPSSRPPERVPS----LSAPAPPPIPPPSNGTVSSPPNSP 271 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 33.9 bits (74), Expect = 0.033 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 707 GPXXXPXFXPXXTPPPXXGXPXPPXX--PPPPPSXXXXXPPPPPPP 838 G P P TP P P P PPPPP P PP P Sbjct: 716 GAVNSPAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXX-PPPPXXXXXXPPPPPPPP 842 P P P +P P PPPP P PP P Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 767 PXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 P PP P P P+ PPPPP PP P Sbjct: 729 PAPPT-PAPTPAVKHH-PPPPPVRSSISPSMPPAP 761 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 32.3 bits (70), Expect = 0.10 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +2 Query: 722 PXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXP-PPPPPPPXXXKXRPPPP 871 P P P G P P P PS PPPP P PPPP Sbjct: 105 PSQPPKEPALPSRGTPSLPSRPGSRPSVLNQEQVPPPPVRPNVMSQMPPPP 155 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.5 bits (68), Expect = 0.18 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 743 TPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPP 838 +PPP P PS PPPPPPP Sbjct: 166 SPPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 28.3 bits (60), Expect = 1.6 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 16/71 (22%) Frame = +2 Query: 707 GPXXXPXFXPXXTPPPXXGXPXPPXXPPP---PPSXXXXXPPPP-------------PPP 838 G P P TP P PP PPP P S P P PPP Sbjct: 216 GRAVSPEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPP 275 Query: 839 PXXXKXRPPPP 871 P P PP Sbjct: 276 PATPSQPPRPP 286 Score = 27.5 bits (58), Expect = 2.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 765 SPXPPXXXPPPPXXXXXXPPPPPPP 839 SP P P PPPPPPP Sbjct: 220 SPEIPPTYTPKQADPLPAPPPPPPP 244 Score = 27.1 bits (57), Expect(2) = 0.27 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 722 PXFXPXXTPPPXXGXPX---PPXXPPPPPS 802 P F P P P PP PPPPP+ Sbjct: 169 PSFQPPSAAAPATSLPSDYNPPPPPPPPPA 198 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 734 PXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 P + P P P PP + P PPP PPPP P Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPP------PPPPPP 197 Score = 22.2 bits (45), Expect(2) = 0.27 Identities = 13/48 (27%), Positives = 15/48 (31%) Frame = +2 Query: 785 PPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXPHQXRGRXSLXS 928 P PP+ P P PP PP P R +L S Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGS 268 >SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 31.1 bits (67), Expect = 0.23 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 819 PPPPPPPPXXXKXVPXPRP 875 PPPPPPPP P RP Sbjct: 370 PPPPPPPPELLNHSPKSRP 388 >SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 30.3 bits (65), Expect = 0.40 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 788 PPPPSXXXXXPPPPPPPPXXXKXRPPPP 871 PPPPS PP PPP P P Sbjct: 48 PPPPSVDHSAPPSGPPPSYSNSAAPATP 75 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 753 PXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVP 863 P P PPPP PP PPP P Sbjct: 36 PQWECPVRGLTIPPPPSVDHSAPPSGPPPSYSNSAAP 72 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 26.6 bits (56), Expect = 5.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +3 Query: 819 PPPPPPPP 842 PPPPPPPP Sbjct: 945 PPPPPPPP 952 Score = 26.6 bits (56), Expect(2) = 0.45 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 818 PPPPPPPP 841 PPPPPPPP Sbjct: 946 PPPPPPPP 953 Score = 21.8 bits (44), Expect(2) = 0.45 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 797 PSXXXXXPPPPPPP 838 P+ PPPPPP Sbjct: 899 PTIITHPTPPPPPP 912 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 29.1 bits (62), Expect = 0.93 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFXXXXPT 899 P PPP P PP PP P P P+ P PT Sbjct: 206 PPPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYPQAPQQPIVVAQPT 260 >SPAC1B3.14 |vma3||V-type ATPase subunit c|Schizosaccharomyces pombe|chr 1|||Manual Length = 161 Score = 27.9 bits (59), Expect = 2.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 151 PFFGVMGAASAIIFS 195 PFFGVMG +AI+F+ Sbjct: 11 PFFGVMGCTAAIVFA 25 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 792 PPPXXXXXXPPPPPPPPXXXKXVP 863 P P PPPPPP P VP Sbjct: 347 PTPQVQGSRPPPPPPMPAPIYNVP 370 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 27.9 bits (59), Expect = 2.2 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 785 PPPPPSXXXXXPPPP---PPPPXXXKXRPPPPXPXXKXXPHQ 901 PPPPP+ P PPPP + PP + P Q Sbjct: 908 PPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQ 949 Score = 26.2 bits (55), Expect = 6.6 Identities = 16/58 (27%), Positives = 17/58 (29%), Gaps = 4/58 (6%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPP----PPXXXKXVPXPRPPFXXXXP 896 P PP + P PPPP PP PP P P P P Sbjct: 908 PPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAPQSP 965 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 27.9 bits (59), Expect = 2.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 821 PPPPPPPXXXKXRPPPPXPXXKXXP 895 PPPPPP K PP P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPP 1906 Score = 25.8 bits (54), Expect = 8.7 Identities = 16/70 (22%), Positives = 18/70 (25%) Frame = +3 Query: 705 PAPXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVPXPRPPFX 884 P P + PP S PP P P P P P K P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVPLTGKETAVPLSSMP 1941 Query: 885 XXXPTXRGGA 914 P+ A Sbjct: 1942 NAPPSVASNA 1951 >SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 735 PXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPP 839 P PP S P P PPPPPP Sbjct: 211 PLNQPPSYAASTQPEFQQTTSPIFSSSSTPPPPPP 245 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 749 PPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKXXP 895 P P PP P P PP P P PP P P Sbjct: 569 PEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVP 617 Score = 26.6 bits (56), Expect = 5.0 Identities = 16/64 (25%), Positives = 17/64 (26%) Frame = +2 Query: 704 PGPXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXX 883 P P PP P P P PP + P P PP P P Sbjct: 563 PAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQR 622 Query: 884 KXXP 895 P Sbjct: 623 PAVP 626 Score = 26.6 bits (56), Expect = 5.0 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +2 Query: 749 PPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRP 862 P P PP P P + P PP PP P Sbjct: 674 PEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDETQEP 711 Score = 25.8 bits (54), Expect = 8.7 Identities = 14/45 (31%), Positives = 15/45 (33%), Gaps = 2/45 (4%) Frame = +2 Query: 749 PPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPP--PPXP 877 P P PP P P PP P P + P PP P Sbjct: 659 PEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLP 703 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 711 PXXXLXXXPXXPPPPXXXSPXPPXXXPPPPXXXXXXPPPPPPPPXXXKXVP 863 P L P P P P P PP P P P PP + VP Sbjct: 99 PEEPLPREPPLPNEPVPEEPLP--GEPPLPDEPVPEEPLPGEPPLPNEPVP 147 >SPBC2D10.04 |||arrestin Aly1 related|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 734 PXXTPPPXXGXPXPPXXPPPPPS 802 P PPP G PP PPP+ Sbjct: 578 PSTNPPPFDGDVCPPACNTPPPN 600 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 27.1 bits (57), Expect = 3.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 785 PPPPPSXXXXXPPPPPPPP 841 P S PPPPPPPP Sbjct: 295 PSSGDSANGGLPPPPPPPP 313 Score = 26.6 bits (56), Expect = 5.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +3 Query: 819 PPPPPPPP 842 PPPPPPPP Sbjct: 307 PPPPPPPP 314 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 761 GXPXPPXXPPPPPSXXXXXPPPPPPP 838 G P PP PPPPPS P P Sbjct: 304 GLPPPP--PPPPPSNDFWKDSNEPAP 327 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 26.6 bits (56), Expect = 5.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +3 Query: 819 PPPPPPPP 842 PPPPPPPP Sbjct: 1095 PPPPPPPP 1102 Score = 24.2 bits (50), Expect(2) = 4.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 818 PPPPPPPPXXXK 853 PPPPPPP K Sbjct: 1096 PPPPPPPAEVEK 1107 Score = 20.6 bits (41), Expect(2) = 4.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 797 PSXXXXXPPPPP 832 PS PPPPP Sbjct: 1091 PSAVPPPPPPPP 1102 >SPAC9.07c |||GTPase Rbg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 366 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 837 GGGGGGGXXXXXEGGGGGXXGGXGXPXXG 751 GGGGGGG G G G G P G Sbjct: 47 GGGGGGGLGFDVARTGIGTVGFIGFPSVG 75 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -3 Query: 840 GGGGGGGGXXXXXEGGGGGXXG-GXGXPXXGGGVXXG 733 GGG GG GG GG G G G GG G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSG 482 >SPBP8B7.31 |||acid phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 177 Score = 26.2 bits (55), Expect = 6.6 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 60 VCADSHHSFWXL*ILPHLTN--KMAENNPIYGXLLWSYGGXVCYH 188 V D ++ W L I H+T K ++N+P G L+ YG +C++ Sbjct: 11 VVFDLDYTLWPLWIDTHVTAPFKPSKNDP--GVLIDKYGTEICFY 53 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 26.2 bits (55), Expect = 6.6 Identities = 13/45 (28%), Positives = 14/45 (31%) Frame = +2 Query: 743 TPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXP 877 T P G P P PP+ PPPP P P Sbjct: 289 TSIPPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLP 333 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.8 bits (54), Expect = 8.7 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 710 PXXXPXFXPXXTPPPXXGXPXPPXXPPPPPSXXXXXPPPPPPPPXXXKXRPPPPXPXXKX 889 P P PP G P PP P PP PP P P P Sbjct: 487 PGTSAPLPPTTFAPP--GVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPA 544 Query: 890 XP 895 P Sbjct: 545 VP 546 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,688,025 Number of Sequences: 5004 Number of extensions: 55196 Number of successful extensions: 1310 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 471335896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -