BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K16 (902 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003385-5|AAB54245.1| 494|Caenorhabditis elegans Hypothetical ... 31 1.1 AF016688-6|AAB66074.2| 274|Caenorhabditis elegans Hypothetical ... 28 7.9 >AF003385-5|AAB54245.1| 494|Caenorhabditis elegans Hypothetical protein R08F11.3 protein. Length = 494 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 632 WKAPSCAPPGSEPWPLYRDTLFRLFSLPG 718 WK + PPG P PL+ +TL LF +PG Sbjct: 22 WKRRNL-PPGPTPLPLFGNTLPTLFDIPG 49 >AF016688-6|AAB66074.2| 274|Caenorhabditis elegans Hypothetical protein F18A12.2 protein. Length = 274 Score = 28.3 bits (60), Expect = 7.9 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +1 Query: 526 FSIGSAPPDEHHKNRRSSQRWRKPDRTIKIPGVSPLESSLVRSSWFRTLAALPGYPVPP 702 FS + + K + +KP T+K P +P ESS +S TLA P PP Sbjct: 206 FSTNATTSSQTTKPKLIYNEMKKPRTTLK-PSTAPPESSKAPASTGTTLATNPTITGPP 263 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,043,816 Number of Sequences: 27780 Number of extensions: 385369 Number of successful extensions: 1116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2297313942 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -