BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K13 (864 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 191 6e-49 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 184 5e-47 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 153 1e-37 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 31 0.75 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.99 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 3.0 At2g04330.1 68415.m00429 hypothetical protein contains Pfam prof... 29 3.0 At5g35794.1 68418.m04297 hypothetical protein contains Pfam prof... 29 4.0 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 29 4.0 At2g23480.1 68415.m02803 hypothetical protein contains Pfam prof... 29 4.0 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 28 7.0 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 28 7.0 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 28 7.0 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 28 7.0 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 28 9.2 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 191 bits (465), Expect = 6e-49 Identities = 94/173 (54%), Positives = 124/173 (71%), Gaps = 2/173 (1%) Frame = +1 Query: 100 RKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLARHM 279 +K +RT KS D+ TN+KFN ++L+RLFMS++N+ P+S+SRL M Sbjct: 12 KKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAPLSLSRLVEFM 71 Query: 280 KKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRA 459 +E IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRA Sbjct: 72 TG--KEDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRA 129 Query: 460 PTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGH--EKARPSRRA 612 P G+ TVL++G +N+REAV+HFGPAPG P SH+KPYVR KG EKAR R++ Sbjct: 130 PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRAKGRKFEKARGKRKS 182 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 184 bits (449), Expect = 5e-47 Identities = 91/173 (52%), Positives = 123/173 (71%), Gaps = 2/173 (1%) Frame = +1 Query: 100 RKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPPISVSRLARHM 279 +K +RT KS D+ +N+ FN ++L+RLFMS++N+ P+S+SRL M Sbjct: 12 KKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKAPLSLSRLVEFM 71 Query: 280 KKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRA 459 ++ IAV+VGT+T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRA Sbjct: 72 TG--KDDKIAVLVGTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRA 129 Query: 460 PTGKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKGH--EKARPSRRA 612 P G+ TVL++G +N+REAV+HFGPAPG P S+TKPYVR KG EKAR R++ Sbjct: 130 PLGQNTVLLRGPKNSREAVKHFGPAPGVPHSNTKPYVRHKGRKFEKARGKRKS 182 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 153 bits (372), Expect = 1e-37 Identities = 79/132 (59%), Positives = 98/132 (74%), Gaps = 3/132 (2%) Frame = +1 Query: 226 MSRINRPPISVSRLARHMKKPTREGLIAVVVGTVTNDVRLYKIPKMTVAALHVTEKARAR 405 MS++N+ P+S+SRL R+M ++G IAV+VGTVT+DVR+ +P +TV AL TE ARAR Sbjct: 1 MSKVNKAPLSLSRLVRYMDG--KDGKIAVIVGTVTDDVRIEDVPALTVTALRFTESARAR 58 Query: 406 ILAAGGEILTFDQLALRAPT-GKKTVLVQGQRNAREAVRHFGPAPGAPRSHTKPYVRTKG 582 I AGGE LTFDQLAL PT + TVL++G +N REAV+HFGPAPG P SHTKPYVR G Sbjct: 59 IHKAGGECLTFDQLALPCPTWSENTVLLRGPKNTREAVKHFGPAPGVPHSHTKPYVRQTG 118 Query: 583 H--EKARPSRRA 612 E AR RR+ Sbjct: 119 KKIEIARGRRRS 130 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 31.5 bits (68), Expect = 0.75 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 529 GQSDALPHEHFADLVPVLSSCQSEHEEPADQ 437 G S LPH +PV SSC E +P DQ Sbjct: 223 GDSSFLPHREMDGSIPVYSSCFFESTKPEDQ 253 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.99 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 372 CSSCYRKSSCTHFGCWRRNSYF 437 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 424 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 516 E L FD L L+ P+GK LV G + + V Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTV 320 >At2g04330.1 68415.m00429 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 564 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -2 Query: 353 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRDTEIGGRLIRLIKSR 216 +LY LTS + VPT T + S + F RA D I ++ R Sbjct: 347 VLYFLTSSIVVPTKTGERASPIDDFCVRAASDLTFSFEAIPSLRER 392 >At5g35794.1 68418.m04297 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 662 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 353 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 258 +LY LTS + VPT T + S + F RA D Sbjct: 377 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 408 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -2 Query: 356 GILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 258 G+LY LTS + V T T K S V F RA D Sbjct: 101 GVLYFLTSIIVVLTKTGEKGSPVDNFCLRAASD 133 >At2g23480.1 68415.m02803 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 705 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -2 Query: 353 ILYSLTSFVTVPTTTAIKPSRVGFFMWRAKRD 258 +LY LTS + VPT T + S + F RA D Sbjct: 440 VLYFLTSIIAVPTKTGERASPIDDFCVRAASD 471 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 436 FDQLALRAPTGKKTVLVQGQRNAREAV 516 FD L LR P+GK LV G + + V Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTV 382 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 436 FDQLALRAPTGKKTVLVQGQRNAREAV 516 FD L LR P+GK LV G + + V Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTV 391 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 336 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGSSCS 461 R+ + +E GGC+SC KS T C R+ + S G+ CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -1 Query: 513 CLTSISLTLYQYCLLASRSTKSQLIKSKNFSSSSQNACTSF 391 CL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 71 CLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 199 NQIVLRRLFMSRINRPPISVSRLARHMKKPTREGLI 306 +Q V + S INRPP+ + H R+GL+ Sbjct: 34 SQTVHSHAYHSGINRPPVETKPVTEHKSFTRRDGLL 69 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,694,022 Number of Sequences: 28952 Number of extensions: 372513 Number of successful extensions: 1088 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2019160800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -