BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K08 (849 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F5.08c |yam8|ehs1|calcium transport protein|Schizosaccharom... 28 1.9 SPBC887.13c |||3-oxoacyl-[acyl-carrier-protein]-synthase |Schizo... 26 5.9 >SPAC1F5.08c |yam8|ehs1|calcium transport protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 486 Score = 27.9 bits (59), Expect = 1.9 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 3/68 (4%) Frame = -1 Query: 720 PSSFIHXSNNSATKGQAGVHVLKSALGXHFXFISVSNVTGII---ATGNEFSXRPESLAP 550 P S++ S S+ G K+ G F + VSNVTG+I A G EF +L Sbjct: 409 PCSYLCYSLASSCPLDLGFACPKAGYGLEFSYGEVSNVTGLITCNAPGVEFYESGSALLN 468 Query: 549 RDFVSWCT 526 +SW T Sbjct: 469 ---ISWRT 473 >SPBC887.13c |||3-oxoacyl-[acyl-carrier-protein]-synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 426 Score = 26.2 bits (55), Expect = 5.9 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = -1 Query: 711 FIHXSNNSATKGQAGVHVLKSALGXHFXFISVSNVTGIIATGNEFSXRPESLA 553 F ++ + T AG H A+G F FI + + IIA G+E P ++A Sbjct: 159 FTALNHTTTTACAAGCH----AIGDAFNFIKLGHADVIIAGGSESCINPLTVA 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,035,377 Number of Sequences: 5004 Number of extensions: 55995 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -