BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K13 (864 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 24 1.3 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 3.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.4 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 24.2 bits (50), Expect = 1.3 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -2 Query: 371 ATVIFGILYSLTSFVTVPTTTAIKPSRVGFF---MWRAKRDTEIGGRLIRLIKSRRR 210 +T I I + + VTV T A+K S++ F M R + G I ++ +RR Sbjct: 76 STAILEIAFEVIFIVTVWMTGAVKHSKIAHFLNKMIRLDERFQSVGLQIDTVREKRR 132 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.0 bits (47), Expect = 3.1 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -2 Query: 359 FGILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRDT--EIGGRLIRLIKSRRRTI 204 F I Y VT+ T A + + G F+W + D E G L+K+ + I Sbjct: 322 FWIGYDNEQSVTIKTEYAKEKNLAGVFIWSIETDDMHEFCGEKNGLLKAVNKAI 375 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 640 HTPXPPXPXXPPXP 681 H P PP PP P Sbjct: 1375 HPPIPPTSEKPPLP 1388 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -1 Query: 303 QTLTSWLLHVARQTRHRDWW 244 QTL WL H DW+ Sbjct: 658 QTLAMWLNHNPNYAEVTDWY 677 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,059 Number of Sequences: 336 Number of extensions: 4021 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -