BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K21 (867 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21330| Best HMM Match : JmjC (HMM E-Value=0.0054) 30 2.1 SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.8 SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) 29 3.7 SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_51778| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=0.31) 28 8.6 SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_20561| Best HMM Match : 7tm_1 (HMM E-Value=0.2) 28 8.6 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_21330| Best HMM Match : JmjC (HMM E-Value=0.0054) Length = 304 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +3 Query: 141 HIKSKNVDAVFVEKQKKILSFFQDVSQLNTDD-EYYKIGKD---YDIEM 275 +I + ++A +EK K++L FF + N +D EY I + Y +EM Sbjct: 226 YILKEEIEAFSIEKMKEVLLFFDPIDVSNMEDFEYSHINAEDIMYSLEM 274 >SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/64 (31%), Positives = 31/64 (48%) Frame = -2 Query: 611 VNFLQHFHIHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHTRKTGTLVERFK 432 VN +Q F + ++ +SR+ + +R DN D EG+ E T T G L + F Sbjct: 658 VNDIQDFAFSNNMKLNPAKSRHQAFIPLRCKDNGDREGMFEAT-----TTPGGVLCKNFW 712 Query: 431 VLSV 420 V +V Sbjct: 713 VKAV 716 >SB_25189| Best HMM Match : Drf_FH1 (HMM E-Value=4.1) Length = 570 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 264 HSLCQFYNIHHQCLVGSHLGRRTEFSFAFQQIRHPHFLTLCARFWY 127 H LC + + ++ L +L + + A Q H H+ T CA W+ Sbjct: 329 HKLCYYVALQYRSLC-HYLLHKLCYCVALQYCSHCHYYTSCATVWH 373 >SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +3 Query: 303 AVEEFLKMYRTGFMPKNLEFSVFYDKMRDEAIALFHLFYYAKDFETFYKSACFARVHLNQ 482 A++E MY+TG + + F + K+ D F +F E Y+S C VHL++ Sbjct: 372 ALKELWSMYQTGELKRR--FQEAFAKISDGQEIKFSVFID----ENEYRSICLNLVHLSR 425 Query: 483 GQFL 494 +F+ Sbjct: 426 AEFV 429 >SB_51778| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=0.31) Length = 239 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 697 CKRSSRFPL*MPYLAAASGLMRPCCIFV 614 CKR S P M YL A G+ CIF+ Sbjct: 27 CKRWSSVPSPMMYLIAVQGIFSVICIFL 54 >SB_21351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 234 HQCLVGSHLGRRTEFSFAFQQIRHPHFLTLCAR 136 + CL SH+ + F +Q R H T+C R Sbjct: 417 YNCLSSSHISSKCTSKFRCRQCRGKHHTTICER 449 >SB_20561| Best HMM Match : 7tm_1 (HMM E-Value=0.2) Length = 310 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -3 Query: 697 CKRSSRFPL*MPYLAAASGLMRPCCIFV 614 CKR S P M YL A G+ CIF+ Sbjct: 27 CKRWSSVPSPMMYLIAVQGIFSVICIFL 54 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 282 PYSFRYHSLCQF-YNIHHQCLVGSHLGRRTEFSFAFQQIRHP 160 P+S+R C+F +H+ CL +H + EF + + P Sbjct: 68 PFSYRNKVFCRFDAAVHYDCLYVTHKKKHVEFRWLHIEFLQP 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,191,542 Number of Sequences: 59808 Number of extensions: 482976 Number of successful extensions: 1079 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1008 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1079 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -