BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K18 (906 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 31 0.012 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 28 0.12 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 31.1 bits (67), Expect = 0.012 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 Query: 477 RERINGGMFXYAFTAACFHRTDCKGLYL 560 R+R+N +F YAF+ A HR D + L L Sbjct: 115 RDRVNPYLFYYAFSVALLHRPDTQNLDL 142 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 27.9 bits (59), Expect = 0.12 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 471 WMRERINGGMFXYAFTAACFHRTDCKGLYL 560 + R+R+N +F YA + A HR D + + L Sbjct: 113 YARDRVNPYLFSYALSVAILHRQDTQDIDL 142 Score = 25.0 bits (52), Expect = 0.81 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 254 KEIAKEYNIEKSCDKYMNVDVVKQFMEMYKMGMLPRGETFV 376 ++I YN E+ C+K F E K P+ ++ V Sbjct: 237 QQIIARYNFERLCNKLKRATRFNDFNEAIKEAYFPKLDSLV 277 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,456 Number of Sequences: 336 Number of extensions: 2736 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25237652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -