BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K12 (1257 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 39 0.002 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 38 0.002 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 38 0.004 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 34 0.036 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 34 0.036 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 32 0.14 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 32 0.14 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 31 0.25 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 29 1.0 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 29 1.8 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 28 2.4 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 28 3.1 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 26 9.5 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 26 9.5 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 38.7 bits (86), Expect = 0.002 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 305 PXXPPXPPPXPPXXXPPXXPPPPXP 379 P P PPP PP PP PPPP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 30.3 bits (65), Expect = 0.58 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 312 PXXXXPPPPXXXXPPXXXPPPXPXPPP 392 P PPPP PP PP P PPP Sbjct: 5 PPGNPPPPPP---PPGFEPPSQPPPPP 28 Score = 29.9 bits (64), Expect = 0.77 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 314 PPXPPPXPPXXXPPXXPPPPXPXXPXXP 397 PP PP PP PP PP P P P Sbjct: 5 PPGNPPPPPP--PPGFEPPSQPPPPPPP 30 Score = 29.9 bits (64), Expect = 0.77 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 105 PPXXPXPXPXXPXXXPXXXXPPPP 176 PP P P P P P PPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 29.5 bits (63), Expect = 1.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 312 PXXXXPPPPXXXXPPXXXPPPXPXP 386 P PPPP P PPP P P Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 3.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 163 PPPPXXXXXXPXXXPXPXPPP 225 PPPP P P P PPP Sbjct: 10 PPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +3 Query: 150 PXXXXPPPPXXXXXPXXXPXPXXPP 224 P PPPP P P P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 37.9 bits (84), Expect = 0.003 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +2 Query: 164 PPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPPX 343 PPPP P P P P PPP PP PP PPP Sbjct: 732 PPPPPPAVIV---PTPAPAPIPVPPPAPIMGGPP----------------PPPPPPGVAG 772 Query: 344 XXPPXXPPPP 373 PP PPPP Sbjct: 773 AGPPPPPPPP 782 Score = 33.1 bits (72), Expect = 0.083 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 233 PPPXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXP 388 PPP P P PPP PP PPPP P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 30.3 bits (65), Expect = 0.58 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 327 PPPPXXXXPPXXXPPPXPXPPP 392 PPPP P P P P PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPP 754 Score = 30.3 bits (65), Expect(2) = 0.002 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 327 PPPPXXXXPPXXXPPPXPXPPP 392 PPPP PPP P PPP Sbjct: 762 PPPPPPPGVAGAGPPPPPPPPP 783 Score = 29.9 bits (64), Expect = 0.77 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = +1 Query: 103 PPPXPPXXXPXXPXXXXXXXPPPPXXXXXXPXXXPXP-----XPPPXXP 234 PPP PP P PPP P P P PPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 29.9 bits (64), Expect = 0.77 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 106 PPXPPXXXPXXPXXXXXXXPPPPXXXXXXPXXXPXPXPPP 225 P P P P PPPP P P PPP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 323 PPPXPPXXXPPXXPPPPXPXXPXXP 397 PPP PP P P P P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAP 756 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPP 223 P P P P PPPP P P P PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 28.7 bits (61), Expect = 1.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 103 PPPXPPXXXPXXPXXXXXXXPPPPXXXXXXPXXXPXPXPP 222 P P P P P PPPP P P PP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 312 PXXXXPPPPXXXXPPXXXPPPXPXPPP 392 P PPPP PP P PPP Sbjct: 756 PIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 27.1 bits (57), Expect(2) = 0.002 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 102 PPPXXPXPXPXXPXXXPXXXXPPPPXXXXXPXXXPXP 212 PPP P P P PP P P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 27.1 bits (57), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 45 PXXXPXPXXXXXXXXXXXXPPPXXPXPXPXXPXXXPXXXXPPPP 176 P P P PPP P P P P PPPP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPP--PPPPPGVAGAGPPPPPPPPP 783 Score = 26.6 bits (56), Expect = 7.2 Identities = 13/46 (28%), Positives = 13/46 (28%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPP 241 PPP P P PP P P P PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP 778 Score = 26.2 bits (55), Expect = 9.5 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +2 Query: 722 PLGPPWXILXPXTFFXPXPWPPXGXXXFWGPXGXXAPPXLT---PPPXKXFPXPPXA 883 P PP ++ P P P PP GP PP + PPP P PP A Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPA-PIMGGPPPPPPPPGVAGAGPPPP---PPPPPA 784 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 37.5 bits (83), Expect = 0.004 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 3/100 (3%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXX--PPXXXPPPXXXXXXPPXXXXX 280 PP P P PP P P P P PP P PP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Query: 281 XXXXXXXXPXXPPXPPPXPPXXXP-PXXPPPPXPXXPXXP 397 P PP P PP P PP P P P Sbjct: 1200 VPKPSVGVPPVPP-PSTAPPVPTPSAGLPPVPVPTAKAPP 1238 Score = 35.9 bits (79), Expect = 0.012 Identities = 25/100 (25%), Positives = 25/100 (25%), Gaps = 6/100 (6%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXP------XXPPXXXPPPXXXXXXPPX 268 PP P P PP P P P P P PP PP Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPV 1161 Query: 269 XXXXXXXXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXP 388 P P P P PP PP P P Sbjct: 1162 PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVP 1201 Score = 34.3 bits (75), Expect = 0.036 Identities = 27/101 (26%), Positives = 27/101 (26%), Gaps = 4/101 (3%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXX 286 PP P P PP P P P P P P PP Sbjct: 1131 PPVPVPSGAPPVPKPSVAAPPVPAPSGAP---PVPKPSVAAPPVPAPSSGIPPVPKPAAG 1187 Query: 287 XXXXXXPXX-PPXPPPX---PPXXXPPXXPPPPXPXXPXXP 397 P PP P P PP P PP P P P Sbjct: 1188 VPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Score = 32.7 bits (71), Expect = 0.11 Identities = 25/97 (25%), Positives = 25/97 (25%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXX 286 PP P P PP P P P P P P P PP Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAP---PVPKPSVAAPP------V 1133 Query: 287 XXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXPXXP 397 P P PP P PP P P P Sbjct: 1134 PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPP 1170 Score = 29.9 bits (64), Expect = 0.77 Identities = 22/89 (24%), Positives = 22/89 (24%), Gaps = 2/89 (2%) Frame = +2 Query: 107 PPXPXXXXXXXPXX-PXXXXPPPPXPXXXXXXXPXPXX-PPXXXPPPXXXXXXPPXXXXX 280 PP P P P PP P P P P PP P PP Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Query: 281 XXXXXXXXPXXPPXPPPXPPXXXPPXXPP 367 P P PP P P Sbjct: 1219 VPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 29.1 bits (62), Expect = 1.3 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 1/98 (1%) Frame = +2 Query: 107 PPXPXXXXXXXPXX-PXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXX 283 PP P P P PP P P P P P PP P Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAP---PVPI--PTSTPPVPKSSSGAPSAPPPV 1066 Query: 284 XXXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXPXXP 397 P P P PP P PP P P P Sbjct: 1067 PAPSSEIPSIPA-PSGAPPVPAPSGIPPVPKPSVAAPP 1103 Score = 27.5 bits (58), Expect = 4.1 Identities = 21/94 (22%), Positives = 21/94 (22%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXX 286 PP P P PP P P P P P P Sbjct: 1032 PPIPVPSTAPPVPIPTST-PPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSG 1090 Query: 287 XXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXP 388 P P P P PP P P P Sbjct: 1091 IPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVP 1124 Score = 27.5 bits (58), Expect = 4.1 Identities = 25/97 (25%), Positives = 25/97 (25%), Gaps = 5/97 (5%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXX 283 P P P PPP P P P PP PP Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPA--PSGAPPVPAPSGIPPVPKPSV 1099 Query: 284 XXXXXXXP--XXPPXPPP--XPPXXXPPXXPPP-PXP 379 P PP P P PP P PP P P Sbjct: 1100 AAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Score = 27.1 bits (57), Expect = 5.4 Identities = 20/98 (20%), Positives = 20/98 (20%) Frame = +1 Query: 103 PPPXPPXXXPXXPXXXXXXXPPPPXXXXXXPXXXPXPXPPPXXPXXXXXXXXPXXXXXXP 282 PP P P P P P P P PP P P Sbjct: 1150 PPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPP 1209 Query: 283 XXXXXXXXXXPXXXXPXPPXXXPPPXXXPPPPXXPXXP 396 P PP P P P P Sbjct: 1210 VPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 34.3 bits (75), Expect = 0.036 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -1 Query: 351 GXXXGGXGGGXGGXXGXXXXXXXXXXXXXGGXXXXXXGGGXXXGGXXGXGXXXXXXXGXG 172 G GG GG GG G G GG GG G G G G Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGG--GPGGFEGGPGGFG 241 Query: 171 GGGXXXXGXXGXXXXXXXGXGGG 103 GG G G G GGG Sbjct: 242 GGPGGFGGGLGGFGGGPGGFGGG 264 Score = 31.9 bits (69), Expect = 0.19 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 396 GXXGXXGXGGGGXXGGXXXGGXGGGXGGXXG 304 G G G G GG GG GG GGG GG G Sbjct: 221 GGHGGFGGGPGGFEGGP--GGFGGGPGGFGG 249 Score = 31.9 bits (69), Expect = 0.19 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 396 GXXGXXGXGGGGXXGGXXXGGXGGGXGGXXG 304 G G G G GG GG GG GGG GG G Sbjct: 235 GGPGGFGGGPGGFGGGL--GGFGGGPGGFGG 263 Score = 31.5 bits (68), Expect = 0.25 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 396 GXXGXXGXGGGGXXG-GXXXGGXGGGXGGXXG 304 G G G GGG G G GG GGG GG G Sbjct: 239 GFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGG 270 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 34.3 bits (75), Expect = 0.036 Identities = 25/102 (24%), Positives = 25/102 (24%), Gaps = 4/102 (3%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXP----PPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXX 271 PPP P P P P P P P PP PP Sbjct: 376 PPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSA 435 Query: 272 XXXXXXXXXXXPXXPPXPPPXPPXXXPPXXPPPPXPXXPXXP 397 P PP P PP PP P P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPP 477 Score = 34.3 bits (75), Expect = 0.036 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 164 PPPPXPXXXXXXXPXPXXPPXXXPP-PXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPP 340 PP P P P P PP P P PP P P PP PP Sbjct: 415 PPVPTPPSLPPSAP-PSLPPSAPPSLPMGAPAAPPLPPSAPIAPPL--PAGMPAAPPLPP 471 Query: 341 XXXPPXXPPPPXPXXP 388 P P P P P Sbjct: 472 AAPAPPPAPAPAPAAP 487 Score = 28.3 bits (60), Expect = 2.4 Identities = 23/96 (23%), Positives = 23/96 (23%), Gaps = 5/96 (5%) Frame = +2 Query: 107 PPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXP--PXXXPPPXXXXXXPPXXXXX 280 PP P P PP P P P PPP P Sbjct: 271 PPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNG 330 Query: 281 XXXXXXXXPXXPPXPPPXPPXXXPP---XXPPPPXP 379 P PP PP PPPP P Sbjct: 331 SSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 317 PXPPPXPPXXXPPXXPPPPXPXXPXXP 397 P PPP PP PP P P P Sbjct: 251 PAPPPIPPPSNGTVSSPPNSPPRPIAP 277 Score = 27.9 bits (59), Expect = 3.1 Identities = 21/90 (23%), Positives = 21/90 (23%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXX 283 PPP PPPP P PP PP Sbjct: 293 PPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPP-----PPPPRSNA 347 Query: 284 XXXXXXXPXXPPXPPPXPPXXXPPXXPPPP 373 P PPP PP P PP Sbjct: 348 AGSIPLPPQGRSAPPPPPPRSAPSTGRQPP 377 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/54 (25%), Positives = 14/54 (25%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPP 265 P P P P PP P P P P P P PP Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 32.3 bits (70), Expect = 0.14 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 221 PXXXPPPXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPPXXXPPXXPPPPXP 379 P PP PP PP PP P PP PPPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAG--PPSAPPPPLP 1736 Score = 30.3 bits (65), Expect = 0.58 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 327 PPPPXXXXPPXXXPPPXPXPPP 392 PPPP PP PP P PP Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPP 1728 Score = 29.9 bits (64), Expect = 0.77 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 313 PXXXXPXPPXXXPPPXXXPPPPXXPXXP 396 P P PP PPP PPPP P P Sbjct: 1700 PQMSAPTPP---PPPMSVPPPPSAPPMP 1724 Score = 29.5 bits (63), Expect = 1.0 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 103 PPPXPPXXXPXXPXXXXXXXPPPPXXXXXXPXXXPXPXPPPXXP 234 PP P P P PPPP P P P PP P Sbjct: 1690 PPVRPQSAAP--PQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAP 1731 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 317 PXPPPXPPXXXPPXXPPPPXPXXP 388 P PPP PP PP PP P P Sbjct: 1705 PTPPP-PPMSVPPPPSAPPMPAGP 1727 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 312 PXXXXPPPPXXXXPPXXXPPPXPXPPP 392 P PPPP PP PP PPP Sbjct: 1710 PPMSVPPPP--SAPPMPAGPPSAPPPP 1734 Score = 26.6 bits (56), Expect = 7.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 140 PXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXP 262 P P PPPP P P PP PPP P Sbjct: 1707 PPPPPMSVPPPPSAP------PMPAGPPSAPPPPLPASSAP 1741 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 32.3 bits (70), Expect = 0.14 Identities = 22/90 (24%), Positives = 22/90 (24%) Frame = +2 Query: 104 PPPXPXXXXXXXPXXPXXXXPPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXX 283 PP P P PP P P P PP PP Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPS---IPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Query: 284 XXXXXXXPXXPPXPPPXPPXXXPPXXPPPP 373 P P PP PP PP P Sbjct: 181 VKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 28.3 bits (60), Expect = 2.4 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 7/85 (8%) Frame = +2 Query: 164 PPPPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXXXXXXXXPXXPPX-----PP 328 P PP P P PP PP PP P P PP Sbjct: 128 PAPPTPQSELR--PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Query: 329 PXP--PXXXPPXXPPPPXPXXPXXP 397 P P PP P P P P Sbjct: 186 SAPSLPSAVPPMPPKVPPPPLSQAP 210 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 31.5 bits (68), Expect = 0.25 Identities = 18/76 (23%), Positives = 18/76 (23%) Frame = +2 Query: 170 PPXPXXXXXXXPXPXXPPXXXPPPXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPPXXX 349 PP P PP PPP P PP P Sbjct: 173 PPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQA 232 Query: 350 PPXXPPPPXPXXPXXP 397 P PPP P P Sbjct: 233 DPLPAPPPPPPPTLPP 248 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 29.5 bits (63), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 396 GXXGXXGXGGGGXXGGXXXGGXGGGXGGXXG 304 G G G G GG GG GG GG GG G Sbjct: 31 GRGGARGGGRGGARGGR--GGRGGARGGRGG 59 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 28.7 bits (61), Expect = 1.8 Identities = 23/95 (24%), Positives = 23/95 (24%), Gaps = 4/95 (4%) Frame = +3 Query: 102 PPPXXPXPXPXXPXXX----PXXXXPPPPXXXXXPXXXPXPXXPPXXXXXXXXXXXPXXX 269 PPP P P P PPPP P P P P Sbjct: 209 PPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHH 266 Query: 270 XXXXXXXXXXXXXXPXXXXPPPPXXXXPPXXXPPP 374 P PPPP P PPP Sbjct: 267 EPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 301 Score = 28.7 bits (61), Expect = 1.8 Identities = 23/95 (24%), Positives = 23/95 (24%), Gaps = 4/95 (4%) Frame = +3 Query: 102 PPPXXPXPXPXXPXXX----PXXXXPPPPXXXXXPXXXPXPXXPPXXXXXXXXXXXPXXX 269 PPP P P P PPPP P P P P Sbjct: 222 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHH 279 Query: 270 XXXXXXXXXXXXXXPXXXXPPPPXXXXPPXXXPPP 374 P PPPP P PPP Sbjct: 280 EPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 314 Score = 28.7 bits (61), Expect = 1.8 Identities = 23/95 (24%), Positives = 23/95 (24%), Gaps = 4/95 (4%) Frame = +3 Query: 102 PPPXXPXPXPXXPXXX----PXXXXPPPPXXXXXPXXXPXPXXPPXXXXXXXXXXXPXXX 269 PPP P P P PPPP P P P P Sbjct: 235 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHH 292 Query: 270 XXXXXXXXXXXXXXPXXXXPPPPXXXXPPXXXPPP 374 P PPPP P PPP Sbjct: 293 EPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 327 Score = 28.7 bits (61), Expect = 1.8 Identities = 23/95 (24%), Positives = 23/95 (24%), Gaps = 4/95 (4%) Frame = +3 Query: 102 PPPXXPXPXPXXPXXX----PXXXXPPPPXXXXXPXXXPXPXXPPXXXXXXXXXXXPXXX 269 PPP P P P PPPP P P P P Sbjct: 248 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHH 305 Query: 270 XXXXXXXXXXXXXXPXXXXPPPPXXXXPPXXXPPP 374 P PPPP P PPP Sbjct: 306 EPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 340 Score = 26.2 bits (55), Expect = 9.5 Identities = 18/75 (24%), Positives = 18/75 (24%) Frame = +3 Query: 150 PXXXXPPPPXXXXXPXXXPXPXXPPXXXXXXXXXXXPXXXXXXXXXXXXXXXXXPXXXXP 329 P PPPP P P P P P P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPP--PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMP 260 Query: 330 PPPXXXXPPXXXPPP 374 PPP P PPP Sbjct: 261 PPPMHHEPGEHMPPP 275 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 387 GXXGXGGGGXXGGXXXGGXGGGXGGXXG 304 G G GGG GG G GG GG G Sbjct: 165 GSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 378 GXGGGGXXGGXXXGGXGGGXGGXXG 304 G GGG GG G GG GG G Sbjct: 160 GGFGGGSRGGFGGGSRGGSRGGFRG 184 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 305 PXXPPXPPPXPPXXX-PPXXPPPPXPXXPXXP 397 P P P PP PP P PP P P P Sbjct: 484 PFIPGTSAPLPPTTFAPPGVPLPPIPGAPGMP 515 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/47 (27%), Positives = 13/47 (27%) Frame = +2 Query: 233 PPPXXXXXXPPXXXXXXXXXXXXXPXXPPXPPPXPPXXXPPXXPPPP 373 PPP PP PP P PP P P P Sbjct: 207 PPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYPQAPQQP 253 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 323 PPPXPPXXXPPXXPPPPXPXXPXXP 397 PPP PP P PP P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPP 1906 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,094,231 Number of Sequences: 5004 Number of extensions: 34158 Number of successful extensions: 516 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 75 effective length of database: 1,987,178 effective search space used: 681602054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -