BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K20 (837 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 29 0.18 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 26 1.2 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 26 1.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.6 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 5.0 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 5.0 AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein ... 24 6.6 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 8.7 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 8.7 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.1 bits (62), Expect = 0.18 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +2 Query: 146 DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 268 D A QH+ RP+RS + NP GR H C+SRR Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 26.2 bits (55), Expect = 1.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 320 NGDATVLFVLTRVSETGLSGSRTSND 243 +GD T L +T ++E+G+ S TS D Sbjct: 194 SGDETDLDAITTLAESGIPSSNTSGD 219 Score = 25.0 bits (52), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 244 SLLVREPERPVSLTRVRTNKTVASPLNLRPSLCSSSL 354 S L + PER SLT++ + + AS L S SS+L Sbjct: 666 SNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTL 702 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 26.2 bits (55), Expect = 1.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 320 NGDATVLFVLTRVSETGLSGSRTSND 243 +GD T L +T ++E+G+ S TS D Sbjct: 195 SGDETDLDAITTLAESGIPSSNTSGD 220 Score = 25.0 bits (52), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +1 Query: 244 SLLVREPERPVSLTRVRTNKTVASPLNLRPSLCSSSL 354 S L + PER SLT++ + + AS L S SS+L Sbjct: 667 SNLPKIPERKSSLTKLNRSNSTASNGTLERSYSSSTL 703 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 433 SIKLIKKPFSLFSRWSGFVMNTKSFSSSSKNIEMAVDL 320 +++L+KKP SL S W + N ++A+ L Sbjct: 156 TVRLLKKPPSLDSEWKSSTSTIQLIEQLDSNKQLAIAL 193 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 8 FXTTHYRESLRFESVRHCWRMVVGLIEQ 91 F H R +FESV+ W+ V ++++ Sbjct: 477 FVAQHVRNKDKFESVKEDWKYVALVLDR 504 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 24.2 bits (50), Expect = 5.0 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -3 Query: 589 NRIGLMRSAIA*RSTVSVCTHTPDTQSTTTRAPSVTRSA 473 N +GL RS A S SV P + T RAP +A Sbjct: 3 NALGLTRSMSADTSKTSVGKQLPASGIPTLRAPMAAGNA 41 >AF164152-1|AAD47076.1| 261|Anopheles gambiae ribosomal protein L8 protein. Length = 261 Score = 23.8 bits (49), Expect = 6.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 541 SVCTHTPDTQSTTTRAPS 488 SV H PDT+ T + PS Sbjct: 135 SVIAHNPDTKRTRVKLPS 152 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 161 EYPQHVCDRPRRSRQVNPHGLVGFQG 238 ++P HVC+R R+ +N +V G Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.4 bits (48), Expect = 8.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 550 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST-CPGES 431 +TV+ T T +TTT AP+ T + A +T PG++ Sbjct: 34 TTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQT 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 874,179 Number of Sequences: 2352 Number of extensions: 18113 Number of successful extensions: 40 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -