BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K18 (906 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0204 - 19022329-19023990 30 2.9 04_04_0577 + 26349205-26349669,26350384-26350482,26350887-263510... 29 5.1 11_06_0198 - 21158350-21159528 28 8.9 >05_04_0204 - 19022329-19023990 Length = 553 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 278 IEKSCDKYMNVDVVKQFMEMYKMGMLPRGETF 373 + K CD++ + VVK F +M K G+ P TF Sbjct: 355 MRKLCDEHRWLSVVKLFTDMAKKGIAPNSWTF 386 >04_04_0577 + 26349205-26349669,26350384-26350482,26350887-26351064, 26351900-26352087,26352335-26352373 Length = 322 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/81 (24%), Positives = 36/81 (44%) Frame = +2 Query: 149 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNVDVVKQF 328 +F + + L K +E L +++ T F D+ ++ ++Y +K N DVV Sbjct: 160 IFLLKSLDELFQKGREAVDFPALQELMEKTGF-DMDDVVRKYIRYTLNEKPFNPDVVVDL 218 Query: 329 MEMYKMGMLPRGETFVHTNEL 391 + + K ML E NE+ Sbjct: 219 IHLRKASMLEDAEVAEILNEI 239 >11_06_0198 - 21158350-21159528 Length = 392 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 570 GGGXGRDPCSRFCGSTRQ*KRRXTCLR 490 GGG G D C R C R+ R C+R Sbjct: 345 GGGHGGDHCRRQCQHHREWHERQRCMR 371 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,270,241 Number of Sequences: 37544 Number of extensions: 338869 Number of successful extensions: 678 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -