BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K23 (869 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) 39 0.006 SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) 35 0.075 SB_18761| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_21938| Best HMM Match : Big_2 (HMM E-Value=0.69) 33 0.23 SB_33650| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_15141| Best HMM Match : RVT_1 (HMM E-Value=1.1) 33 0.30 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.40 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.70 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_57414| Best HMM Match : SIP1 (HMM E-Value=9.7) 31 1.2 SB_52599| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_48293| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) 31 1.2 SB_45196| Best HMM Match : DUF58 (HMM E-Value=8.6) 31 1.2 SB_37380| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=5.2) 31 1.2 SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) 31 1.2 SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_24755| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16247| Best HMM Match : Flu_B_NS1 (HMM E-Value=9.7) 31 1.2 SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 31 1.2 SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) 31 1.2 SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) 31 1.2 SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) 31 1.2 SB_52771| Best HMM Match : DUF58 (HMM E-Value=5.4) 31 1.2 SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) 31 1.2 SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) 31 1.2 SB_33099| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) 31 1.6 SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.6 SB_39616| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_30839| Best HMM Match : NOG1 (HMM E-Value=7) 31 1.6 SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) 31 1.6 SB_29567| Best HMM Match : Polysacc_deac_1 (HMM E-Value=7.7) 31 1.6 SB_24572| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_21218| Best HMM Match : C1_1 (HMM E-Value=3.6) 31 1.6 SB_20971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_18997| Best HMM Match : Fumerase_C (HMM E-Value=8.5) 31 1.6 SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) 31 1.6 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.6 SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) 31 1.6 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) 31 1.6 SB_31160| Best HMM Match : FeThRed_B (HMM E-Value=4.1) 31 1.6 SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) 31 1.6 SB_26374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) 31 1.6 SB_8813| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.9 SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37) 30 2.1 SB_3179| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) 30 2.1 SB_53706| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) 30 2.1 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) 30 2.8 SB_49730| Best HMM Match : DUF59 (HMM E-Value=8.9) 30 2.8 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_29079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_4753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_34292| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) 30 2.8 SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) 30 2.8 SB_2034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_27649| Best HMM Match : ResIII (HMM E-Value=0.43) 29 3.7 SB_15548| Best HMM Match : DUF385 (HMM E-Value=3.3) 29 3.7 SB_6828| Best HMM Match : Spo0M (HMM E-Value=9.6) 29 3.7 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_51168| Best HMM Match : Extensin_2 (HMM E-Value=1.3) 29 3.7 SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) 29 3.7 SB_41929| Best HMM Match : ResIII (HMM E-Value=1.5) 29 3.7 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 3.7 SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) 29 3.7 SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) 29 3.7 SB_50528| Best HMM Match : Flavi_propep (HMM E-Value=8.5) 29 4.9 SB_48491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_32374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_27892| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) 29 4.9 SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_44330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_37646| Best HMM Match : Cob_adeno_trans (HMM E-Value=6.9) 29 4.9 SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) 29 4.9 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_34044| Best HMM Match : PHZA_PHZB (HMM E-Value=5.4) 29 4.9 SB_33821| Best HMM Match : zf-MIZ (HMM E-Value=1.3e-29) 29 4.9 SB_29371| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) 29 4.9 SB_27882| Best HMM Match : Cob_adeno_trans (HMM E-Value=3.6) 29 4.9 SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) 29 4.9 SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 29 4.9 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 29 4.9 SB_1703| Best HMM Match : Extensin_2 (HMM E-Value=0.26) 29 4.9 SB_54018| Best HMM Match : OS-D (HMM E-Value=5.2) 29 6.5 SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 29 6.5 SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40544| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 6.5 SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 29 6.5 SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_19859| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 6.5 SB_18901| Best HMM Match : Cob_adeno_trans (HMM E-Value=4.1) 29 6.5 SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) 29 6.5 SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) 29 6.5 SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_2787| Best HMM Match : DUF1265 (HMM E-Value=3.2) 29 6.5 SB_2436| Best HMM Match : Orn_DAP_Arg_deC (HMM E-Value=6.9) 29 6.5 SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_55091| Best HMM Match : DUF1502 (HMM E-Value=1.8) 29 6.5 SB_54893| Best HMM Match : CheR (HMM E-Value=3.2) 29 6.5 SB_54646| Best HMM Match : WCCH (HMM E-Value=1.3) 29 6.5 SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) 29 6.5 SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) 29 6.5 SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) 29 6.5 SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_47766| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.3) 29 6.5 SB_46866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) 29 6.5 SB_45966| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 6.5 SB_44056| Best HMM Match : Fumerase_C (HMM E-Value=4.5) 29 6.5 SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_40128| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) 29 6.5 SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) 29 6.5 SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) 29 6.5 SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) 29 6.5 SB_27256| Best HMM Match : DUF1265 (HMM E-Value=3.2) 29 6.5 SB_25341| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_24706| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_23692| Best HMM Match : Ribosomal_S26e (HMM E-Value=3.3) 29 6.5 SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) 29 6.5 SB_18715| Best HMM Match : Orn_DAP_Arg_deC (HMM E-Value=3.2) 29 6.5 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 29 6.5 SB_16888| Best HMM Match : ResIII (HMM E-Value=2.6) 29 6.5 SB_16258| Best HMM Match : DUF917 (HMM E-Value=4.4) 29 6.5 SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) 29 6.5 SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) 29 6.5 SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 29 6.5 SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) 29 6.5 SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) 29 6.5 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_46840| Best HMM Match : S-methyl_trans (HMM E-Value=4.2) 28 8.6 SB_36734| Best HMM Match : SH2 (HMM E-Value=0.00043) 28 8.6 SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_4610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) 28 8.6 SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) 28 8.6 SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) 28 8.6 SB_17386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) 28 8.6 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_11172| Best HMM Match : LTXXQ (HMM E-Value=1.9) 28 8.6 SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) 28 8.6 SB_1442| Best HMM Match : SRCR (HMM E-Value=0) 28 8.6 >SB_52129| Best HMM Match : Sec23_trunk (HMM E-Value=0) Length = 942 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 1/97 (1%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + S S+ +P + F+P P+ + Q TPPS P S L P L + + Sbjct: 227 PLSSHSGSSPQPGSAFSPVNTPPNAQAQQMTPPSSAAPPQSLPGLQTSP-SLQPPSQRST 285 Query: 378 YQPQGSPSAHP-SPNSRGDRPRSCLHSRATPPAPPSW 485 PQ + H P G P + ++ P PP++ Sbjct: 286 PSPQSMSALHSGKPKRPGMPPSPSVPHQSQPAVPPAF 322 >SB_20395| Best HMM Match : Extensin_2 (HMM E-Value=0.019) Length = 348 Score = 35.1 bits (77), Expect = 0.075 Identities = 23/71 (32%), Positives = 31/71 (43%) Frame = +3 Query: 264 PSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRS 443 P S + PPS+ ++P T P P+D+A G Q Q P P P D P Sbjct: 96 PPVDSARARPPSQSQIPRWTAPKPDIPVDIARARSPRG-QEQDPPWTAPDP----DFPVY 150 Query: 444 CLHSRATPPAP 476 +R+ PP P Sbjct: 151 RAKARSPPPEP 161 >SB_18761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +1 Query: 325 FPWTDNPSTSPTSLTRTVTNPREAHLPTPHPIPEAIARAL--AYIRGPPPQP 474 F +T P T+ T+ P A +P P P+ E + + AYI PPP P Sbjct: 75 FLFTQEPEEEVTNTELTIEVPPLACVPFPPPLDEGMTEEVWRAYIMTPPPSP 126 >SB_21938| Best HMM Match : Big_2 (HMM E-Value=0.69) Length = 651 Score = 33.5 bits (73), Expect = 0.23 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 2/78 (2%) Frame = +3 Query: 276 STQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQP--QGSPSAHPSPNSRGDRPRSCL 449 S + PP+ P P G P D Y A G P GSP+ S N R ++ + Sbjct: 553 SRRQPPPAPYGSPYIPSPYPGSPYDTTYGASYGGGTPYGTGSPAMDGSGNPRRHMMKTEV 612 Query: 450 HSRATPPAPPSWKEKSSP 503 R T A S + SP Sbjct: 613 RHRVTKTASESDDIRGSP 630 >SB_33650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 521 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P AHP+ Sbjct: 385 DGWAIDRAFT-DETGYDPQWLPDAHPA 410 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 33.1 bits (72), Expect = 0.30 Identities = 29/88 (32%), Positives = 35/88 (39%), Gaps = 4/88 (4%) Frame = +3 Query: 189 RHHPWKATSSSTTRPATEFTPRLKVPSRTSTQNTPP----SKLRVPTSTLPLDGQPIDLA 356 RH T+S+ TR E TPR+ + T TQ P S TS P D QP + A Sbjct: 692 RHVNTAGTASADTRCQQELTPRVSASTHTHTQMEGPQESTSAQPAGTSAEP-DKQPAEQA 750 Query: 357 YVADENGYQPQGSPSAHPSPNSRGDRPR 440 A E P SP RP+ Sbjct: 751 --AQEPARTPSALAETITSPEPPATRPK 776 >SB_15141| Best HMM Match : RVT_1 (HMM E-Value=1.1) Length = 402 Score = 33.1 bits (72), Expect = 0.30 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = +3 Query: 177 QIQLRHHPWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLP 329 Q+ L +H W + T+PA+E+ P R + TPP +P P Sbjct: 120 QLHLANHQWSTINEGCTKPASEYDVTCSCPQR---ETTPPRPSELPFPCKP 167 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.7 bits (71), Expect = 0.40 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = +3 Query: 210 TSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQ 389 T ++TT+P T+ P+ PS T TPP+ P T P P+ + + + P Sbjct: 165 TETTTTKPETK-PPKPPAPSTIPTPPTPPAPPSPPIPTAP-PTPPMPETPLPPGSPHIPP 222 Query: 390 GS-----PSAHPSPNSRGDRPRSCLHSRATPPAPPS 482 P A P+P+ P + PPA P+ Sbjct: 223 APLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPN 258 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 31.9 bits (69), Expect = 0.70 Identities = 26/99 (26%), Positives = 39/99 (39%) Frame = +3 Query: 210 TSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQ 389 T S+ + P+T TPR PS T +TP + T + P L + Sbjct: 406 TPSTPSTPSTPITPR--TPSTPCTHSTPGTPSTPSTPSTPSTPSTPSLTHTPSTPSTPST 463 Query: 390 GSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSPT 506 S + PS S P S + +TP P + S+P+ Sbjct: 464 PSTPSTPSTPSTPSTP-STPSTPSTPSTPSTSSTPSTPS 501 Score = 29.9 bits (64), Expect = 2.8 Identities = 31/101 (30%), Positives = 43/101 (42%), Gaps = 2/101 (1%) Frame = +3 Query: 210 TSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQ 389 T S+ + P+T TPR PS ST TP ST PI + + Sbjct: 382 TPSTPSTPSTPSTPR--TPSTPSTPCTP--------STPSTPSTPITPRTPSTPCTHSTP 431 Query: 390 GSPS--AHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSPT 506 G+PS + PS S P S H+ +TP P + S+P+ Sbjct: 432 GTPSTPSTPSTPSTPSTP-SLTHTPSTPSTPSTPSTPSTPS 471 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 31.9 bits (69), Expect = 0.70 Identities = 28/100 (28%), Positives = 39/100 (39%), Gaps = 1/100 (1%) Frame = +3 Query: 207 ATSSSTTRPATEFTPRLKVPSRTSTQ-NTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQ 383 + SSST+RP P LK PS T Q TPP + P P Q + + Sbjct: 42 SASSSTSRPTNALQP-LKPPSNTPQQLTTPPHQSNTPRPLTPPSRQS------NNPRPHT 94 Query: 384 PQGSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 P S P P + R + A PP ++++P Sbjct: 95 PPSCQSNTPRPLTPPPRQSNTTQPPAYPPRQSYALQQTTP 134 >SB_3854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +3 Query: 321 TLPL--DGQPIDLAYVADENGYQPQGSPSAHPS 413 T+P+ DG ID A+ DE GY PQ P HP+ Sbjct: 309 TVPIGQDGAAIDRAFT-DETGYDPQWLPDDHPA 340 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 31.5 bits (68), Expect = 0.93 Identities = 22/72 (30%), Positives = 29/72 (40%) Frame = +3 Query: 273 TSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRSCLH 452 T +P K P+S P +YV N PS P+P+ D S Sbjct: 2459 TRVPKSPRPKQTTPSSANPSSAHHF-FSYVKTNNT-----GPSFKPAPSDE-DSDSSSQS 2511 Query: 453 SRATPPAPPSWK 488 + + PP PPSWK Sbjct: 2512 TPSPPPPPPSWK 2523 >SB_57414| Best HMM Match : SIP1 (HMM E-Value=9.7) Length = 333 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 265 DGAAIDRAFT-DETGYDPQWLPDDHPA 290 >SB_52599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 235 DGAAIDRAFT-DETGYDPQWLPDDHPA 260 >SB_48293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 450 DGAAIDRAFT-DETGYDPQWLPDDHPA 475 >SB_46990| Best HMM Match : Keratin_B2 (HMM E-Value=4.6) Length = 782 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 152 DGAAIDRAFT-DETGYDPQWLPDDHPA 177 >SB_45196| Best HMM Match : DUF58 (HMM E-Value=8.6) Length = 241 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 152 DGAAIDRAFT-DETGYDPQWLPDDHPA 177 >SB_37380| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=5.2) Length = 322 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 26 DGAAIDRAFT-DETGYDPQWLPDDHPA 51 >SB_36584| Best HMM Match : ResIII (HMM E-Value=0.95) Length = 1244 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 403 DGAAIDRAFT-DETGYDPQWLPDDHPA 428 >SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2286 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/74 (32%), Positives = 30/74 (40%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + +S R + P L P RT T PS+L P + D P+ A A Sbjct: 1635 PHQPCHTSEQRQRYQRPPALS-PQRTPTTTPSPSELGSPEKSPFADSDPVGPAAPARHPH 1693 Query: 378 YQPQGSPSAHPSPN 419 Y P S A P PN Sbjct: 1694 YSPAESACA-PLPN 1706 >SB_30355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 431 DGAAIDRAFT-DETGYDPQWLPDDHPA 456 >SB_29024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 998 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 621 DGADIDRAFT-DETGYDPQWLPDDHPA 646 >SB_24755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = +1 Query: 283 RIPRHRS*GCLQVHFPWTDNPSTSPTSLTRTVTNPR-----EAHLPTPHPIPEAIARA 441 RI R+ GCL+++ + S+SP + TR PR + L P P I +A Sbjct: 100 RISRYNQLGCLEIYINKNSDNSSSPLTRTRKTRTPRLYQLGQLELEPPSHFPPCIPQA 157 >SB_17591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 126 DGAAIDRAFT-DETGYDPQWLPDDHPA 151 >SB_16247| Best HMM Match : Flu_B_NS1 (HMM E-Value=9.7) Length = 556 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 354 DGAAIDRAFT-DETGYDPQWLPDDHPA 379 >SB_8103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 382 DGAAIDRAFT-DETGYDPQWLPDDHPA 407 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 31.1 bits (67), Expect = 1.2 Identities = 29/94 (30%), Positives = 37/94 (39%), Gaps = 1/94 (1%) Frame = +3 Query: 201 WKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGY 380 + TS S + + ++P S TS +P S PTS P +Y Y Sbjct: 519 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP---SYSPTSPSYSPTSPSY 575 Query: 381 QPQGSPSAHPSPNSRGDRPRSCLHS-RATPPAPP 479 P SPS PS S S H+ R TPP P Sbjct: 576 SPT-SPSYSPSSPSYSPSSPSFHHNLRPTPPPLP 608 Score = 30.7 bits (66), Expect = 1.6 Identities = 29/103 (28%), Positives = 40/103 (38%), Gaps = 1/103 (0%) Frame = +3 Query: 201 WKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGY 380 + TS S + + ++P S TS +P S PTS P +Y Y Sbjct: 505 YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP---SYSPTSPSYSPTSPSY 561 Query: 381 QPQGSPSAHP-SPNSRGDRPRSCLHSRATPPAPPSWKEKSSPT 506 P SPS P SP+ P S + P+ PS+ PT Sbjct: 562 SPT-SPSYSPTSPSYSPTSPSYSPSSPSYSPSSPSFHHNLRPT 603 >SB_366| Best HMM Match : ResIII (HMM E-Value=0.28) Length = 1104 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 430 DGAAIDRAFT-DETGYDPQWLPDDHPA 455 >SB_53861| Best HMM Match : LIM (HMM E-Value=0.93) Length = 968 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 308 DGAAIDRAFT-DETGYDPQWLPDDHPA 333 >SB_53507| Best HMM Match : DUF1610 (HMM E-Value=2) Length = 425 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 221 DGAAIDRAFT-DETGYDPQWLPDDHPA 246 >SB_52771| Best HMM Match : DUF58 (HMM E-Value=5.4) Length = 667 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 460 DGAAIDRAFT-DETGYDPQWLPDDHPA 485 >SB_47012| Best HMM Match : ScdA_N (HMM E-Value=5.3) Length = 840 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 384 DGAAIDRAFT-DETGYDPQWLPDDHPA 409 >SB_36328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1526 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 972 DGAAIDRAFT-DETGYDPQWLPDDHPA 997 >SB_36012| Best HMM Match : DUF755 (HMM E-Value=0.064) Length = 265 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +3 Query: 387 QGSPSAHPSPNSRGDRPRS-CLHSRATP---PAPPSWKEKSSPTC*DKSRQQHTATST 548 + P HPS + GDR R LH ++P P+PP ++ S+ K + +H +S+ Sbjct: 143 ESPPVRHPSGSQSGDRQRERRLHKHSSPSISPSPPRRQKYSNGQSDRKGKHRHRDSSS 200 >SB_33099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 66 DGAAIDRAFT-DETGYDPQWLPDDHPA 91 >SB_9087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 375 DGAAIDRAFT-DETGYDPQWLPDDHPA 400 >SB_3287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1030 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 326 DGAAIDRAFT-DETGYDPQWLPDDHPA 351 >SB_1431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1748 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 1053 DGAAIDRAFT-DETGYDPQWLPDDHPA 1078 >SB_53052| Best HMM Match : U79_P34 (HMM E-Value=2.7) Length = 1130 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 480 DGWAIDRAFT-DETGYDPQWLPDDHPA 505 >SB_53010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 426 DGWAIDRAFT-DETGYDPQWLPDDHPA 451 >SB_42721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 564 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G PQG P HP+ Sbjct: 315 DGAAIDRAFT-DETGCDPQGLPDDHPA 340 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/89 (28%), Positives = 34/89 (38%) Frame = +3 Query: 231 PATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHP 410 P+ + P P + PPS+ +VP PL GQ +A P + SA P Sbjct: 302 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQ---IAPPPPPISKPPTSTRSAPP 358 Query: 411 SPNSRGDRPRSCLHSRATPPAPPSWKEKS 497 P R +P PP PP + S Sbjct: 359 PPPGRAPQPLG-----GPPPPPPGRRPPS 382 Score = 29.1 bits (62), Expect = 4.9 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 1/103 (0%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + S + P + R +P+ +N PP +R PTS G+P +N Sbjct: 220 PGRGPSQRSLAPPPTGSSR-PLPAPPPGENRPPPPMRGPTS----GGEP-----PPPKNA 269 Query: 378 YQPQGSPSAH-PSPNSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 P S++ P P +RG P S + PP PPS + +P Sbjct: 270 PPPPKRGSSNPPPPPTRG--PPSNSFTTQGPPLPPSRDQAPAP 310 >SB_39616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 57 DGGAIDRAFT-DETGYDPQWLPDDHPA 82 >SB_30839| Best HMM Match : NOG1 (HMM E-Value=7) Length = 581 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 391 DGWAIDRAFT-DETGYDPQWLPDDHPA 416 >SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) Length = 739 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 136 DGWAIDRAFT-DETGYDPQWLPDDHPA 161 >SB_29567| Best HMM Match : Polysacc_deac_1 (HMM E-Value=7.7) Length = 760 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 431 DGWAIDRAFT-DETGYDPQWLPDDHPA 456 >SB_24572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1032 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 402 DGGAIDRAFT-DETGYDPQWLPDDHPA 427 >SB_21356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 362 DGWAIDRAFT-DETGYDPQWLPDDHPA 387 >SB_21218| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 352 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 57 DGWAIDRAFT-DETGYDPQWLPDDHPA 82 >SB_20971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 111 DGGAIDRAFT-DETGYDPQWLPDDHPA 136 >SB_18997| Best HMM Match : Fumerase_C (HMM E-Value=8.5) Length = 419 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 273 DGWAIDRAFT-DETGYDPQWLPDDHPA 298 >SB_14515| Best HMM Match : ScdA_N (HMM E-Value=6.1) Length = 609 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 431 DGWAIDRAFT-DETGYDPQWIPDDHPA 456 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/89 (28%), Positives = 34/89 (38%) Frame = +3 Query: 231 PATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHP 410 P+ + P P + PPS+ +VP PL GQ +A P + SA P Sbjct: 214 PSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQ---IAPPPPPISKPPTSTRSAPP 270 Query: 411 SPNSRGDRPRSCLHSRATPPAPPSWKEKS 497 P R +P PP PP + S Sbjct: 271 PPPGRAPQPLG-----GPPPPPPGRRPPS 294 Score = 29.1 bits (62), Expect = 4.9 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 1/103 (0%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + S + P + R +P+ +N PP +R PTS G+P +N Sbjct: 132 PGRGPSQRSLAPPPTGSSR-PLPAPPPGENRPPPPMRGPTS----GGEP-----PPPKNA 181 Query: 378 YQPQGSPSAH-PSPNSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 P S++ P P +RG P S + PP PPS + +P Sbjct: 182 PPPPKRGSSNPPPPPTRG--PPSNSFTTQGPPLPPSRDQAPAP 222 >SB_7382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1120 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 377 DGWAIDRAFT-DETGYDPQWLPDDHPA 402 >SB_59334| Best HMM Match : zf-AN1 (HMM E-Value=0.72) Length = 1161 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 396 DGWAIDRAFT-DETGYDPQWLPDDHPA 421 >SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 30.7 bits (66), Expect = 1.6 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 5/93 (5%) Frame = +3 Query: 270 RTSTQNTPPSKLRVPTSTLPLDGQ---PIDLAYVADENGYQPQGSPSAHPSP--NSRGDR 434 R S N PP R PL+G+ P N P ++P+P N R Sbjct: 251 RKSNPN-PPLNGRKSNPNPPLNGRKSNPNPPLNGRKSNPNPPHNGRKSNPNPPLNGRKSN 309 Query: 435 PRSCLHSRATPPAPPSWKEKSSPTC*DKSRQQH 533 P L+ R + P PP KS+P SR+ + Sbjct: 310 PNPPLNGRKSNPNPPHNGRKSNPNPPHNSRKSN 342 Score = 28.7 bits (61), Expect = 6.5 Identities = 26/90 (28%), Positives = 34/90 (37%), Gaps = 5/90 (5%) Frame = +3 Query: 249 PRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQ---PIDLAYVADENGYQPQGSPSAHPSP- 416 P + R S N PP R PL+G+ P N P ++P+P Sbjct: 277 PNPPLNGRKSNPN-PPHNGRKSNPNPPLNGRKSNPNPPLNGRKSNPNPPHNGRKSNPNPP 335 Query: 417 -NSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 NSR P L+ R + P PP K P Sbjct: 336 HNSRKSNPNPPLNGRKSNPNPPHNGPKVHP 365 Score = 28.3 bits (60), Expect = 8.6 Identities = 30/113 (26%), Positives = 42/113 (37%), Gaps = 7/113 (6%) Frame = +3 Query: 186 LRHHPWKATSSSTTRPAT--EFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQ---PID 350 LR +P S+ P + P + R S N PP R P +G+ P Sbjct: 243 LRSYPLNGRKSNPNPPLNGRKSNPNPPLNGRKSNPN-PPLNGRKSNPNPPHNGRKSNPNP 301 Query: 351 LAYVADENGYQPQGSPSAHPSP--NSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 N P ++P+P N R P +SR + P PP KS+P Sbjct: 302 PLNGRKSNPNPPLNGRKSNPNPPHNGRKSNPNPPHNSRKSNPNPPLNGRKSNP 354 >SB_55740| Best HMM Match : C1_1 (HMM E-Value=3.6) Length = 533 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 238 DGWAIDRAFT-DETGYDPQWLPDDHPA 263 >SB_31160| Best HMM Match : FeThRed_B (HMM E-Value=4.1) Length = 828 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G PQG P HP+ Sbjct: 315 DGAAIDRAFT-DETGCDPQGLPDDHPA 340 >SB_28120| Best HMM Match : ScdA_N (HMM E-Value=6.5) Length = 452 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 384 DGWAIDRAFT-DETGYDPQWLPDDHPA 409 >SB_26374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 160 DGGAIDRAFT-DETGYDPQWLPDDHPA 185 >SB_11212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1175 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 1117 DGWAIDRAFT-DETGYDPQWLPDDHPA 1142 >SB_2770| Best HMM Match : ResIII (HMM E-Value=2.2) Length = 928 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 250 DGWAIDRAFT-DETGYDPQWLPDDHPA 275 >SB_8813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 27.5 bits (58), Expect(2) = 1.9 Identities = 16/66 (24%), Positives = 28/66 (42%) Frame = +1 Query: 226 RDRQRNLRPG*RCRQERQLRIPRHRS*GCLQVHFPWTDNPSTSPTSLTRTVTNPREAHLP 405 R +L PG + R+ER + +++ LQ H +P SP + ++ R Sbjct: 639 RQGTNHLTPGYKPREERPISSSKNKDIRVLQDHGVVKKSPPPSPREMAKSRERSRSLRPE 698 Query: 406 TPHPIP 423 +P P Sbjct: 699 KKYPSP 704 Score = 21.4 bits (43), Expect(2) = 1.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 175 VKSSYDITPGRPLPVQLRDRQRNL 246 VKS Y GR LPV ++ R++ Sbjct: 591 VKSEYSRGLGRKLPVMEQEEYRDV 614 >SB_48939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ ADE G+ PQ P HP+ Sbjct: 274 DGWAIDRAF-ADETGHDPQWLPDDHPA 299 >SB_41458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 416 DGWAIDRAFT-DETGYYPQWLPDDHPA 441 >SB_31362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 30.3 bits (65), Expect = 2.1 Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 4/123 (3%) Frame = +3 Query: 195 HPWKATSSSTTRPATEFT-PRLKVPSRTSTQNTPPS--KLRVPTSTLPLDGQPIDLAYVA 365 +P SS +P + P+ PS N P S K P+S P P Sbjct: 124 NPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSNPKPNNPSSN-PKPNNPSSNPKPN 182 Query: 366 DENGYQPQGSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEK-SSPTC*DKSRQQHTAT 542 + + +PS++P PN+ P+S S P PS K ++P+ KS + Sbjct: 183 NPSSNPKPNNPSSNPKPNNPSSNPKSNNPSSNPKPNNPSSNPKPNNPSSNPKSNNPSSNP 242 Query: 543 STN 551 N Sbjct: 243 KPN 245 >SB_6033| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=1.6e-37) Length = 1052 Score = 30.3 bits (65), Expect = 2.1 Identities = 29/98 (29%), Positives = 40/98 (40%), Gaps = 1/98 (1%) Frame = +3 Query: 207 ATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQP 386 A S S + + +TP + TS +P S PTS P +Y + Y P Sbjct: 656 AASPSYSPASPSYTPASPSYTPTSPSYSPASPSYSPTSP---SYSPASPSYTSASPSYSP 712 Query: 387 QGSPSAHP-SPNSRGDRPRSCLHSRATPPAPPSWKEKS 497 SPS P SP+ P + S + PA PS+ S Sbjct: 713 -ASPSYSPTSPSYSPAIPSNSPASPSYSPASPSYTPAS 749 >SB_3179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ ADE G+ PQ P HP+ Sbjct: 187 DGWAIDRAF-ADETGHDPQWLPDDHPA 212 >SB_59126| Best HMM Match : zf-A20 (HMM E-Value=4.4) Length = 860 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ ADE G+ PQ P HP+ Sbjct: 477 DGWAIDRAF-ADETGHDPQWLPDDHPA 502 >SB_53706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 384 DGWAIDRAFT-DETGYDPQCLPDDHPA 409 >SB_42615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1130 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY PQ P HP+ Sbjct: 422 DGAAIDRAFT-DETGYDPQLLPDDHPA 447 >SB_2121| Best HMM Match : ResIII (HMM E-Value=0.46) Length = 1106 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ ADE G+ PQ P HP+ Sbjct: 370 DGWAIDRAF-ADETGHDPQWLPDDHPA 395 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 334 TDNPSTSPTSLTRTVTNPREAHLPTPHP 417 T NP ++P+ T ++NP P+PHP Sbjct: 456 TSNPISNPSISTSPISNPSPRPHPSPHP 483 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/74 (27%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Frame = +3 Query: 288 TPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRSCLHSRATP 467 T K P S + PI P +PS +PSPN D + + ++ Sbjct: 451 TAYQKTSNPISNPSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSD 510 Query: 468 PAP-PSWKEKSSPT 506 P+P PS S P+ Sbjct: 511 PSPNPSSNPSSEPS 524 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 340 NPSTSPTSLTRTVTNPREAHLPTPHP 417 NP ++P+ T ++NP + P+PHP Sbjct: 526 NPISNPSISTSPISNPHPSSNPSPHP 551 Score = 27.5 bits (58), Expect(2) = 2.5 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = +3 Query: 264 PSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPN 419 P+ +S ++ PS P S + PI + + P +PS+ PSPN Sbjct: 513 PNPSSNPSSEPSPN--PISNPSISTSPISNPHPSSNPSPHPSSNPSSEPSPN 562 Score = 21.0 bits (42), Expect(2) = 2.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 393 SPSAHPSPNSRGDRPRSCLHSRATPPAPPS 482 SPS PSPN + R+ + P P S Sbjct: 590 SPSVRPSPNLISNPNRNSNSNSNRNPNPSS 619 >SB_56393| Best HMM Match : CTF_NFI (HMM E-Value=0.75) Length = 886 Score = 29.9 bits (64), Expect = 2.8 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +3 Query: 201 WKATSSSTTRPATEFTPRLKVPSRTSTQNTP---PSKLRVPTSTLPLDGQPIDLAYVADE 371 W + S + P T T R V + ++ P PS + L+ Q + + A + Sbjct: 600 WSESHSKSADPPTG-TSRANVVTSNASVALPGMVPSSIENVNRKTNLNPQVAEPSEAA-Q 657 Query: 372 NGYQPQGSPSAHPSPNSRGDRPRSCLHSR 458 NG P P A P+P R D R+CL SR Sbjct: 658 NGSAP---PLAGPTPARRVDSVRACLRSR 683 >SB_49730| Best HMM Match : DUF59 (HMM E-Value=8.9) Length = 631 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID ++ DE GY PQ P HP+ Sbjct: 412 DGAAIDRSFT-DETGYDPQWLPDDHPA 437 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +1 Query: 328 PWTDNPSTSPTSLTRTVTNPREAHLPTP-HPIPEA 429 P T P T PT T T+T P A PTP P P A Sbjct: 76 PTTPTPKT-PTPTTSTLTKPTPATTPTPTKPTPTA 109 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 207 ATSSSTTRPATEF--TPRLKVPSRTSTQNTPPSKLRVPTSTLP 329 A + +T PAT TP K P+ T++ T P+ PT T P Sbjct: 63 APTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKP 105 >SB_32583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/89 (25%), Positives = 32/89 (35%), Gaps = 1/89 (1%) Frame = +3 Query: 186 LRHHPWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAY-V 362 LRHHP SSS+ P TP P PP+ PT + + P+ + Sbjct: 9 LRHHPPPPASSSSPTPCYGITPH---PLHRH-HLPPPATASPPTPCIVIISHPLHRHHPP 64 Query: 363 ADENGYQPQGSPSAHPSPNSRGDRPRSCL 449 + P HP P + P C+ Sbjct: 65 PPASSSFPHSLHRHHPPPPASSSSPTPCI 93 >SB_31182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1280 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 387 QGSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 + SP+ SP SRG RP ++P PS EKS P Sbjct: 531 RASPARGVSPASRGKRPAPPAPRTSSPVQKPSITEKSVP 569 >SB_29079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HPS Sbjct: 127 DGWAIDRAFT-DETGHDPQWLPDDHPS 152 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG +D A+ DE GY PQ P HP+ Sbjct: 108 DGWALDRAFT-DETGYDPQWLPDDHPA 133 >SB_4753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 596 Score = 29.9 bits (64), Expect = 2.8 Identities = 23/74 (31%), Positives = 30/74 (40%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + +S R ++ P L P RT T P +L P + D P+ A A Sbjct: 319 PHQPCHTSEQRQRSQRPPALS-PQRTPTTTPSPFELGSPEKSPFADSDPVGPAASARHPH 377 Query: 378 YQPQGSPSAHPSPN 419 Y P S A P PN Sbjct: 378 YSPAESACA-PLPN 390 >SB_34292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 868 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 328 PWTDNPSTSPTSLTRTVTNPREAHLPTPHPIPEAI 432 P T P+T+P ++T T LPT P+P+ + Sbjct: 49 PTTPPPTTAPANVTVNTTQSSGTTLPTVEPMPDIV 83 >SB_31796| Best HMM Match : SAP (HMM E-Value=3.5e-10) Length = 1029 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = +3 Query: 387 QGSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSP 503 Q PS + S + P +C+ S+ PP P K SSP Sbjct: 519 QQMPSPNTSIKQEPESPNTCIFSQQPPPQPAIKKVASSP 557 >SB_24250| Best HMM Match : ResIII (HMM E-Value=3.6) Length = 842 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID ++ DE GY PQ P HP+ Sbjct: 429 DGAAIDRSFT-DETGYDPQWLPDDHPA 454 >SB_2034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 29.9 bits (64), Expect = 2.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY P+ P HP+ Sbjct: 664 DGAAIDRAFT-DETGYDPEWLPDDHPA 689 >SB_27649| Best HMM Match : ResIII (HMM E-Value=0.43) Length = 802 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P+ HP+ Sbjct: 352 DGAAIDRAFT-DETGHDPQWLPNDHPA 377 >SB_15548| Best HMM Match : DUF385 (HMM E-Value=3.3) Length = 615 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID + DE GY PQ P HP+ Sbjct: 346 DGAAIDRTFT-DETGYDPQWLPDDHPA 371 >SB_6828| Best HMM Match : Spo0M (HMM E-Value=9.6) Length = 220 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG D A+ DE GY PQ P HP+ Sbjct: 179 DGAAFDRAFT-DETGYDPQWLPDDHPA 204 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +3 Query: 264 PSRTSTQNT-PPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSR 425 P R + +N PP+ R LP +GQ + + + P +PS SP SR Sbjct: 836 PRRATPENERPPADPRFTNRVLPEEGQEVMIDVTGCDVSAIPVSTPSTVQSPTSR 890 >SB_51168| Best HMM Match : Extensin_2 (HMM E-Value=1.3) Length = 288 Score = 29.5 bits (63), Expect = 3.7 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 4/97 (4%) Frame = +3 Query: 258 KVPSRTSTQNTPPS---KLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRG 428 K+P T+ + PP + R+PT T P P+D A P+ +P P ++R Sbjct: 42 KIPPWTAPEQDPPRGQHQSRIPTWTAPQQDPPVDSARARSPPWTAPEPNP---PVDSARA 98 Query: 429 DRPRSCLHSRATPPAPPSWKEKSSPTC*DKSR-QQHT 536 R S+ P P T + R Q+H+ Sbjct: 99 RSFRGQRQSKIPPWTAPEQDPSVESTRAESPRGQRHS 135 >SB_51131| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 738 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ D+ GY PQ P HP+ Sbjct: 227 DGWAIDRAFT-DDTGYDPQWLPDDHPA 252 >SB_41929| Best HMM Match : ResIII (HMM E-Value=1.5) Length = 773 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P+ HP+ Sbjct: 337 DGAAIDRAFT-DETGHDPQWLPNDHPA 362 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/71 (30%), Positives = 30/71 (42%) Frame = +3 Query: 264 PSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRS 443 PSR+S + PPS+ P ++ + P+ A P G P P P RP S Sbjct: 331 PSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA-APPPPPPPPVGGPPPPPPPIE--GRPPS 387 Query: 444 CLHSRATPPAP 476 L + PP P Sbjct: 388 SLGNPPPPPPP 398 >SB_30283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1417 Score = 29.5 bits (63), Expect = 3.7 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 4/79 (5%) Frame = +3 Query: 210 TSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPT-STLPLDGQPIDLAY--VADENGY 380 TS++ +P+ TP PS T + +P + P+ ST P+ P + + Sbjct: 1292 TSTTPIKPSPSTTPIKPSPSTTPIKPSPSTTPIKPSPSTTPIKPSPSTTSTTPIKPSPST 1351 Query: 381 QP-QGSPSAHPSPNSRGDR 434 P + SPS P + RGDR Sbjct: 1352 TPIKPSPSTTPGVHDRGDR 1370 >SB_20407| Best HMM Match : ResIII (HMM E-Value=0.36) Length = 1175 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID + DE GY PQ P HP+ Sbjct: 371 DGAAIDRTFT-DETGYDPQWLPDDHPA 396 >SB_19342| Best HMM Match : Keratin_B2 (HMM E-Value=0.41) Length = 1093 Score = 29.5 bits (63), Expect = 3.7 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = +3 Query: 327 PLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRSCL-HSRATP-PAPPSWKEKSS 500 P P + + Q + S PSPN+ ++ S HS P P+P + ++++ Sbjct: 952 PKQSDPPPMNTLKQAGTRQLESSKKGFPSPNNTINQAASSYPHSPKYPFPSPKNISKQTA 1011 Query: 501 PTC*DKSRQQHTATSTN 551 P+C D S +Q A S N Sbjct: 1012 PSCLD-SPKQAAAQSKN 1027 >SB_50528| Best HMM Match : Flavi_propep (HMM E-Value=8.5) Length = 358 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE GY P+ P HP+ Sbjct: 57 DGWAIDRAFT-DETGYDPKWLPDDHPA 82 >SB_48491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ +E GY PQ P HP+ Sbjct: 181 DGLAIDRAFT-EETGYDPQWLPDDHPA 206 >SB_45281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +3 Query: 177 QIQLRHHPWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTL--PLDGQP 344 ++++ HP A+ +S P E TP+ + P ST+ P + P +T P G P Sbjct: 1154 RLEVCGHPKAASIASAAEPTQEETPQ-ETPGDQSTEQGNPEVVETPPATAEEPQQGLP 1210 >SB_32374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 349 DGAAIDRAFT-DETGHDPQWLPDDHPA 374 >SB_31317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 387 DGAAIDRAFT-DETGHDPQWLPDDHPA 412 >SB_28107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ D+ GY PQ P HP+ Sbjct: 244 DGWAIDRAFT-DKTGYDPQWLPDDHPA 269 >SB_27892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1441 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/69 (30%), Positives = 28/69 (40%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENG 377 P + +S R ++ P L P RT T PS+L P + D P+ A A Sbjct: 1325 PHQPCHTSEQRQRSQRPPALS-PQRTPTTTPSPSELGSPEKSPFADSDPVGPAAPARHPH 1383 Query: 378 YQPQGSPSA 404 Y P S A Sbjct: 1384 YSPAESVCA 1392 >SB_24603| Best HMM Match : GatB_Yqey (HMM E-Value=0.7) Length = 984 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ +DE G+ PQ P HP+ Sbjct: 186 DGWAIDRAF-SDETGHDPQWLPDDHPA 211 >SB_50233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 967 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 432 DGAAIDRAFT-DETGHDPQWLPDDHPA 457 >SB_44330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 570 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ +E GY PQ P HP+ Sbjct: 403 DGLAIDRAFT-EETGYDPQWLPDDHPA 428 >SB_37646| Best HMM Match : Cob_adeno_trans (HMM E-Value=6.9) Length = 497 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 429 DGAAIDRAFT-DETGHDPQWLPDDHPA 454 >SB_35740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPSPNSRGDRPRS 443 DG ID A+ DE G+ PQ P HP+ D S Sbjct: 354 DGWAIDRAFT-DETGHDPQWLPDDHPAYQEYTDATHS 389 >SB_34841| Best HMM Match : ResIII (HMM E-Value=1.6) Length = 949 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P+ HP+ Sbjct: 389 DGWAIDRAFT-DETGHDPQWLPNDHPA 414 >SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2492 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 2161 DGAAIDRAFT-DETGHDPQWLPDDHPA 2186 >SB_34044| Best HMM Match : PHZA_PHZB (HMM E-Value=5.4) Length = 514 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 410 DGAAIDRAFT-DETGHDPQWLPDDHPA 435 >SB_33821| Best HMM Match : zf-MIZ (HMM E-Value=1.3e-29) Length = 1202 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 307 GCLQVHFPWTDNPSTSPTSLTRTVTNPREAHLPTPH 414 G Q H P ++ PS S + T+P HLPTP+ Sbjct: 1064 GGTQEHGPGSNQPSDKIHSPATSHTSPVSTHLPTPN 1099 >SB_29371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 432 DGAAIDRAFT-DETGHDPQWLPDDHPA 457 >SB_28214| Best HMM Match : Drf_FH1 (HMM E-Value=3.8) Length = 361 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNT-PPSK 302 P KATS T PAT T P+ ST+ T PPS+ Sbjct: 19 PSKATSPKPTAPATRPTSTSTKPTTASTKPTSPPSQ 54 >SB_27882| Best HMM Match : Cob_adeno_trans (HMM E-Value=3.6) Length = 822 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 394 DGAAIDRAFT-DETGHDPQWLPDDHPA 419 >SB_16070| Best HMM Match : IncA (HMM E-Value=0.43) Length = 895 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 +G ID A+ DE GY PQ P HP+ Sbjct: 57 EGWAIDRAFT-DETGYDPQWLPDDHPA 82 >SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 659 Score = 29.1 bits (62), Expect = 4.9 Identities = 27/116 (23%), Positives = 47/116 (40%) Frame = +3 Query: 204 KATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQ 383 +A +SSTT P T P+ +T P + V +T Q + V D Q Sbjct: 322 QAQTSSTTGPTTSTQPQTSSTVGPTTPTQPQTSSTVGPTT---STQTQASSTVGDTTSTQ 378 Query: 384 PQGSPSAHPSPNSRGDRPRSCLHSRATPPAPPSWKEKSSPTC*DKSRQQHTATSTN 551 Q S + + +++ + H+ +T P S S+ T + S +T +T+ Sbjct: 379 TQTSSTVGHTTSTQPQTSSAVDHTTSTQPQTSSTTGSSTLTQPETSSTSNTGPTTS 434 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 285 NTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSP 416 NTPP + P T P +GQP L + NG P +P + P Sbjct: 320 NTPPFNGQPPYYTPPFNGQP--LYHTPPFNGQPPYNTPPFNGQP 361 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 285 NTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPN 419 +TPP + P +T P +GQP L + NG P +P + P+ Sbjct: 342 HTPPFNGQPPYNTPPFNGQP--LYHTPPFNGQPPYNTPPFNGQPS 384 >SB_1703| Best HMM Match : Extensin_2 (HMM E-Value=0.26) Length = 307 Score = 29.1 bits (62), Expect = 4.9 Identities = 22/85 (25%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +3 Query: 249 PRLKVPSRTSTQNTPPSK--LRVPTSTLPLDGQPIDLAYVADENGYQ-----PQGSPSAH 407 P+ + P ++ +P + ++PT T P P+D A G P +P Sbjct: 143 PQQETPVESARARSPRGQHQSQIPTWTAPQQDPPVDSARARSPRGQHHSKKPPWKAPEQD 202 Query: 408 PSPNS-RGDRPRSCLHSRATPPAPP 479 P +S R PR HS+ P P Sbjct: 203 PPVDSTRAKSPRGQRHSKIPPWTAP 227 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = +3 Query: 258 KVPSRTSTQNTPPS---KLRVPTSTLPLDGQPIDLAYVADENGYQPQGSP 398 K+P T+ + PP + R+PT T P P+D A P+ +P Sbjct: 42 KIPPWTAPEQDPPRGQHQSRIPTWTAPQQDPPVDSARARSPPWTAPEPNP 91 >SB_54018| Best HMM Match : OS-D (HMM E-Value=5.2) Length = 671 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 424 DGWAIDRAFT-DETGHDPQWLPDDHPA 449 >SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 287 Score = 28.7 bits (61), Expect = 6.5 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 14/126 (11%) Frame = +3 Query: 171 SGQIQLRHHPW-KATSSSTTRPATEFT---PRLKVPSRTSTQNTPPSKLRVPTSTLPLDG 338 SG++ LR+ + +A + +T P ++ P + P R T N+ PS PT + PL G Sbjct: 138 SGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPERQPTLNSSPSP---PTGSGPLTG 194 Query: 339 QP---IDLAY-----VADE-NGYQPQGSPSAHPSPNSRGDR-PRSCLHSRATPPAPPSWK 488 P L++ + E N P P A P ++ + P S A+ AP Sbjct: 195 NPHVTTQLSHGSHPVIPTECNQTVPPAEPVAETPPTTQANNDPVSSCMPDASSQAPQPLP 254 Query: 489 EKSSPT 506 E PT Sbjct: 255 EPRRPT 260 >SB_42714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 273 DGWAIDRAFT-DETGHDPQRLPDDHPA 298 >SB_40544| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 520 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 187 DGWAIDRAFT-DETGHDPQWLPDDHPA 212 >SB_37849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1213 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 374 DGWAIDRAFT-DETGHDPQWLPDDHPA 399 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 28.7 bits (61), Expect = 6.5 Identities = 28/110 (25%), Positives = 43/110 (39%), Gaps = 2/110 (1%) Frame = +3 Query: 252 RLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNSRGD 431 RL+ S +S +T S L +P G P +AY G P G P P + Sbjct: 414 RLRTDSMSSVSST--SSLGGAAGIMP--GIPGQMAYPGTSQGMMPSGGPQTVPEEPA--- 466 Query: 432 RPRSCLHSRATPPAPPSWKEKSS--PTC*DKSRQQHTATSTNETDIMXEI 575 PR PP W +S+ P + ++ TA + +T+ + I Sbjct: 467 EPRELTPKDIYGVNPPHWCTESTNLPCIYSEVAEKATADGSLDTNRLYPI 516 >SB_22559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 944 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 335 DGWAIDRAFT-DETGHDPQWLPDDHPA 360 >SB_19859| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 373 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 264 DGWAIDRAFT-DETGHDPQWLPDDHPA 289 >SB_18901| Best HMM Match : Cob_adeno_trans (HMM E-Value=4.1) Length = 191 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 123 DGWAIDRAFT-DETGHDPQWLPEDHPA 148 >SB_17486| Best HMM Match : CheR (HMM E-Value=3.2) Length = 1177 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 426 DGWAIDRAFT-DETGHDPQWLPDDHPA 451 >SB_15632| Best HMM Match : CBM_5_12 (HMM E-Value=2.9) Length = 748 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 412 DGWAIDRAFT-DETGHDPQWLPDDHPA 437 >SB_10218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 744 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 432 DGWAIDRAFT-DETGHDPQWLPDDHPA 457 >SB_5900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1023 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 326 DGWAIDRAFT-DETGHDPQWLPDDHPA 351 >SB_4087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 412 DGWAIDRAFT-DETGHDPQWLPDDHPA 437 >SB_2787| Best HMM Match : DUF1265 (HMM E-Value=3.2) Length = 795 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 379 DGWAIDRAFT-DETGHDPQWLPDDHPA 404 >SB_2436| Best HMM Match : Orn_DAP_Arg_deC (HMM E-Value=6.9) Length = 467 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 267 DGWAIDRAFT-DETGHDPQWLPDDHPA 292 >SB_59553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1003 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 187 DGWAIDKAFT-DETGHDPQWLPDDHPA 212 >SB_55091| Best HMM Match : DUF1502 (HMM E-Value=1.8) Length = 315 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 187 DGWAIDRAFT-DETGHDPQWLPDDHPA 212 >SB_54893| Best HMM Match : CheR (HMM E-Value=3.2) Length = 537 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 426 DGWAIDRAFT-DETGHDPQWLPDDHPA 451 >SB_54646| Best HMM Match : WCCH (HMM E-Value=1.3) Length = 744 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 475 DGWAIDRAFT-DETGHDPQWLPDDHPA 500 >SB_53226| Best HMM Match : ResIII (HMM E-Value=0.45) Length = 880 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 291 DGWAIDRAFT-DETGHDPQWLPDDHPA 316 >SB_53156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 371 DGWAIDRAFT-DETGHDPQWLPDDHPA 396 >SB_49508| Best HMM Match : ResIII (HMM E-Value=1.3) Length = 666 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 247 DGWAIDRAFT-DETGHDPQWLPDDHPA 272 >SB_48412| Best HMM Match : ResIII (HMM E-Value=0.19) Length = 1390 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 547 DGWAIDRAFT-DETGHDPQWLPDDHPA 572 >SB_48295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 426 DGWAIDRAFT-DETGHDPQWLPDDHPA 451 >SB_47766| Best HMM Match : Ribosomal_L27 (HMM E-Value=2.3) Length = 596 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 188 DGWAIDRAFT-DETGHNPQWLPDDHPA 213 >SB_46866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 248 DGWAIDRAFT-DETGHDPQWLPDDHPA 273 >SB_46041| Best HMM Match : LIM (HMM E-Value=1.5) Length = 1236 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 414 DGWAIDRAFT-DETGHDPQWLPDDHPA 439 >SB_45966| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 237 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 169 DGWAIDRAFT-DETGHDPQWLPDDHPA 194 >SB_44056| Best HMM Match : Fumerase_C (HMM E-Value=4.5) Length = 438 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 127 DGWAIDRAFT-DETGHDPQWLPDDHPA 152 >SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = +3 Query: 204 KATSSSTTRPAT---EFTPRLKVPSRTSTQNTPPSKLRVPTSTLP 329 +A S+STT+P T E T ++ VP+ TS PPS + TS P Sbjct: 103 QAPSTSTTKPITNQPESTAKVAVPT-TSPAPPPPSTVTSTTSKPP 146 >SB_40128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG D A+ DE GY PQ P HP+ Sbjct: 199 DGGATDRAFT-DETGYDPQWLPDDHPA 224 >SB_39663| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1143 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 356 DGWAIDRAFT-DETGHNPQWLPDDHPA 381 >SB_35959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 412 DGWAIDRAFT-DETGHDPQWLPDDHPA 437 >SB_31859| Best HMM Match : DUF1131 (HMM E-Value=4.3) Length = 455 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 57 DGWAIDRAFT-DETGHDPQWLPDDHPA 82 >SB_30246| Best HMM Match : IspA (HMM E-Value=0.39) Length = 1502 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 939 DGWAIDRAFT-DETGHDPQWLPDDHPA 964 >SB_27311| Best HMM Match : DEAD (HMM E-Value=0.17) Length = 1178 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 331 DGWAIDRAFT-DETGHDPQWLPDDHPA 356 >SB_27256| Best HMM Match : DUF1265 (HMM E-Value=3.2) Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 49 DGWAIDRAFT-DETGHDPQWLPDDHPA 74 >SB_25341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 661 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 501 DGWAIDRAFT-DETGHDPQWLPDDHPA 526 >SB_24707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 921 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 421 DGWAIDRAFT-DETGHDPQWLPDDHPA 446 >SB_24706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 335 DGWAIDRAFT-DETGHDPQWLPDDHPA 360 >SB_23692| Best HMM Match : Ribosomal_S26e (HMM E-Value=3.3) Length = 572 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 383 DGWAIDRAFT-DETGHDPQWLPDDHPA 408 >SB_22388| Best HMM Match : Extensin_2 (HMM E-Value=0.086) Length = 724 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = +3 Query: 201 WKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSK----LRVPTSTLPLDGQPIDLAYVAD 368 W+ S TTR P ++ SRT T T P + +P +L D I V Sbjct: 7 WRTCSMPTTRHNECSVPGNRIRSRTDTNITAPKHPEPYMSIPAQSLVQDECHIHCGTVRK 66 Query: 369 ENGY 380 EN Y Sbjct: 67 ENKY 70 >SB_18715| Best HMM Match : Orn_DAP_Arg_deC (HMM E-Value=3.2) Length = 314 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 273 DGWAIDRAFT-DETGHDPQWLPDDHPA 298 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 385 PREAHLPTPHPIPEAIARALAYIRGPPPQP--LRRGKKSRRQLVRISQDNN 531 P + P P P +R L Y R P +P L RGKK RRQ S +++ Sbjct: 1232 PEQVKSDAPSP-PVNASRDLPYYREYPTKPKDLYRGKKPRRQRPSSSSESS 1281 >SB_16888| Best HMM Match : ResIII (HMM E-Value=2.6) Length = 811 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 162 DGWAIDRAFT-DETGHDPQWLPDDHPA 187 >SB_16258| Best HMM Match : DUF917 (HMM E-Value=4.4) Length = 667 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 425 DGWAIDRAFT-DETGHDPQWLPDDHPA 450 >SB_11642| Best HMM Match : LIM (HMM E-Value=1.4) Length = 906 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 273 DGWAIDRAFT-DETGHDPQWLPDDHPA 298 >SB_7073| Best HMM Match : ResIII (HMM E-Value=0.083) Length = 1105 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 375 DGWAIDRAFT-DETGHDPQWLPDDHPA 400 >SB_6689| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 514 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 354 DGWAIDRAFT-DETGHDPQWLPDDHPA 379 >SB_5505| Best HMM Match : ResIII (HMM E-Value=0.55) Length = 1346 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 424 DGWAIDRAFT-DETGHDPQWLPDDHPA 449 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 1215 DGWAIDRAFT-DETGHDPQWLPDDHPA 1240 >SB_4780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 799 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ DE G+ PQ P HP+ Sbjct: 408 DGWAIDRAFT-DETGHDPQWLPDDHPA 433 >SB_1224| Best HMM Match : bZIP_1 (HMM E-Value=8e-10) Length = 496 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 193 ITPGRPLPVQLRDRQRNLRPG*RCRQERQLRI 288 +TP L + +R RQRN + RCR++R+ R+ Sbjct: 282 LTPAEELKI-IRRRQRNKQAASRCREKRRQRL 312 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Frame = +3 Query: 177 QIQLRHHPWKATSS-STTRPATEFTPRLKVPSRTSTQNTP----PSKLRVPTSTLPLDGQ 341 Q HH +S ST +P+T T + ++ +T N P P+ + T+TLP Q Sbjct: 159 QHSTEHHSTSGVASPSTKQPSTALTTTKQPTTQQTTTNLPSTRQPTTNQQTTTTLPSTKQ 218 Query: 342 P 344 P Sbjct: 219 P 219 >SB_46840| Best HMM Match : S-methyl_trans (HMM E-Value=4.2) Length = 774 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ D GY PQ P HP+ Sbjct: 400 DGVAIDRAFT-DATGYDPQWLPDDHPA 425 >SB_36734| Best HMM Match : SH2 (HMM E-Value=0.00043) Length = 661 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +3 Query: 246 TPRLKV-PSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAYVADENGYQPQGSPSAHPSPNS 422 TPR++ P S NTP + P T +D + + + + N P +P+ + SP++ Sbjct: 539 TPRMRTTPVAMSESNTPYTPGATPL-TSDMDANQLLMQLIGNRN-IAP--NPNMYASPST 594 Query: 423 RGDRPRS 443 RGD+ S Sbjct: 595 RGDQQGS 601 >SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 213 SSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTST 323 +++TT AT TP + +T NTP + PT+T Sbjct: 169 TTTTTPTATTTTPTATTTTPNTTTNTPNATTTTPTAT 205 >SB_4610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 230 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ +E GY P+ P HP+ Sbjct: 83 DGAAIDRAFT-EETGYDPKWPPDDHPA 108 >SB_53291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 28.3 bits (60), Expect = 8.6 Identities = 31/121 (25%), Positives = 48/121 (39%), Gaps = 9/121 (7%) Frame = +3 Query: 171 SGQIQLRHHPW-KATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQP- 344 SG++ LR+ + +A + +T P ++ P Q T S PT + PL G P Sbjct: 528 SGRLTLRNRRFLRAYTPATPTPDHQYRTPPPPPRSPECQPTLNSSPSPPTGSGPLTGNPH 587 Query: 345 --IDLAY----VADENGYQPQGSPSAHPSPNSRGDR-PRSCLHSRATPPAPPSWKEKSSP 503 L++ + N P P A P ++ + P S A+ AP E P Sbjct: 588 VTTQLSHGSHPATECNQTVPPAEPVAETPPTTQANNDPVSSCMPDASSQAPQPLPEPRRP 647 Query: 504 T 506 T Sbjct: 648 T 648 >SB_39579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 330 LDGQPIDLAYVADENGYQPQGSPSAHPS 413 L G P DE GY PQ P HP+ Sbjct: 52 LQGAPPKAPAFTDETGYDPQWLPDDHPA 79 >SB_32459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2011 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +1 Query: 328 PWTDNPSTSPTSLTRTVTNPR 390 P T +P TSPTS TRT + P+ Sbjct: 228 PSTRDPDTSPTSSTRTSSTPQ 248 >SB_30029| Best HMM Match : Extensin_2 (HMM E-Value=0.45) Length = 622 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Frame = +1 Query: 322 HFPWTDNP-----STSPTSLTRTVTNPREAHLPTPHPIPEAIARALAYIRGPPPQP 474 HFPW N S + +S++ ++ + P P P + + + Y PP QP Sbjct: 271 HFPWLPNRYQTSISQTNSSISPAISRTQNPASPMPPRRPSYMGQNIQYPTTPPQQP 326 >SB_21674| Best HMM Match : LIM (HMM E-Value=0.44) Length = 885 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A + +E GY PQ P HP+ Sbjct: 254 DGWAIDRA-LTEETGYDPQWLPDDHPA 279 >SB_19979| Best HMM Match : Mo-co_dimer (HMM E-Value=6) Length = 551 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A + DE G+ PQ P HP+ Sbjct: 234 DGAAIDRA-LTDETGHDPQWLPDDHPA 259 >SB_17386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG +D A+ D+ GY PQ P HP+ Sbjct: 56 DGAAMDRAFT-DKTGYNPQWLPDDHPA 81 >SB_15115| Best HMM Match : ResIII (HMM E-Value=0.24) Length = 1179 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 333 DGQPIDLAYVADENGYQPQGSPSAHPS 413 DG ID A+ ADE G+ P P HP+ Sbjct: 368 DGWAIDRAF-ADETGHDPSWLPDDHPA 393 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 339 QPIDLAYVADENGYQPQGSPSAHPS-PNSRGDRPRSCLHSRATPPAPPSWKEK 494 QPID+A + P+G+P S P+ + + PP P W+E+ Sbjct: 139 QPIDIASRVQPSAPTPEGTPVLVQSLPDVEEPSASARSSAEQPPPLPEGWEER 191 >SB_11172| Best HMM Match : LTXXQ (HMM E-Value=1.9) Length = 142 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 198 PWKATSSSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPID 350 PW + SS +RP T PR + R S PS+ R S + +D Sbjct: 6 PWDESESSGSRPGTRLPPR-RSTLRVSHLRDTPSQRRARNSAPMMANSVVD 55 >SB_9846| Best HMM Match : DUF605 (HMM E-Value=0.046) Length = 811 Score = 28.3 bits (60), Expect = 8.6 Identities = 24/94 (25%), Positives = 37/94 (39%), Gaps = 2/94 (2%) Frame = +3 Query: 207 ATSSSTTRPATEFTPRLKVPSRTSTQNTPPS--KLRVPTSTLPLDGQPIDLAYVADENGY 380 A++ PA+ P+ PS N P S K P+S P P + + Sbjct: 506 ASNPKPNNPASN--PKPNNPSSNPKPNNPSSNPKPNNPSSN-PKPNNPASNPKPNNPSSN 562 Query: 381 QPQGSPSAHPSPNSRGDRPRSCLHSRATPPAPPS 482 +P+++P PN+ P+S S P PS Sbjct: 563 PKPNNPASNPKPNNPSSNPKSNNPSSNPKPNNPS 596 >SB_1442| Best HMM Match : SRCR (HMM E-Value=0) Length = 2103 Score = 28.3 bits (60), Expect = 8.6 Identities = 22/92 (23%), Positives = 34/92 (36%), Gaps = 2/92 (2%) Frame = +3 Query: 216 SSTTRPATEFTPRLKVPSRTSTQNTPPSKLRVPTSTLPLDGQPIDLAY--VADENGYQPQ 389 ++T P T P TS P+ L PT+T+P +A+ +A + P Sbjct: 256 TTTKAPTTTIAPTSTTELPTSFTKVVPTSLLEPTTTIPTSATRSSMAHTSIAPTSSLAPT 315 Query: 390 GSPSAHPSPNSRGDRPRSCLHSRATPPAPPSW 485 S + S P + R T PS+ Sbjct: 316 SSLAPTSSVGPTTSPPPEPIFVRLTGVDHPSF 347 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,225,773 Number of Sequences: 59808 Number of extensions: 412529 Number of successful extensions: 2729 Number of sequences better than 10.0: 189 Number of HSP's better than 10.0 without gapping: 2212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2639 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2491217872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -