BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K17 (871 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97189-4|AAC48167.3| 2322|Caenorhabditis elegans Suppressor with... 29 5.7 U97189-3|AAT68901.1| 2019|Caenorhabditis elegans Suppressor with... 29 5.7 AF149821-1|AAD48773.1| 2322|Caenorhabditis elegans nonsense-medi... 29 5.7 >U97189-4|AAC48167.3| 2322|Caenorhabditis elegans Suppressor with morphological effecton genitalia protein 1, isoform a protein. Length = 2322 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +1 Query: 541 LTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRXCRLPDTCPPFSPSGSVALSHS 720 LT K++ V D+ RF + + R L D FS G++ALS Sbjct: 1032 LTKFEKLNNTVNEKRQVVDWSARERFQFVESAFSQTMRRTELLDIQKDFSAMGALALSAD 1091 Query: 721 SRCXYLSSV 747 S C S + Sbjct: 1092 SSCKLYSDI 1100 >U97189-3|AAT68901.1| 2019|Caenorhabditis elegans Suppressor with morphological effecton genitalia protein 1, isoform b protein. Length = 2019 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +1 Query: 541 LTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRXCRLPDTCPPFSPSGSVALSHS 720 LT K++ V D+ RF + + R L D FS G++ALS Sbjct: 1032 LTKFEKLNNTVNEKRQVVDWSARERFQFVESAFSQTMRRTELLDIQKDFSAMGALALSAD 1091 Query: 721 SRCXYLSSV 747 S C S + Sbjct: 1092 SSCKLYSDI 1100 >AF149821-1|AAD48773.1| 2322|Caenorhabditis elegans nonsense-mediated mRNA decay proteinSMG-1 protein. Length = 2322 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +1 Query: 541 LTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRXCRLPDTCPPFSPSGSVALSHS 720 LT K++ V D+ RF + + R L D FS G++ALS Sbjct: 1032 LTKFEKLNNTVNEKRQVVDWSARERFQFVESAFSQTMRRTELLDIQKDFSAMGALALSAD 1091 Query: 721 SRCXYLSSV 747 S C S + Sbjct: 1092 SSCKLYSDI 1100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,991,046 Number of Sequences: 27780 Number of extensions: 373423 Number of successful extensions: 992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 991 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2181923744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -