BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K13 (864 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 8e-42 SB_49884| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 29 4.9 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.5 SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 167 bits (407), Expect = 8e-42 Identities = 88/174 (50%), Positives = 111/174 (63%), Gaps = 5/174 (2%) Frame = +1 Query: 91 KHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLA 270 KH +K R E SQ++ TNAKFNQIV++RL MSR RPP+S++RL Sbjct: 115 KHPKKNYRREPVSQNVYIRLLVKLYRFLSRRTNAKFNQIVMKRLCMSRTKRPPLSLARLV 174 Query: 271 RHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLA 450 R MK + I VVVG++T+D R++++P + + AL +E ARARIL AGGEILTFDQLA Sbjct: 175 RKMKASGHKDKICVVVGSITDDKRIFEVPALKICALRFSETARARILKAGGEILTFDQLA 234 Query: 451 LRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTK-----PYVRTKGHEKAR 597 LRAP G+ TVL+QG R AREA RH G APG P S T Y+ T G + R Sbjct: 235 LRAPLGQNTVLLQGPRKAREAERHMGLAPGVPHSDTNWCGDLDYIGTDGDAQCR 288 >SB_49884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 462 RSTKSQLIKSKNFSSSSQNACTSFFGNMKSSHRHLRY 352 R+ +S L+ S+N ++QNA T+FF + K H + Y Sbjct: 16 RANESTLLTSENNDIANQNADTAFFTSKKKRHNNNSY 52 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 386 VT*RAATVIFGILYSLTSFVTVPTTTAIKPSR 291 +T R T++FGIL L + TT IKP R Sbjct: 616 ITLRPITILFGILALLLNLFVFVTTVGIKPLR 647 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +1 Query: 259 SRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTF 438 SRL MK PT++G+ V V+ + +T A E+ RAR+L G + Sbjct: 92 SRLYEEMKHPTQDGMFVAVNSEVSVTFVGKEKEDVTFAKCAWFER-RARMLKGFGFVTFR 150 Query: 439 DQLALRAPTGKKTVLVQGQ 495 D + + KK ++ G+ Sbjct: 151 DPATIESVLAKKPHILDGK 169 >SB_29576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1202 Score = 28.3 bits (60), Expect = 8.5 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +1 Query: 421 GEILTFDQLALRAPTGKKTVLVQGQRNAREAVRHFGPAPGAPRS 552 GE+++ D++ +A + Q N EA R F P PG P S Sbjct: 614 GEMMSDDEMKPKARCKRSQSTPIHQENREEAHRPFTPQPGRPLS 657 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 365 RWLLFMLPKKLVHAFWLLEEKFLLLISWLFVLRLARRQYW 484 RWL ++ + L H WL ++L +SWL+ +R W Sbjct: 19 RWLNYV--RWLYHVRWLYHVRWLYHVSWLYHVRWLYHVRW 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,359,076 Number of Sequences: 59808 Number of extensions: 525907 Number of successful extensions: 1490 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1482 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2467263854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -