BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K06 (900 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 2e-13 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 69 5e-12 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 64 2e-10 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 6e-09 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 57 2e-08 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 53 3e-07 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 53 4e-07 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 52 6e-07 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 51 1e-06 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 50 2e-06 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 50 3e-06 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 50 3e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 50 3e-06 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 50 3e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 49 4e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 49 6e-06 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 48 8e-06 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 47 2e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 46 3e-05 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 46 3e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 45 7e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 45 7e-05 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 44 1e-04 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 43 3e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 42 5e-04 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 42 7e-04 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 42 9e-04 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 42 9e-04 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 42 9e-04 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 9e-04 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 42 9e-04 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 41 0.001 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 41 0.001 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 40 0.002 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 40 0.003 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 40 0.004 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 40 0.004 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 39 0.005 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 39 0.005 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 39 0.006 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 39 0.006 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 39 0.006 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 38 0.008 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 38 0.011 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 38 0.011 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 38 0.011 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 38 0.011 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 38 0.011 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 38 0.015 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 38 0.015 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 38 0.015 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.019 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.019 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 37 0.026 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 37 0.026 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 36 0.034 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 36 0.034 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 36 0.034 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 36 0.045 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 36 0.059 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 35 0.078 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 35 0.078 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 35 0.078 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 34 0.14 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.14 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 34 0.14 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 34 0.14 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 34 0.14 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 34 0.18 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 34 0.18 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 34 0.18 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 33 0.24 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 33 0.24 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 33 0.31 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 33 0.31 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 33 0.31 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 33 0.42 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.42 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 33 0.42 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 32 0.55 SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) 32 0.55 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 32 0.55 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 32 0.55 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 32 0.73 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 32 0.73 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) 32 0.73 SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) 32 0.73 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 32 0.73 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 32 0.73 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 0.96 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 31 0.96 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 31 0.96 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 31 1.3 SB_50455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 31 1.3 SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) 31 1.3 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 31 1.3 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 31 1.3 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 1.3 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 31 1.3 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 31 1.3 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 31 1.7 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.7 SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 31 1.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 31 1.7 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 31 1.7 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.7 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.7 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 30 2.2 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 30 2.2 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 30 2.2 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 30 2.2 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_10235| Best HMM Match : Coiled (HMM E-Value=6) 30 2.2 SB_51906| Best HMM Match : DUF1621 (HMM E-Value=0.22) 30 2.2 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.2 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 30 2.2 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_8632| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 30 2.9 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 30 2.9 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 30 2.9 SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 30 2.9 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 30 2.9 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 29 3.9 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) 29 3.9 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 29 3.9 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 29 3.9 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 29 3.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 3.9 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 3.9 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 3.9 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 29 3.9 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 29 5.1 SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 29 5.1 SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 29 5.1 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 5.1 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 5.1 SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) 29 5.1 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 29 5.1 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 29 5.1 SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) 29 5.1 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 28 5.5 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_42229| Best HMM Match : Na_H_Exchanger (HMM E-Value=3.9) 29 6.8 SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 6.8 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 29 6.8 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 29 6.8 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 29 6.8 SB_1235| Best HMM Match : Astacin (HMM E-Value=0.0024) 29 6.8 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 6.8 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 29 6.8 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 29 6.8 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 29 6.8 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.9 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 8.9 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40768| Best HMM Match : TM_helix (HMM E-Value=7.7) 28 8.9 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 28 8.9 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 28 8.9 SB_22964| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_18179| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 28 8.9 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 28 8.9 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 28 8.9 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_37809| Best HMM Match : NADH5_C (HMM E-Value=3) 28 8.9 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 28 8.9 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 28 8.9 SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 28 8.9 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 73.3 bits (172), Expect = 2e-13 Identities = 42/134 (31%), Positives = 43/134 (32%), Gaps = 3/134 (2%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXP-XPXXXXPXXPXXXXPXPPXXXXXXXXXX 676 P P PPP P P P P P P P P P P PP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 677 XXXXXXXXXPPPPXPXAPPXPXXXXP-PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP-P 850 PPPP P P P P PPP P PP P +PP PP P Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 851 XPXXXXXXXXPPPP 892 P PPPP Sbjct: 213 PPPNAPNPPYPPPP 226 Score = 70.9 bits (166), Expect = 1e-12 Identities = 41/125 (32%), Positives = 42/125 (33%), Gaps = 6/125 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPS--PXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXX 673 P P A PPP P P P P P P P P P P PP Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 674 XXXXXXXXXXPP---PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP-PXSX 841 PP PP P PP P PPPP P P PPP +P P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Query: 842 PPPXP 856 PPP P Sbjct: 235 PPPNP 239 Score = 66.5 bits (155), Expect = 3e-11 Identities = 39/129 (30%), Positives = 41/129 (31%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXX 685 P + PP P P P P P P P P P P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNP----PYPPPPNAPYPPPPNPPYPPPPNAP 139 Query: 686 XXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXX 865 P P P PP P PPPP P PP PPP +PP PP P Sbjct: 140 YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP--PYPPPPNPPYPPPPNPPYPP 197 Query: 866 XXXXXPPPP 892 PPP Sbjct: 198 PPNAPNPPP 206 Score = 53.6 bits (123), Expect = 2e-07 Identities = 35/129 (27%), Positives = 35/129 (27%), Gaps = 4/129 (3%) Frame = +3 Query: 522 PXXPXXPPXPXXXXXXPXXPPXXXXPXXXXXXXXXXLSPXPP--PLXXXXXXXXXXXXXX 695 P P PP P P PP P P PP P Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Query: 696 XXXXXXXXXXXXXXXXXPXPP--PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPX 869 P PP P PP P PP PPP P P P PP P Sbjct: 171 NAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPN 230 Query: 870 XPXXPPXXP 896 P PP P Sbjct: 231 PPYPPPPNP 239 Score = 52.4 bits (120), Expect = 5e-07 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP--PXXPXXPXXPPXXP 896 P PPP PP P PP PPP PP PPP P P P PP P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Score = 50.4 bits (115), Expect = 2e-06 Identities = 37/134 (27%), Positives = 37/134 (27%), Gaps = 1/134 (0%) Frame = +3 Query: 498 PRXXXXXXPXXPXXPPXPXXXXXXPXXPPXXXXPXXXXXXXXXXLSPXPPPLXXXXXXXX 677 P P P PP P P PP P P PPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN-----PPYPPP---PNAPYP 141 Query: 678 XXXXXXXXXXXXXXXXXXXXXXXPXPPPXXXP-PXXXXPXPPXXXXPPPXPPPXXPPPXP 854 P PPP P P P PP PPP PP PPP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA 201 Query: 855 PXXPXXPXXPPXXP 896 P P P PP P Sbjct: 202 PNPP--PPNPPYPP 213 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P P PP PPP P P P P P P P PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 44.0 bits (99), Expect = 2e-04 Identities = 34/138 (24%), Positives = 34/138 (24%), Gaps = 2/138 (1%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPP-XXXPXXPXXXXPPXPXXSXPXXX 669 P P P P PP P P PP P PP P P PP P P Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPL 160 Query: 670 XXXXXXXXXXXXXXXXXXXXXXPXXXXXPPPXXP-XPXXXXPXPPXXXXXXXXXXXXXXX 846 P PPP P P P PP Sbjct: 161 YPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP--PPNPPYPPPPNAP 218 Query: 847 XXXXXXPXXXPXPPXXPP 900 P P PP PP Sbjct: 219 NPPYPPPPNAPNPPYPPP 236 Score = 42.7 bits (96), Expect = 4e-04 Identities = 32/136 (23%), Positives = 32/136 (23%), Gaps = 2/136 (1%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPP-XPXXSXPXXXXX 675 P P P PP P P PP P P P P PP P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 676 XXXXXXXXXXXXXXXXXXXXPXXXXXPPPXXPXPXXXXPXPP-XXXXXXXXXXXXXXXXX 852 P PPP P P P PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 853 XXXXPXXXPXPPXXPP 900 P P PP PP Sbjct: 210 PYPPPPNAPNPPYPPP 225 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P AP PP P P P P PP P PP P Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 32.3 bits (70), Expect = 0.55 Identities = 29/133 (21%), Positives = 29/133 (21%) Frame = +1 Query: 502 APXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXPXXXXXXX 681 AP P P P P P PP P P PP P P Sbjct: 72 APCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPP--PPPYPPPPNPPYP----PPPNAPYP 125 Query: 682 XXXXXXXXXXXXXXXXXXPXXXXXPPPXXPXPXXXXPXPPXXXXXXXXXXXXXXXXXXXX 861 P PPP P P P PP Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Query: 862 XPXXXPXPPXXPP 900 P PP PP Sbjct: 186 PYPPPPNPPYPPP 198 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 P P PP P P PPP PP PP P PP Sbjct: 70 PDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN 129 Query: 890 P 892 P Sbjct: 130 P 130 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/63 (44%), Positives = 28/63 (44%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P PP P PPPP P PP PPP PP PPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 884 PPP 892 PPP Sbjct: 425 PPP 427 Score = 68.9 bits (161), Expect = 5e-12 Identities = 28/63 (44%), Positives = 28/63 (44%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P PP P PPPP P PP PPP PP PPP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 884 PPP 892 PPP Sbjct: 427 PPP 429 Score = 66.5 bits (155), Expect = 3e-11 Identities = 27/63 (42%), Positives = 28/63 (44%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P +PP P PP P P PP PPP PP PPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 884 PPP 892 PPP Sbjct: 430 PPP 432 Score = 65.7 bits (153), Expect = 5e-11 Identities = 27/63 (42%), Positives = 27/63 (42%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P P P PPPP P PP PPP PP PPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 884 PPP 892 PPP Sbjct: 428 PPP 430 Score = 64.5 bits (150), Expect = 1e-10 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PPP PPP PP P P PP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 64.5 bits (150), Expect = 1e-10 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PPP PPP PP P P PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 64.5 bits (150), Expect = 1e-10 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PPP PPP PP P P PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP P P PPP PPP PP P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP P P PPP PP P P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP PPP PPP PPP PP P P PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P PP PPP PPP PPP PP P P PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P P PPP PPP PPP PP P P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP PPP PPP PPP PP P P PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 61.3 bits (142), Expect = 1e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PPP PPP P P P PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 60.9 bits (141), Expect = 1e-09 Identities = 25/61 (40%), Positives = 26/61 (42%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P +PP P PPPP P PP PP PP PPP P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 Query: 884 P 886 P Sbjct: 441 P 441 Score = 60.1 bits (139), Expect = 2e-09 Identities = 25/51 (49%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP-PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PP P PPP PPP PP P P PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 59.7 bits (138), Expect = 3e-09 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P P P PPPP P PP PPP PP PPP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACA 439 Query: 884 PP 889 PP Sbjct: 440 PP 441 Score = 59.3 bits (137), Expect = 4e-09 Identities = 25/63 (39%), Positives = 26/63 (41%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P P P PPPP P PP PPP +PP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLAC 438 Query: 884 PPP 892 PP Sbjct: 439 APP 441 Score = 58.0 bits (134), Expect = 1e-08 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PP PP PPP PP P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 58.0 bits (134), Expect = 1e-08 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P PP PPP PPP PPP PP P P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 52.8 bits (121), Expect = 4e-07 Identities = 31/97 (31%), Positives = 31/97 (31%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPP P SP P P P P P P P P PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP------------------PP 411 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPP 820 PP P P P PPPP P PP P Sbjct: 412 PPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 52.0 bits (119), Expect = 6e-07 Identities = 23/56 (41%), Positives = 24/56 (42%) Frame = +2 Query: 725 APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 +PP P PPPP P PP PPP PP PPP P PPPP Sbjct: 364 SPPPPPPPPPPPPSPP---PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P P PP P PP P P PP P + P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P+P P PP P P PP P PP P P PP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P +P PP P P PP P PP P P PP P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P P PP P PP P P PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P P PP P P PP P PP P P PP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P +P PP P P P P PP P P PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P PP P PP P P PP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P P PP P PP P P PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P PP P PP P P PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P P PP P PP P PP P P Sbjct: 379 PPPPPPPPPSPPPPPQPPP--PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 529 APXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 +P PP P P PP P PP P PP P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 P P PPP P P P P P P P P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P PP P PP P PP + P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 63.7 bits (148), Expect = 2e-10 Identities = 39/110 (35%), Positives = 39/110 (35%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXX 720 GG GG G G GG GGG GGG GGGG GG G G G GGG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG-----GGGGGD 826 Query: 719 XXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXG 570 G G GG G G GG G GG G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 62.1 bits (144), Expect = 6e-10 Identities = 36/107 (33%), Positives = 36/107 (33%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXX 720 GG GG G G G GGG GGG GGGG G G G G GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 719 XXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGG 579 G G GG G G GG G GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 57.6 bits (133), Expect = 1e-08 Identities = 39/117 (33%), Positives = 39/117 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G GG G GGG GG GGG GG G GGGG G GG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGY 830 Query: 720 GXGGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGE 550 G GGG G GG G G G G G G G G E Sbjct: 831 GDGGG------FGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKNE 881 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 61.3 bits (142), Expect = 1e-09 Identities = 28/65 (43%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +2 Query: 704 PPPPX--PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXX 877 PPPP P +PP P PPPP P PP PPP PP + PPP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPP-PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 878 XPPPP 892 PPPP Sbjct: 406 PPPPP 410 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/55 (40%), Positives = 23/55 (41%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP P PP P P PP PPP PP + PPP P PPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 50.4 bits (115), Expect = 2e-06 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +2 Query: 704 PPPPXPX---APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPPP P PP P PPPP P PP PPP PP + PP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PP PPP PP PPP PP P PP Sbjct: 365 PPPPPPTNKP--PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PPP PP P PP PPP PP PPP PP P Sbjct: 376 PPPPPTNGPPP---PPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPP--XXPPPXPPXXPXXPXXPP 887 PP PP P PP PP PPP PPP PP P PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPX--PPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PP PPP P P P P P Sbjct: 346 PPPPPTNNPPS---PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXX---PPPXPPXXPXXPXXPPXXP 896 P PPP P P PP PPP PPP PPP P P P P P Sbjct: 355 PSPPP---PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +3 Query: 747 PXPP---PXXXPPXXX--XPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP P PP P PP PPP PPP PP PP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP PP P PP PP PPP P PP P PP Sbjct: 374 PPPPP---PPTNGPPPPPPPTNGPPPPPP--PTNGPPPPPPPTNGPP 415 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 8/58 (13%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-----PXXPP---PXPPXXPXXPXXPPXXP 896 P PP PP P PP PPP PP P PP P PP P PP P Sbjct: 357 PPPPTNNTPP----PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 32.3 bits (70), Expect = 0.55 Identities = 25/91 (27%), Positives = 26/91 (28%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPP +P P P P P P P PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP----------- 395 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXPPPPXXP 772 PPPP PP P PPP P Sbjct: 396 --------PPPPPTNGPPPP----PPPTNGP 414 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPP 857 P PPP PPP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXX--PPXPXPPXXXPXXP----XXXXPPXPXXSXP 660 P+P P PP P P PP P PP P P PP P + P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 58.8 bits (136), Expect = 6e-09 Identities = 45/134 (33%), Positives = 45/134 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG GGG GG GGG GG G GGGG G GGA Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGATGGGGGATGGGGGAT 296 Query: 720 GXGGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG 541 G GGG G GG G G G G G G G G G G Sbjct: 297 GGGGGA----TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATG--GGGGVTGGGGG 350 Query: 540 XGGGXXAXXXXGXG 499 GG G G Sbjct: 351 ATGGGGGPGSGGCG 364 Score = 52.8 bits (121), Expect = 4e-07 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 1/113 (0%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXX 720 GG GG G G GG GG G GGGG GG G G G GGG G Sbjct: 251 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG----GGATGGG 306 Query: 719 XXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXG-XGGXXGXG 564 G G GG G G GG G GG G G Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G G GGG GG GGGG GG G G G G G G Sbjct: 315 GATGGGGGATGGGVGATGGG--GGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 35.1 bits (77), Expect = 0.078 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEX----GGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 GGG G GGG GG GGG GG G GGGG G G Sbjct: 306 GGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGE 365 Query: 723 XG 718 G Sbjct: 366 DG 367 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 57.2 bits (132), Expect = 2e-08 Identities = 37/120 (30%), Positives = 39/120 (32%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPP 712 P +P +P P P P P P P P PP PPP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGG----------PPP 166 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P P AP P P P PP PPP PP PPP P PPPP Sbjct: 167 PPPIAPAATV----PAPAVPLAAASPPPPSGGPPPPPPPP---PPPPPPPILELAAPPPP 219 Score = 51.2 bits (117), Expect = 1e-06 Identities = 24/62 (38%), Positives = 25/62 (40%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 PPP P AP P PPP PP PPP +P PPP P PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPP----PPPIAPATGGPPPPPPIAPATGGPP 165 Query: 887 PP 892 PP Sbjct: 166 PP 167 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 P P P PPPP P P PPP SP PPP P PP Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPP---PPPTSPATRAPPPPPPIAPATGGPP 152 Query: 887 PP 892 PP Sbjct: 153 PP 154 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP PP P PPP PP P PP P Sbjct: 124 PSPPPPPTSPATRAPPPP----PPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 9/56 (16%) Frame = +3 Query: 747 PXPPPXXXP---------PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PP PPP PPP PPP PP PP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 P PPP P PP PPP P PPP PP P PP P Sbjct: 110 PPPPPRAPETPSQAPSPP----PPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXP-----PPXPPXXPXXPXXPPXXP 896 P PPP P P PP P P P PP P P P PP P Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXP-----PPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP P PP PPP PP P P P Sbjct: 165 PPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PP P P PP PP P PP P Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 3/51 (5%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPP---PXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P PP P P PPP P P P P Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPP 189 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P P P P PP P S S PPP PPPP Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP--PXSXP-PPXPXXXXXX 874 P APP P P P PPP +P P P PP P Sbjct: 78 PQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPP--PPPRAPETPSQAPSPPPPPTSPAT 135 Query: 875 XXPPPP 892 PPPP Sbjct: 136 RAPPPP 141 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G GG GGG GGG GGGG GG G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 52.8 bits (121), Expect = 4e-07 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GGG GGG GGGG GG G G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G GG GGG GGG GGGG GG G G G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 51.6 bits (118), Expect = 8e-07 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GG GGG GGG GGGG GG G G G GGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 50.8 bits (116), Expect = 1e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G G GG GGG GGG GGGG GG G G G GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G G GG GGG GGG GGGG GG G G G GG Sbjct: 659 GGDGGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GG GGG GGG GGG GG G GG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GG GG GGG GG G GGGG G GGA G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG+ GGG GG G GGGG G GG G GGGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GG GGG GG G GGGG G GG G GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG GGG GG G GGGG G GGA G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGA-GAGAG 710 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G G + GG GGG GG G GGGG G GG G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G GG G GGG GG GGG GG G GG G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG GGG GG G GGGG G G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G GG G GGG GG GGG GG G GGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-----GGGGGGGGGAGGAGAGAGD 711 Query: 720 GXGGG 706 G G Sbjct: 712 DDGDG 716 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 52.8 bits (121), Expect = 4e-07 Identities = 35/121 (28%), Positives = 36/121 (29%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPPS +P P P P P PP PP Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQR---------PP 339 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP APP P PPP PP PPP PP P P PPP Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP--PSSLGNPPPPPP 397 Query: 890 P 892 P Sbjct: 398 P 398 Score = 48.8 bits (111), Expect = 6e-06 Identities = 34/119 (28%), Positives = 35/119 (29%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P A PPPS +P P P P P P PP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP----PPSRSSQRPPPPSRGAPPPPSMG 352 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P PP P PPPP P PPP P PPP P Sbjct: 353 MAPPPVGGAAPPPP--PPPPVGGPPPPP--PPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP A P P PPP PP P PP S P P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 884 PP 889 PP Sbjct: 348 PP 349 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 4/67 (5%) Frame = +2 Query: 704 PPPPXP--XAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP--XSXPPPXPXXXXX 871 PPPP APP P PPPP P PP PP S PP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP----S 342 Query: 872 XXXPPPP 892 PPPP Sbjct: 343 RGAPPPP 349 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP P PP P PPP PP P P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PP PP PP PP PPP P PP P Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPX-----PPPXX--PPPXPPXXPXXPXXPPXXP 896 PPP P PP PPP PPP PP PP P PP P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPP---XXPPPXPPXXPXXPXXPP 887 PPP P P PP PP PP PPP PP PP Sbjct: 297 PPP---PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP----XPPXXPXXPXXPP 887 P PP P P PPP P PPP PP P PP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 Score = 29.1 bits (62), Expect = 5.1 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 4/92 (4%) Frame = +2 Query: 470 PXKKXXXXXXPXPXXXXAXXPPPS----PXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXP 637 P + P P PPPS P S P P P P P P P Sbjct: 319 PARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPP----PPPPPVGGP 374 Query: 638 XPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPP 733 PP PPPP APP Sbjct: 375 PPP--PPPIEGRPPSSLGNPPPPPPPGRGAPP 404 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G GG GGG G GGGG GG G G G GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 52.0 bits (119), Expect = 6e-07 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G GG GGG G G GG G GG G G G GGG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G GG GGG G GGG GG G G G GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G GG GGG G GGG GG G GG GGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G GG GGG G G GG GG G GG GGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG GGG GG G GGGG G GG G GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 GG GG G G G GGG GGG GGGG GG G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG GG GGG GG G GGGG GG G GGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GG GGG GGG G G GG G G G GGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG G G GGG G G GGGG GG G G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 GGGG G GGG GG+ G G GG G GGGG G G A Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG-GGGVGRA 116 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GG GGG GG G G G G GG G GGG Sbjct: 60 DDGGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G G G GGG GGGG GG G G G GGG G Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/55 (47%), Positives = 26/55 (47%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G GGG GGG GGGG GG G G G GGG G Sbjct: 152 GGYRGGGGGYRGRGRG-GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 49.2 bits (112), Expect = 4e-06 Identities = 27/63 (42%), Positives = 27/63 (42%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGG G GGG GG GGG GG G GGGG G GG G G Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGG--GGGGYGGSGYGGGGGYG 215 Query: 711 GGG 703 GGG Sbjct: 216 GGG 218 Score = 48.8 bits (111), Expect = 6e-06 Identities = 35/108 (32%), Positives = 35/108 (32%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXXX 676 G GG GG GGG GG GGGG G GG G GGGG Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG-GYGGGGYGGGGYGGG 184 Query: 675 XXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGG 532 G G G G G G G G G G G GG Sbjct: 185 GHGGGGY----GGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G G GG GG GGG GGGG GG G G G GG Sbjct: 168 GGGYGGGGYGGGGYGG--GGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G G GGG GGG GGGG GG G G G G G G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG G GGG GG GGG GG G GGGG G GG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS-GYGGGGGYGGGGYGGGR 223 Query: 720 GXGGG 706 GGG Sbjct: 224 SGGGG 228 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG G GGG G GGG G G GGGG G GG Sbjct: 141 GYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Query: 720 GXGGG 706 G GG Sbjct: 201 GGYGG 205 Score = 44.4 bits (100), Expect = 1e-04 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 2/106 (1%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGG-XGGGGXXXGGXGXXXXGXGXXG-GGXXXXXGXXX 726 GG G G GG GG GGG GGGG GG G G G G GG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 725 XXXXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXG 588 G G GG G G GG G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 43.2 bits (97), Expect = 3e-04 Identities = 32/106 (30%), Positives = 32/106 (30%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXXXXXXXXXXXXXXX 678 GG GG GGG GGGG G G G GGG G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRG----RGGGGYGGGGYGGGG 180 Query: 677 XXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXGXXXXRXGG 540 G G GG G G G GG G G R GG Sbjct: 181 YGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 41.9 bits (94), Expect = 7e-04 Identities = 36/117 (30%), Positives = 36/117 (30%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXXXXX 670 GGG GG GGG GG GGG G GG GGGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYR--------SGGGYR--GGGGYR--GGGGGYRGRGRGGGG 170 Query: 669 XXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGGGXXAXXXXGXG 499 GG G G G G G G G G G GGG G G Sbjct: 171 YGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 50.4 bits (115), Expect = 2e-06 Identities = 39/125 (31%), Positives = 39/125 (31%), Gaps = 5/125 (4%) Frame = -1 Query: 888 GGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXX--GXXGGGGXXXXGXGGAXGX 715 GG G GGG GG GGG GG G GGGG GGA G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 714 GG---GGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXX 544 GG GG G GG G G G G G G G Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 543 GXGGG 529 GGG Sbjct: 160 TGGGG 164 Score = 48.8 bits (111), Expect = 6e-06 Identities = 38/133 (28%), Positives = 38/133 (28%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXX 717 G G G G GG GG GG GGGG GG G G G GG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGG----GGGATGDG 93 Query: 716 XXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXGXXXXRXGGX 537 G GG G G GG G G G G GG Sbjct: 94 GGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHG-GATGGHGGATGGGGGA 152 Query: 536 XGAXXPXXXXGAG 498 G G G Sbjct: 153 TGGGGGATGGGGG 165 Score = 48.4 bits (110), Expect = 8e-06 Identities = 33/110 (30%), Positives = 33/110 (30%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXX 720 GG GG G G GG GG G GGGG G G G G GGG G Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGG---HG 115 Query: 719 XXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXG 570 G G GG G GG GG G Sbjct: 116 GATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 45.6 bits (103), Expect = 6e-05 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 3/126 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG---XXGGGXXXXXGXX 729 GG G G G GG G GG GGGG GG G G G GGG G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA 103 Query: 728 XXXXXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXGXXXXR 549 G G G G GG G G G G Sbjct: 104 TGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGG-GGGATGGGGGATGG 162 Query: 548 XGGXXG 531 GG G Sbjct: 163 GGGATG 168 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGG--GXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G G GG GG G GG GGGG GG G G G GG Sbjct: 119 GGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG GG GGG G GG G GG GG G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHG 80 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 5/68 (7%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXX-----XG 736 G GGGG GGG G GG GG GGGG G Sbjct: 102 GATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATG 161 Query: 735 XGGAXGXG 712 GG G Sbjct: 162 GGGGATGG 169 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = +2 Query: 704 PPPPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXX 877 PPPP P PP PPPP P PP P P PPP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 878 XPPPP 892 PPPP Sbjct: 754 PPPPP 758 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP---XXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXX 874 PPPP P PPPP P PP PPP PPP P Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAG 738 Query: 875 XXPPPP 892 PPPP Sbjct: 739 LPPPPP 744 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPP---XXPPPXPPXXPXXPXXPPXXP 896 P PPP PP PP PPP P P PPP PP P PP P Sbjct: 710 PMPPPPPPPPPGCAGLPP----PPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 41.5 bits (93), Expect = 9e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 747 PXPPPXXXPPXXXX--PXPPXXXXPPPXPPPXX---PPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP PPP PPP P P PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPP----PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP 744 Score = 37.9 bits (84), Expect = 0.011 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPP P P P P P P P PP P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGL-------------P 726 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PP P P PPPP P PP PPP P Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPP----PPPIDVP 763 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPP------XXPPPXPPXXPXXPXXPPXXP 896 P PPP PP PPP PPP PPP PP P PP P Sbjct: 678 PPPPPLPVIEGSSLSVPPP---PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 35.1 bits (77), Expect = 0.078 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXP-----PPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PP P PP PPP PPP P P PP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP--PPPGCAGLP--PPPPP 759 Score = 34.7 bits (76), Expect(2) = 0.003 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PPP P P PP PPP PPP P P P Sbjct: 726 PPPPPSPQPGCAGLPPPPP--PPPPGCAGLPPPPPPIDVPMKP 766 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 7/53 (13%) Frame = +2 Query: 755 PPPXXPXXXXXXXPPXXXXPPPXSPP-------XSXPPPXPXXXXXXXXPPPP 892 PPP P PPP PP PPP P PPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP 729 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PPP PPP P P PP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPP 717 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 P P PPPSP P P P P P P P P Sbjct: 718 PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 24.2 bits (50), Expect(2) = 0.003 Identities = 12/41 (29%), Positives = 12/41 (29%) Frame = +3 Query: 522 PXXPXXPPXPXXXXXXPXXPPXXXXPXXXXXXXXXXLSPXP 644 P P PP P P PP P SP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 50.0 bits (114), Expect = 3e-06 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G GG GGG GGG GGG GG G GG GGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG--GGGGFG 128 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GGG GG GGGG GG G G G GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG G G GG GGG GGG GGGG GG G G Sbjct: 85 GGFGGGGGFGGGGGGGFGGG-GGGGFGGGGGGGGGFGGGGGG 125 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G GG GG GGG G GG GG G G G GGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG GG GGG GG G GGGG G GG G GGGG Sbjct: 82 GRGGGFGGGGGFGGGGG--GGFGGGGGGGFGGGGG----GGGGFGGGGGGG 126 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 GG GG G G GG GGG GGG GG G Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG G GG GG GGG GGG GG G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 828 GEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG GG G GGGG G GG G GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXG 798 GG GG G G G GGG GG GGGG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG G GGG GG GGGG G GG G GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGF-----GGGGGGGFGGGGGGGGGFGGGG 123 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG G GG GGE GGG GG G GGGG G G Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMG 1825 Query: 720 GXGGG 706 GGG Sbjct: 1826 AAGGG 1830 Score = 47.2 bits (107), Expect = 2e-05 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXX---GGGGXXXXGXG 730 G GGGG G G G GG GGG GG G GGG G G Sbjct: 1778 GGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEG 1837 Query: 729 GAXGXGGGG 703 G G GGGG Sbjct: 1838 GGAGGGGGG 1846 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G GG GGG G G GGG GG G G G GGG Sbjct: 1801 GGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEG---GGAGGGGGG 1846 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG G GGG GG GG GG G GGGG G GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG-GMAGGGGGMGGGGGGMG 1818 Query: 720 GXGGG 706 G G G Sbjct: 1819 GGGEG 1823 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G GG GG GG GGG GG G G GGG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/66 (40%), Positives = 27/66 (40%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG G GG GG GGG GG G GGG G GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGG---GGGMGGGGMAAGGGEFGGGEGMGGGG---MAGGGGGM 1810 Query: 720 GXGGGG 703 G GGGG Sbjct: 1811 GGGGGG 1816 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G GG GG GGG GGG G G G G GGG G Sbjct: 1756 GGFGGGGGG--GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 GG GGG GGG GGG GG G GG GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G GG GGG GGG GGGG G G G G GGG G Sbjct: 1794 GGEGMGGGGMAGGGGGMGGG--GGGMGGGGEGMGAAG-GGMGAGGEGGGAGGGGG 1845 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GGG GGG G GG G GG GGG G Sbjct: 1801 GGMAGGGGGMGGGGGG-MGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 41.5 bits (93), Expect = 9e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 4/69 (5%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEX--GGGXXXXGGXXXXXXXGXXGGG-GXXXXGXG 730 G GGG GGG GGE GGG GG G GGG G G G Sbjct: 1771 GGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGG 1830 Query: 729 -GAXGXGGG 706 GA G GGG Sbjct: 1831 MGAGGEGGG 1839 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 49.6 bits (113), Expect = 3e-06 Identities = 34/134 (25%), Positives = 36/134 (26%), Gaps = 3/134 (2%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPP + P P P P P PP Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 300 Query: 680 XXXXXXXXPPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP A PP P P P P PP PP S + PPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Query: 851 XPXXXXXXXXPPPP 892 PPPP Sbjct: 361 PGRAPQPLGGPPPP 374 Score = 45.6 bits (103), Expect = 6e-05 Identities = 33/139 (23%), Positives = 34/139 (24%), Gaps = 8/139 (5%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPP S P P P P PP Sbjct: 196 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMR 255 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXPPPP--------XXPXXXXXXXPPXXXXPPPXSPPX 835 PPP PP PPPP P P P P Sbjct: 256 GPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 315 Query: 836 SXPPPXPXXXXXXXXPPPP 892 + PPP P PPPP Sbjct: 316 ATPPPPPPSRDQVPLPPPP 334 Score = 45.2 bits (102), Expect = 7e-05 Identities = 31/123 (25%), Positives = 33/123 (26%), Gaps = 4/123 (3%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXX-PXXPXPXXXXPXXPXXXX---PXPPXXXXXXX 667 P P + PPP P P P P P P P PP Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Query: 668 XXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPPP P PPPP PP P S + PP Sbjct: 330 LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 389 Query: 848 PXP 856 P P Sbjct: 390 PPP 392 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 2/107 (1%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXX--P 706 PP P S P P P P P P PP Sbjct: 298 PPLPP-SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 356 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPP P P P PPPP P PPP PP P Sbjct: 357 PPPPPGRAPQPLGGPPPPP-----PGRRPPSGKINPPPPPPPAMDKP 398 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 747 PXPPPXXXPP--XXXXPXPPXXXXPPP--XPPPXXPPPXPPXXPXXPXXPP 887 P PPP PP P PP P P PPP P PP P PP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Frame = +3 Query: 747 PXPPPXXXPPXXXX-----PXPPXXXXPPPXPPPXXP--PPXPPXXPXXPXXPP 887 P PPP PP P PP P PPP PP PP P PP Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 333 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP PPP PP P PP PP P Sbjct: 299 PLPPSRDQAPA---PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PPP P P PP PP PPP PP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 35.5 bits (78), Expect = 0.059 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPP 887 PP PPP PPP PP P P PP Sbjct: 2 PPPPPPPGPPP-PPSAPSGPVKPP 24 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP +PP P PPP P PPP PP PPP Sbjct: 133 PPPKNSSPPPPFGAPPPPDR--GGQLAKKPSQGSFPPP--PPMGKPPP 176 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 728 PPXPXXXXPPPPXX--PXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P PPPP P PPP S S PPP P PPP Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPP-PERSSGPPPPPP 220 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/102 (25%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = +2 Query: 470 PXKKXXXXXXPXPXXXXAXXPPPSPXXSPXXXPXPXXP-XXPXPXXXXPXXPXXXXPXPP 646 P + P P PPPS P P P P P P PP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Query: 647 XXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P P PPPP P Sbjct: 361 ---------PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP-PXPPPXXP-PPXPPXXPXXPXXPP 887 P PPP P PP P P PPP PP P P PP Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP 264 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 747 PXPPPXXXPP---XXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP PP PP PP P PP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 312 Score = 31.9 bits (69), Expect = 0.73 Identities = 33/125 (26%), Positives = 34/125 (27%), Gaps = 5/125 (4%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPP 712 PP P +P P P P PP PPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGP--PPP 197 Query: 713 PXPX---APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPX--SPPXSXPPPXPXXXXXXX 877 P APP P PPP P PPP S P PPP Sbjct: 198 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRS---LAPPPTGSSRPLPAPPP------GEN 248 Query: 878 XPPPP 892 PPPP Sbjct: 249 RPPPP 253 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P PP PP PPP P P PP P Sbjct: 329 PLPPP---PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 375 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PPP P PPP P P PP Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPP--PKNAPPP-PKRGSSNPPPPP 284 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PPP PP PPP PP Sbjct: 464 PPPVPPSRGPPPPPP 478 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 828 PPXXPPPXPPXXPXXPXXPPXXP 896 PP PPP PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP P PP PP P PP P PP P Sbjct: 280 PPP---PPTRGPPSNSFTTQGPPLPPSRDQAPAPPP-PLNATPPPPPP 323 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P PP P P P P PP P PP P Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGG 770 GG G GGG GGG GG GG G GG Sbjct: 65 GGNLSSSSSSTGGGGGFSGGG--GGSMGGGGLGGLFAGG 101 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 PPP P PP PP PPP P Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 224 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 49.6 bits (113), Expect = 3e-06 Identities = 34/134 (25%), Positives = 36/134 (26%), Gaps = 3/134 (2%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPP + P P P P P PP Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 212 Query: 680 XXXXXXXXPPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP A PP P P P P PP PP S + PPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Query: 851 XPXXXXXXXXPPPP 892 PPPP Sbjct: 273 PGRAPQPLGGPPPP 286 Score = 45.6 bits (103), Expect = 6e-05 Identities = 33/139 (23%), Positives = 34/139 (24%), Gaps = 8/139 (5%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPP S P P P P PP Sbjct: 108 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMR 167 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXPPPP--------XXPXXXXXXXPPXXXXPPPXSPPX 835 PPP PP PPPP P P P P Sbjct: 168 GPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 227 Query: 836 SXPPPXPXXXXXXXXPPPP 892 + PPP P PPPP Sbjct: 228 ATPPPPPPSRDQVPLPPPP 246 Score = 45.2 bits (102), Expect = 7e-05 Identities = 31/123 (25%), Positives = 33/123 (26%), Gaps = 4/123 (3%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXX-PXXPXPXXXXPXXPXXXX---PXPPXXXXXXX 667 P P + PPP P P P P P P P PP Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Query: 668 XXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPPP P PPPP PP P S + PP Sbjct: 242 LPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPP 301 Query: 848 PXP 856 P P Sbjct: 302 PPP 304 Score = 38.3 bits (85), Expect = 0.008 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 2/107 (1%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXX--P 706 PP P S P P P P P P PP Sbjct: 210 PPLPP-SRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 268 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPP P P P PPPP P PPP PP P Sbjct: 269 PPPPPGRAPQPLGGPPPPP-----PGRRPPSGKINPPPPPPPAMDKP 310 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 747 PXPPPXXXPPXXXX--PXPPXXXXPPP--XPPPXXPPPXPPXXPXXPXXPP 887 P PPP PP P PP P P PPP P PP P PP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Frame = +3 Query: 747 PXPPPXXXPPXXXX-----PXPPXXXXPPPXPPPXXP--PPXPPXXPXXPXXPP 887 P PPP PP P PP P PPP PP PP P PP Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPP 245 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP PPP PP P PP PP P Sbjct: 211 PLPPSRDQAPA---PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PPP P P PP PP PPP PP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP +PP P PPP P PPP PP PPP Sbjct: 45 PPPKNSSPPPPFGAPPPPDR--GGQLAKKPSQGSFPPP--PPMGKPPP 88 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 728 PPXPXXXXPPPPXX--PXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P PPPP P PPP S S PPP P PPP Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPP-PERSSGPPPPPP 132 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/102 (25%), Positives = 27/102 (26%), Gaps = 1/102 (0%) Frame = +2 Query: 470 PXKKXXXXXXPXPXXXXAXXPPPSPXXSPXXXPXPXXP-XXPXPXXXXPXXPXXXXPXPP 646 P + P P PPPS P P P P P P PP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Query: 647 XXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P P PPPP P Sbjct: 273 ---------PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP-PXPPPXXP-PPXPPXXPXXPXXPP 887 P PPP P PP P P PPP PP P P PP Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP 176 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 747 PXPPPXXXPP---XXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP PP PP PP P PP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 224 Score = 31.9 bits (69), Expect = 0.73 Identities = 33/125 (26%), Positives = 34/125 (27%), Gaps = 5/125 (4%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPP 712 PP P +P P P P PP PPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGP--PPP 109 Query: 713 PXPX---APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPX--SPPXSXPPPXPXXXXXXX 877 P APP P PPP P PPP S P PPP Sbjct: 110 PHSRHGSAPPPPERSSGPPPPPPGRGPSQRS---LAPPPTGSSRPLPAPPP------GEN 160 Query: 878 XPPPP 892 PPPP Sbjct: 161 RPPPP 165 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P PP PP PPP P P PP P Sbjct: 241 PLPPP---PLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 287 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PPP P PPP P P PP Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPP--PKNAPPP-PKRGSSNPPPPP 196 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PPP PP PPP PP Sbjct: 376 PPPVPPSRGPPPPPP 390 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP P PP PP P PP P PP P Sbjct: 192 PPP---PPTRGPPSNSFTTQGPPLPPSRDQAPAPPP-PLNATPPPPPP 235 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P PP P P P P PP P PP P Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 PPP P PP PP PPP P Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGP 136 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 49.2 bits (112), Expect = 4e-06 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP-PXPPPXXPPPXP-----PXXPXXPXXPPXXP 896 P PPP PP P PP PP P PPP PP P P P P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Score = 48.0 bits (109), Expect = 1e-05 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP----XSXPPPXPXXXXX 871 PPPP P PP P PPPP P PP PPP SPP P P P Sbjct: 204 PPPPPPRPPPSPP--PPPPPPSP------SPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Query: 872 XXXPPP 889 PPP Sbjct: 256 PTLPPP 261 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P P P P PP PPP PP PP PP P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP PPP PPP P P PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P +P PPPP P PP PP PP PP P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PP PPP PP PP P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPP 230 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 520 GXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 G P P + P P PP PP P P PP P P Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 532 PXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P PP P P PP P PP P P PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPP--RPPPPPPPSPPRP 240 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P PP P PP P PP P S P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 PPP P SP P P P P P P PP Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +3 Query: 747 PXPPPX--XXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P P P PP P P P P P P PP PP Sbjct: 222 PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/56 (26%), Positives = 15/56 (26%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP P P PP P P P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXX--PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P APP P PPPP P PP PPP + P PPP P Sbjct: 57 PPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 48.4 bits (110), Expect = 8e-06 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P P PPP P P PPP PP PPP P P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP--PPLPAPPPPPAQPAPQPPP 107 Query: 884 PPP 892 PP Sbjct: 108 APP 110 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P PP P PPP PP PP P P PP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 42.3 bits (95), Expect = 5e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 747 PXPP---PXXXPPXXXXPX-PPXXXXPP--PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P PP P PP PP P PPP P P PP P PP P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXX---PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P PP PPP PP PPP PP P PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPL--PAPPPPPAQP 101 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +2 Query: 704 PPPPX--PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP-PPXSPPXSXP 844 PPPP P APP P PP P PP P PP +PP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/56 (33%), Positives = 22/56 (39%) Frame = +2 Query: 725 APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 +PP P PP P PPP +PP + PPP P PPPP Sbjct: 49 SPPPPP--PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP----LPAPPPPP 98 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 747 PXPP---PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P PP P P P P PPP P P P P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXP--PPXPPXXPXXPXXPPXXP 896 P P PP P PP P PP P P P PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLP 92 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P A PP P P P PP P P PP P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP---PPPPLPAPPPPPAQPAP 103 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPP---XPXPPXXXPXXPXXXXPPXPXXSXP 660 P P+P AP P P P PP P PP P P P P + P Sbjct: 53 PPPSPPAA-APAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 502 APXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 AP A PP P P PP P PP P P PP P P Sbjct: 64 APPPPAAAPAAPPPPAAPPAAPPPP-PPLPAPPPP-PAQPAPQPPPAPPHFLP 114 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PPP PP P P P P P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAP 75 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 48.8 bits (111), Expect = 6e-06 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G GG GGG GGG GGG GG G G G GGG G Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGY-GGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G GG G G GG GGG GGG GGG GG G GG GGG Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGGG--GYGGGGRHDYGGGSKGGG 245 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G G G G GG GGG GGG GGG GG G GG GGG Sbjct: 187 GYRSGGGGYGGSKGGYGGGSGGGGYGGG-RGGGGYGGGHGGGGYGGGG 233 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGG--GXXXGGXGXXXXGXGXXGGG 753 G G G G GG GGG GGG GGG G GG G G GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGX-GGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG G G GG GGG GGG GGGG G G G Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG G GG G GGG G G GG G G GG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 720 GXGGG 706 GGG Sbjct: 236 DYGGG 240 Score = 36.3 bits (80), Expect = 0.034 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GGG + GG GG GG G GGG G GG G GGG Sbjct: 180 GGGSQGGGYRSGGGGY-GGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 34.3 bits (75), Expect = 0.14 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG G GGG GG GG GG G GGGG G GG+ Sbjct: 187 GYRSGGG-GYGGSKGGYGGGSGGGGY--GGGRGGGGYGGGHGGGGYGGGGRHDYG-GGSK 242 Query: 720 GXG 712 G G Sbjct: 243 GGG 245 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 48.4 bits (110), Expect = 8e-06 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG G G GG GGG GGG GGGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GGG GGG GGGG GG G G G GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG GGG GGGG GG G G G G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGG 770 G GG G G GG GGG GGG GGG GG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXG 759 G GG GGG GGG GGGG GG G G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 G G G GG GGG GGG GGGG GG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G G GG GGG GGG GGGG GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 845 GGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG GGGG GG G G G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G G GG GGG GGG GGG GG G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG GG G G GG GGG GGG G G G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -1 Query: 825 EXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GGG GG G GGGG G GG G GGGG Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGG 166 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXG 718 GGG GG GGG GG G GGGG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGGGGGGGDG 168 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 825 EXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 + GGG GG G GGGG G GG G G Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGG 727 + GG GGG GG G GGGG G GG Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G GGG GG GGG GG G GGGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGG-----GGGGGGGGGGGGDGDEDDDG 174 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGG 793 G GGGG G GGG GG G G G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 48.0 bits (109), Expect = 1e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PPP PPP PPP PP P P PP P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP PP P PP PP PPP PP P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP P PP P PP P P PP P SP S P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGS--PSGTSAGNPQQQP 741 Query: 884 PPP 892 PPP Sbjct: 742 PPP 744 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P PP P PP PPP P P PPP PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP PPP PPP PP P PP P Sbjct: 683 PPPP----PPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 P P PP P PPPP P PP PPP PP S PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPP-----PPPPQPSTPPP--PPPSTPP 715 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 541 PPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P + P P PP P PP P P PP P S P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 34.7 bits (76), Expect = 0.10 Identities = 28/124 (22%), Positives = 29/124 (23%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG GG GG GG G G GG GG+ Sbjct: 492 GNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSN 551 Query: 720 GXGGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG 541 G G G G G G G G G G G Sbjct: 552 NGGNDG-----SNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGG 606 Query: 540 XGGG 529 GG Sbjct: 607 NTGG 610 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P P P PPPP P PP PPP P S PPP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPP-------PPPPPPPPPPPPQPSTPPPPP 710 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 755 PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P P PP PPP PP PPP P PPPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQP----STPPPPPP 711 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/83 (24%), Positives = 20/83 (24%) Frame = +2 Query: 596 PXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPX 775 P P P PP PPPP P PP P P Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Query: 776 XXXXXXPPXXXXPPPXSPPXSXP 844 P PPP P P Sbjct: 730 SGTSAGNPQQQPPPPGQLPGQQP 752 Score = 32.7 bits (71), Expect = 0.42 Identities = 27/124 (21%), Positives = 27/124 (21%), Gaps = 3/124 (2%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG GG GG GG G G GG G G Sbjct: 461 GGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNG 520 Query: 711 G---GGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG 541 G GG G G G G G G G G Sbjct: 521 GNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGG 580 Query: 540 XGGG 529 GG Sbjct: 581 NTGG 584 Score = 32.3 bits (70), Expect = 0.55 Identities = 28/130 (21%), Positives = 28/130 (21%), Gaps = 6/130 (4%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G G GE GG G G GG G Sbjct: 477 GNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGE 536 Query: 720 GXGGGGXXXXXXXXXXXXXXXXGXXGG------XGXXXXGXXGXXXXGXGXXGXXGXGXX 559 GG GG G G G G G G Sbjct: 537 NNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 596 Query: 558 XGEXXGXGGG 529 G G GG Sbjct: 597 GGNTGGNNGG 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = -1 Query: 900 GXXGG--GGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGG 727 G GG GG G GG GG GG GG G GG GG Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNN---GGNTGGNNNGGNTGGNNNGGNTGG 628 Query: 726 AXGXGGGG 703 G GG Sbjct: 629 NNGGNTGG 636 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = -2 Query: 899 GGXXGGX---GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG--XGXXGGG 753 GG GG G G GG GG GG GG G G G G GG Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGG 641 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGG 755 G G GG GG GG G G GG GG Sbjct: 418 GGNDKGGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGG 457 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GG GG GG G G GG G Sbjct: 428 GGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGG 487 Query: 720 GXGGG 706 GG Sbjct: 488 NNNGG 492 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 541 PPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 PP P P PP P P P P PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G GG GG GG GG GG G GG Sbjct: 562 GGNTGGNNNG-GNTGGNNGGNTGGNNNGGN--TGGNNNGGNTGGNNGG 606 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXG-GGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GG GG GG G G GG Sbjct: 423 GGNTNGGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGG 472 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/65 (24%), Positives = 16/65 (24%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG GG GG GG G G GG G Sbjct: 433 GGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNNNGGNNNGG 492 Query: 720 GXGGG 706 GG Sbjct: 493 NNNGG 497 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = -2 Query: 899 GGXXGGX---GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 GG GG G G GG GG GG GG G G G Sbjct: 614 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSGEVTIQPGGG 660 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 4/70 (5%) Frame = -1 Query: 900 GXXGG--GGXXXXXXXXGXGGGXEXGGEXGG--GXXXXGGXXXXXXXGXXGGGGXXXXGX 733 G GG GG G G GG GG G GG G GG Sbjct: 576 GNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 635 Query: 732 GGAXGXGGGG 703 G G GG Sbjct: 636 GNNNGGNSGG 645 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 48.0 bits (109), Expect = 1e-05 Identities = 33/123 (26%), Positives = 34/123 (27%), Gaps = 6/123 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP P P P P P P P P P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRV 461 Query: 674 XXXXXXXXXXPPP--PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSX 841 PPP P P PP P PPP P PPP +P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRV 521 Query: 842 PPP 850 PPP Sbjct: 522 PPP 524 Score = 47.6 bits (108), Expect = 1e-05 Identities = 33/123 (26%), Positives = 34/123 (27%), Gaps = 6/123 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP P P P P P P P P P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 491 Query: 674 XXXXXXXXXXPPP--PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSX 841 PPP P P PP P PPP P PPP +P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 551 Query: 842 PPP 850 PPP Sbjct: 552 PPP 554 Score = 45.6 bits (103), Expect = 6e-05 Identities = 34/124 (27%), Positives = 35/124 (28%), Gaps = 7/124 (5%) Frame = +2 Query: 500 PXPXXXXAXXPPPS---PXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXX 670 P P PPP P P P P P P P P P P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPP-PGAPHPRVPPPGAPHPR 520 Query: 671 XXXXXXXXXXXPPP--PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXS 838 PPP P P PP P PPP P PPP +P Sbjct: 521 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPR 580 Query: 839 XPPP 850 PPP Sbjct: 581 VPPP 584 Score = 45.2 bits (102), Expect = 7e-05 Identities = 37/137 (27%), Positives = 38/137 (27%), Gaps = 6/137 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP P P P P P P P P P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRV 501 Query: 674 XXXXXXXXXXPPP--PXPXAPPXPXXXXP--PPPXXPXXXXXXXPPXXXXPPPXSPPXSX 841 PPP P P PP P P PPP P PP P PP + Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPP-PGAPHPRVPPPGAPHPRV---PPPGAPHPRVPPPGAS 557 Query: 842 PPPXPXXXXXXXXPPPP 892 P P PPP Sbjct: 558 HPRVPPPGAPHPRVPPP 574 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/113 (28%), Positives = 33/113 (29%), Gaps = 6/113 (5%) Frame = +2 Query: 530 PP--PSPXXSPXXXPXPXXPXX--PXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXX 697 PP P P P P P P P P P P P PP Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVP-PPGAPHPRVPPPGAPHPRV 481 Query: 698 XXPPPPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P P P PP P PPP P PPP +P PPP Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 43.6 bits (98), Expect = 2e-04 Identities = 38/138 (27%), Positives = 39/138 (28%), Gaps = 7/138 (5%) Frame = +2 Query: 500 PXPXXXXAXXPPPS---PXXSPXXXPXPXXPXX--PXPXXXXPXXPXXXXPXPPXXXXXX 664 P P PPP P P P P P P P P P P PP Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVP-PPGAPHPR 510 Query: 665 XXXXXXXXXXXXXPPPPXPXAPPXPXXXXP--PPPXXPXXXXXXXPPXXXXPPPXSPPXS 838 P P P PP P P PPP P PP P PP + Sbjct: 511 VPPPGAPHPRVPPPGAPHPRVPP-PGAPHPRVPPPGAPHPRV---PPPGASHPRVPPPGA 566 Query: 839 XPPPXPXXXXXXXXPPPP 892 P P PPP Sbjct: 567 PHPRVPPPGAPHPRVPPP 584 Score = 41.9 bits (94), Expect = 7e-04 Identities = 36/137 (26%), Positives = 37/137 (27%), Gaps = 6/137 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP P P P P P P P P Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 531 Query: 674 XXXXXXXXXXPPP--PXPXAPPXPXXXXP--PPPXXPXXXXXXXPPXXXXPPPXSPPXSX 841 PPP P P PP P P PPP P PP P PP + Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPP-PGASHPRVPPPGAPHPRV---PPPGAPHPRVPPPGTP 587 Query: 842 PPPXPXXXXXXXXPPPP 892 P P PPP Sbjct: 588 HPRVPPPGAPHPKVPPP 604 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/121 (24%), Positives = 31/121 (25%), Gaps = 6/121 (4%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPX----PPXXXXXXXXX 673 P A PPP P P P P P P PP Sbjct: 374 PGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPP 433 Query: 674 XXXXXXXXXXPPPPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 P P P PP P PPP P PPP +P PP Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 493 Query: 848 P 850 P Sbjct: 494 P 494 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/126 (25%), Positives = 33/126 (26%), Gaps = 5/126 (3%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXXXXXXXXXXXX 703 PPP P P P P P P P P P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 491 Query: 704 PPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXX 874 PPP P PP PPP P PP P PP + P P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRV---PPPGAPHPRVPPPGAPHPRVPPPGAPH 548 Query: 875 XXPPPP 892 PPP Sbjct: 549 PRVPPP 554 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/134 (24%), Positives = 33/134 (24%), Gaps = 3/134 (2%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP P P P P P P P P P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 551 Query: 674 XXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP-PP 850 PPP P P P P P P P P P PP P Sbjct: 552 PPPGASHPRVPPPGAPH-PRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQR 610 Query: 851 XPXXXXXXXXPPPP 892 P PPP Sbjct: 611 LPYSGAYHPRLPPP 624 Score = 39.5 bits (88), Expect = 0.004 Identities = 35/133 (26%), Positives = 37/133 (27%), Gaps = 16/133 (12%) Frame = +2 Query: 500 PXPXXXXAXXPPPS-------PXXSP---XXXPXPXXPXXPXPXXXXPXXPXXXXPXP-- 643 P P + PPP P P P P P P P P P P Sbjct: 352 PYPGSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRV 411 Query: 644 PXXXXXXXXXXXXXXXXXXXPPP--PXPXAPP--XPXXXXPPPPXXPXXXXXXXPPXXXX 811 P PPP P P PP P PPP P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 471 Query: 812 PPPXSPPXSXPPP 850 PPP +P PPP Sbjct: 472 PPPGAPHPRVPPP 484 Score = 39.5 bits (88), Expect = 0.004 Identities = 35/143 (24%), Positives = 38/143 (26%), Gaps = 12/143 (8%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PP + P P P P P P P P P Sbjct: 362 PPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRV 421 Query: 674 XXXXXXXXXXPPP--PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP---- 829 PPP P P PP P PPP P PPP +P Sbjct: 422 RPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 481 Query: 830 --PXSXPPPXPXXXXXXXXPPPP 892 P + P P PPP Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPP 504 Score = 37.9 bits (84), Expect = 0.011 Identities = 36/133 (27%), Positives = 36/133 (27%), Gaps = 16/133 (12%) Frame = +2 Query: 500 PXPXXXXAXXPPPS---PXXSPXXXPXPXXPXX--PXPXXXXPXXPXXXXPXP------- 643 P P PPP P P P P P P P P P P P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRV 561 Query: 644 PXXXXXXXXXXXXXXXXXXXPPP--PXPXAPPXPXXXXP--PPPXXPXXXXXXXPPXXXX 811 P PPP P P PP P P PPP P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP-PGAPHPKVPPPGAPYQRLPYSGAYHPR 620 Query: 812 PPPXSPPXSXPPP 850 PP PP PP Sbjct: 621 LPPPGPPYQRVPP 633 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVP--PPGAP 477 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVP--PPGAP 487 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVP--PPGAP 497 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVP--PPGAP 547 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP-HPRVP--PPGAP 597 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPP 887 PPP P P P PPP P P PPP P P P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPX-------PPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP PP P PP P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPP-------XPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP PP P PP P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPP------XPPPXXPPP--XPPXXPXXPXXPPXXP 896 PPP P P P PPP PPP P P PP P PP P Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +3 Query: 753 PPPXXXPPXXXXPX-PPXXXXPPPXPPPXXPPPX--PPXXPXXPXXPPXXP 896 P P PP P PP P PPP P P PP P PP P Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXP 875 PPP P P P PPP P P PPP P P Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPX-------PPXXPXXPXXPPXXP 896 PPP P P PPP P P PPP PP P PP P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 11/56 (19%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-----------PXXPPPXPPXXPXXPXXPP 887 PPP P P P PPP P P PPP PP P P Sbjct: 582 PPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAP 637 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P P PPP PP PP PP P Sbjct: 300 PPPQYMPHPRMRP-PTRIPPPGMGPPPRIPP--PPIRAPVDVYPPRAP 344 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/120 (26%), Positives = 35/120 (29%), Gaps = 1/120 (0%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PP+P +P P P P P P P P P Sbjct: 177 PKPPAPSTIPTPPTP-PAPPSPPIPTAPPTP-PMPETPLPPGSPHIPPAPLHPHIPPAPP 234 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXP-PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P PP P P P P PP P PP P P +P PP P Sbjct: 235 NPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNP 294 Score = 44.8 bits (101), Expect = 1e-04 Identities = 40/150 (26%), Positives = 41/150 (27%), Gaps = 9/150 (6%) Frame = +2 Query: 470 PXKKXXXXXXPXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXP----XXXXP 637 P K P P A PPSP P P P P P P P P Sbjct: 176 PPKPPAPSTIPTPPTPPA---PPSPPI-PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Query: 638 XPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPP-XPXXXXPPPPXXPXXXXXXXPPXXXXP 814 PP P P P PP P PP P P P P Sbjct: 232 APPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAP 291 Query: 815 P----PXSPPXSXPPPXPXXXXXXXXPPPP 892 P P +PP P P PP P Sbjct: 292 PNPYIPPAPPNLFIPSAPPNPHIPPAPPNP 321 Score = 44.0 bits (99), Expect = 2e-04 Identities = 38/146 (26%), Positives = 40/146 (27%), Gaps = 15/146 (10%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXX--SPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXX 673 P P PP SP +P P P P P P P PP Sbjct: 204 PTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPP 263 Query: 674 XXXXXXXXXXPP------PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP------ 817 PP PP P P P PP P PP PP Sbjct: 264 ASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPY-IPPAPPNLFIPSAPPNPHIPPAPPNPY 322 Query: 818 -PXSPPXSXPPPXPXXXXXXXXPPPP 892 P +PP PP P PP P Sbjct: 323 IPTAPPNPSIPPAPPNPSIPPAPPNP 348 Score = 40.7 bits (91), Expect = 0.002 Identities = 34/124 (27%), Positives = 35/124 (28%), Gaps = 5/124 (4%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXS-PXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXX 676 P P PP +P P P P P P P P P P P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAP-PNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Query: 677 XXXXXXXXXPPPPXPXAPPXPXXXXPPP--PXXPXXXXXXXPPXXXXP--PPXSPPXSXP 844 P P P APP P PP P PP P PP P P Sbjct: 302 NLFIPSAP-PNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIP 360 Query: 845 PPXP 856 P P Sbjct: 361 PATP 364 Score = 39.1 bits (87), Expect = 0.005 Identities = 34/137 (24%), Positives = 37/137 (27%), Gaps = 8/137 (5%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PP+P + P P P P P P P Sbjct: 222 PAPLHPHIPPAPPNPSKA-IATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Query: 680 XXXXXXXXPPPPXPXAPPXP----XXXXPP----PPXXPXXXXXXXPPXXXXPPPXSPPX 835 PP P PP P PP PP P PP PP +PP Sbjct: 281 APPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPP--APPN 338 Query: 836 SXPPPXPXXXXXXXXPP 886 PP P PP Sbjct: 339 PSIPPAPPNPSIPPAPP 355 Score = 36.7 bits (81), Expect = 0.026 Identities = 32/132 (24%), Positives = 32/132 (24%), Gaps = 7/132 (5%) Frame = +3 Query: 522 PXXPXXPPXPXXXXXXPXXP-PXXXXPXXXXXXXXXXLSPXPPPLXXXXXXXXXXXXXXX 698 P P PP P P P P P L P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPM 247 Query: 699 XXXXXXXXXXXXXXXXPXPPPXXXP--PXXXXPXPPXXXXPPPXPPPXXPPPXP----PX 860 P P P P P PP P P P PP P P Sbjct: 248 PETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPS 307 Query: 861 XPXXPXXPPXXP 896 P P PP P Sbjct: 308 APPNPHIPPAPP 319 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP-PXXPXXPXXPPXXP 896 P P P P PP PP P P PP P P P P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P P P P P P PP P P PP P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPA-PLHPHIPPAPP 234 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-PXXP-PPXPPXXPXXPXXPPXXP 896 P P PP P P PP PP P P PP P P P P P Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP P P P PP P PP P P PP P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP-APPNPSIPPAPP 355 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P P PP P P PP PP PP PP P P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPX-PPXXXXPPPXPPPXXPPPXP-PXXPXXPXXPPXXP 896 P P PP P PP PP P P P P P P P P P Sbjct: 292 PNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP 343 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXP--PPXXPPPXPPXXPXXPXXPPXXP 896 PP P P P PP P PP P P P P PP P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP-PPXPXXXXXXXXP 883 PP P P PP PP PP + P + P P P P Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Query: 884 PPP 892 P P Sbjct: 222 PAP 224 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 532 PXXP-PXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P + P P PP P P P P PP P Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPP 639 PAP AP P + P P PP P P P P PP Sbjct: 316 PAPPNPYIPTAPPNPS-IPPAPPNPSIPPAPPNPSIPPAPPNLFIPP 361 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PP PPP PPP PPP PP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP PPP PPP PP P P PP P Sbjct: 464 PPPPP---PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PPP PP P PP PPP PPP PPP PP Sbjct: 464 PPPPPPPPPPPPPPPP----PPPPPPPPFPPPPPP 494 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 PPP PP P PP PPP PPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPP--PPPTP 496 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 PP P PP PPP PPP PP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P PP PPP PPP PPP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPP-PPPPFPPPPPPTP 496 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P PP P PPPP P PP PPP PP PPP P Sbjct: 464 PPPPPPPPPPPP----PPPPPPP-------PP----PPPFPPP---PPPTP 496 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P PP P P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P PP P P PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P PP P P PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 529 APXXPPXLXXXXPXPXXPPXPXPPXXXPXXP 621 AP PP P P PP P PP P P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 520 GXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXP 621 G P PP P P PP P PP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 571 PXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P PP P PP P P PP P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 541 PPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 PP P P PP P PP P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP--PPPPTP 496 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 580 PPXPXPPXXXPXXPXXXXPPXPXXSXP 660 PP P PP P P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXP 613 PPP P P P P P P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P PPP P PP PPP PPP PPP P P P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP P PPP PPP PP PP P Sbjct: 290 PVPPPP--PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P P PP PPP P PP PPP PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 752 PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P PP P PP PP +PP PPP P PPPP Sbjct: 290 PVPPPPPADGSAPAPPPPP-PPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP + P P PPP PP PPP PP PPP P P Sbjct: 293 PPPPADGSAPAP-----PPP----------PPPGGAPPPPPPP---PPPPPGDGGAPPPP 334 Query: 884 PPP 892 PPP Sbjct: 335 PPP 337 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP P P PPPP PP PPP + PPP P Sbjct: 292 PPPPPADGSAPAPPPPPPP-----GGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P P G PP P P PP P PP P PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP---PPPPP 337 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/61 (26%), Positives = 17/61 (27%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 P P P P P P PP + PPP P PPP Sbjct: 261 PSVPQGLDLPDVLEHDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Query: 890 P 892 P Sbjct: 321 P 321 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 505 PXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P G AP PP PP P PP P P PP P Sbjct: 281 PDIVTGGGAPVPPP--PPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 45.6 bits (103), Expect = 6e-05 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = +2 Query: 704 PPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPP-PXSPPXSXPPPXPXXXXX 871 PPPP A PP P PPPP P PP PP P P S PPP P Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPP--PPPGGSAPPPGGGAPPLPPPPGGSAPPPPP----P 987 Query: 872 XXXPPPP 892 PPPP Sbjct: 988 PPPPPPP 994 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 PPP P PP PPPP PP PPP PP PP P PP Sbjct: 920 PPPPP--PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPP-PGGGAPPLPPP 976 Query: 887 P 889 P Sbjct: 977 P 977 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 5/68 (7%) Frame = +2 Query: 704 PPPPX---PXAPPXPXXXXP--PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXX 868 PPPP P PP P P PPP PP PPP PPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 869 XXXXPPPP 892 PPPP Sbjct: 983 PPPPPPPP 990 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 1/105 (0%) Frame = +2 Query: 539 SPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPX 718 SP +P P P P P PP PPPP Sbjct: 899 SPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Query: 719 PX-APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P + P P PP P PP PPP PP PPP Sbjct: 959 PGGSAPPPGGGAPPLPP---------PPGGSAPPPPPPPPPPPPP 994 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPP--XPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P PP PPP PP PPP P P PP P Sbjct: 945 PPPPGGNAPPP---PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXX---------PPPXPPXXPXXPXXPPXXP 896 P PPP P PP PPP PPP PP PP P PP P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP P PP P P PPP P P P PP P Sbjct: 914 PPGGSVPPP---PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 35.1 bits (77), Expect = 0.078 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P A P P PPPP P PP PP S P PPP PPPP Sbjct: 910 PSASP-PGGSVPPPPPPPGGNAPLPPP----PPGGSAPSQPPPP---GGNAPPPPPPP 959 Score = 35.1 bits (77), Expect = 0.078 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 747 PXPPPXXXPPXXX---XPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP PP P PP P PPP P PP P PP Sbjct: 920 PPPPP---PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 P P A PPP P S P P P P P P PP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXX--PPXPXPPXXXPXXPXXXXPPXP 645 P+ G AP PP P P PP P PP P PP P Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P G AP PP P PP P PP P PP P Sbjct: 931 PLPPPPPGGSAPSQPP-----PPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 797 PXXXXPPPXSPPX-SXPPPXPXXXXXXXXPPPP 892 P P SPP S PPP P PPPP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPP 936 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG G G GG G GG GG G G G GGG Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGG 81 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG-XGXXXXGXGXXGGG 753 G GG G G GG GGG G G GGGG GG G G G GG Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/66 (36%), Positives = 25/66 (37%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G G GGG + GG GGG GG G G G G G Sbjct: 44 GNGGGAGNGVGAGGCGCGGGND-GGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Query: 720 GXGGGG 703 G GG G Sbjct: 103 GSGGVG 108 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG G G GG G G GG G G GGG G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -1 Query: 885 GGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG 709 GG G GGG GG G G G G GGGG G GG G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GG G G GGG G G G GG GGG G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G G G G G GG GGGG G GA G G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 711 GGG 703 GG Sbjct: 95 AGG 97 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G GGG GGG G G GG G G GGG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGG-AGNGVGAGGCGCGGGNDGGNGGGGAGNGG 77 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G G G G G G G G GG G G G G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNG 85 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G G GG GGG G G GGG GG G GGGG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GG G G G GG GG G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNG 76 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G GG GGG GG G G G G GG Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G G GG GGG GG G GG GG G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGG--GXXXXGGXGXXXXGGXXXGGGXG 746 G GG G GG GGG GG G G G G GG GG G Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXG-GGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GG G GG G G G G GG GG G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGG 78 Score = 36.3 bits (80), Expect = 0.034 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXXX 676 G GGG GG GG G G GGG G GGA GGGG Sbjct: 33 GVGGGGVGGG--GGNGGGAGNGVGAGGCG-CGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Query: 675 XXXXXXXGXXGGXGXXXXGXXG 610 G GG G G G Sbjct: 90 AAGAGAGGNVGGGGSGGVGGNG 111 Score = 36.3 bits (80), Expect = 0.034 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGG-GXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG GGG G G GG G G GG GGG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 36.3 bits (80), Expect = 0.034 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGG-GXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGX 715 GGG G GG GG GG G G G G G G GG G Sbjct: 42 GGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGG 101 Query: 714 GGGG 703 GG G Sbjct: 102 GGSG 105 Score = 35.1 bits (77), Expect = 0.078 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG G G G G GG GGG GG GG G Sbjct: 78 GGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGG G G G GG GG G G G GG G G+ Sbjct: 57 GCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGS 115 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/63 (39%), Positives = 26/63 (41%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G G + GG GGG GG G GGG G GG G G Sbjct: 53 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG---GDGGGGGDG 109 Query: 711 GGG 703 GGG Sbjct: 110 GGG 112 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = -2 Query: 899 GGXXGGXGXXX-----GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G GGG GG GGGG GG G G G GG G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGG---XGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GG GGG GGG GGGG G G G G GGG G Sbjct: 60 GDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG + G+ G G G GGGG G GG GGGG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GGG G G G G GG GGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDG 87 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 837 EXGGEXGGGXXXXGG--XXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GG+ GGG G G GGG GG G GGGG Sbjct: 46 DSGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGG 92 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GG G G G GGG G G G GG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDG 95 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG G G G G G GGG G Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGG 85 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 45.2 bits (102), Expect = 7e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GGG GGG GGGG G G G GGG Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GGG GGG GGG G G G G GGG Sbjct: 105 GSSRGGYGGGRGG-GGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G GG GGG GGG GGG GG G G GGG G Sbjct: 95 GYRSGGGGYGGSSRGGYGGGRGGGGYGGG---RGGGGYGGGRGGGYGGGRRDYGG 146 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G GG G GGG GGGG GG G G G GG Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGG-YGGGRGGGGYGGGRGGG 136 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G GG G GGG GGG G G GG G G G Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG GG G G GG G GG GG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG 126 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GG GG G G GGG G GG G GGG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGG 136 Score = 34.3 bits (75), Expect = 0.14 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGG-GXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G G GG G GG G G GGG GG G G GG G GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGG---RGGGGYGGGRGGGGYGGGRGGGYGGG 140 Query: 723 XGXGGGG 703 GGG Sbjct: 141 RRDYGGG 147 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 45.2 bits (102), Expect = 7e-05 Identities = 25/63 (39%), Positives = 26/63 (41%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G G + GG GGG GG G GGG G GG G G Sbjct: 68 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG---GDGGGGGDG 124 Query: 711 GGG 703 GGG Sbjct: 125 GGG 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = -2 Query: 899 GGXXGGXGXXX-----GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G GGG GG GGGG GG G G G GG G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGG---XGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GG GGG GGG GGGG G G G G GGG G Sbjct: 75 GDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG + G+ G G G GGGG G GG GGGG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GGG G G G G GG GGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDG 102 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -1 Query: 837 EXGGEXGGGXXXXGG--XXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GG+ GGG G G GGG GG G GGGG Sbjct: 61 DSGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGG 107 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GG G G G GGG G G G GG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDG 110 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG G G G G G GGG G Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGG 100 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 886 GGXXGXXGXXGGXGG-GXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GG G GGG GGG GG G GG GGG G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGG-EGGGGRGRGTGGGSRGGGGDG 196 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GGG GG GGG G G GG G G G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G GG G G GG GGG GG G G GGG G Sbjct: 123 GVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEG 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G G G G G GG G GG GG G G G GG Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G GG GG GG GGG GG G G GGG G Sbjct: 148 GRGGGRGRGGGE-GGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRG 200 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG G G G GG GGG G G GGG GG G Sbjct: 160 GGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G G G GG G G G GG GG G G GGG Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXG-GXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG G G G G G GG GGG GGGG G G G G G Sbjct: 150 GGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGG G GGG GG GG G G GGGG GG+ G G Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGN--GGGRGGGEGGGGRGRGTGGGSRGGG 193 Query: 711 GGG 703 G G Sbjct: 194 GDG 196 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG G GGG GG G GG G G GG G GG G Sbjct: 134 GRGGGEGNGA--GGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRG 182 Score = 37.1 bits (82), Expect = 0.019 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 1/108 (0%) Frame = -1 Query: 819 GGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG-GGGXXXXXXXXXXXXXXXXGXXG 643 G G G G GG G GG G G GGG G G Sbjct: 107 GYGAKRENGMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRG 166 Query: 642 GXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGGGXXAXXXXGXG 499 G G G G G G G G G G GG G G Sbjct: 167 GNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEERTRIEGYG 214 Score = 35.9 bits (79), Expect = 0.045 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G GG G GGG G GG GG G GGG G G G G Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRG-GGGDGRGRG 200 Query: 711 GGG 703 GG Sbjct: 201 RGG 203 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -2 Query: 899 GGXXGGXGXXXGXXG---GXGGGXXGGGXGGGGXXXGG 795 GG GG G G G G GGG GGG G G GG Sbjct: 166 GGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 883 GXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG GG GG GGG GG G G GG G Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGR--GGGEGGGGRGRGTGGGSRG 191 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGG 727 G GGG G GG GG GGG G GGG G GG Sbjct: 146 GIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXX-XGXGGAXGXGGGG 703 GG + GG GG GG G GGG G GG G GG G Sbjct: 122 GGVQRGGR-GGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNG 169 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G G GGG G G G G GG GGG G Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNG----AGGGIGRGGGRGRGGGEG 160 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GGG GGG GGGG G G G G GGG Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGY--GGGRRDYGGGSKGGG 241 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGG--GGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G GGG G GG GG GG G G G GGG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG--GXXXGGXGXXXXGXGXXGGG 753 G GG G GG G GGG GGG G GG G G GGG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/48 (43%), Positives = 22/48 (45%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GGG + GG GG GG G GGGG G GG G GGG Sbjct: 184 GGGSQGGGYRSGGGGY-GGSSRGGYGGGRGGGG-YGGGRGGGGGYGGG 229 Score = 35.1 bits (77), Expect = 0.078 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G GG G GGG GGG G G GG G G Sbjct: 190 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GGG GG G GGG GG G GG G Sbjct: 185 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GGG GG G G GG G GGG G GG GGG Sbjct: 189 GGGYRSGG-GGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G GGG G G GG G G GG GG+ G G Sbjct: 183 GGGGSQGGGYRSG-GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 825 EXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 E GGG GG G G GG G GG G GG G Sbjct: 181 ERGGGGSQGGG----YRSGGGGYGGSSRGGYGGGRGGGGYG 217 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP P P PP PPP P P P PP P Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP-PRMQPPGPPGPPGPP 1287 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXP-PPXPPXXPXXPXXPPXXP 896 PPP PP PP PP PP P PP PP P P P P Sbjct: 1235 PPP---PPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +2 Query: 707 PPPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP P PP P PPP PP PP PP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP P PP P PP P P PP PPP P PP Sbjct: 1235 PPPPPAM--PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 6/57 (10%) Frame = +2 Query: 704 PPPPX--PXAPPXPXXXXPPPPXX----PXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P PP PPPP P PP P P PP P P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP-GPPGPQP 1291 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXX--PPPXPPXXPXXPXXPPXXP 896 P PPP P PP PP PP PPP P P P PP P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAM--PPDGPPKFMGLPPPPPGMRP-MPPQPPFMP 1270 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP-PPXPXXXXXXXXPPPP 892 P PP PP P P PPP PP P PP P PPPP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPP--PPGMRPMPPQP-----PFMPPPP 1273 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P P PP + P P PP P P P P P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQP 1277 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPP P PP PPP P PP PP PP + PPP P P Sbjct: 168 PPPIFPIDPP----RTQPPPIPPIDPPRTQPPPI---PPIDPPRTQPPPIPPIDPPRTQP 220 Query: 884 PP 889 PP Sbjct: 221 PP 222 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP--PPXSPPXSXPPPXPXXXXXXX 877 P P P P P PP P PP P PP PP + PPP P Sbjct: 147 PTTPAPMTLP-PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRT 205 Query: 878 XPPP 889 PPP Sbjct: 206 QPPP 209 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP--PXPPPXX-PPPXPPXXPXXPXXPPXXP 896 P PP PP PP PP P PP PPP PP P PP P Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPP--PXPPP-XXPPPXPPXXPXXPXXPPXXP 896 P P PP PP PP P PP PPP PP P PP P Sbjct: 150 PAPMTLPPISPID-PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-------PXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P P PPP PP P PP P P PP P Sbjct: 160 PIDPPRTQPPPIF-PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 P P P PP P P P PPP PP PP P P P P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP-IPPIDPPRTQPPPIFPQPTTP 230 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P P P PP PP PP PP P PP P Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP-RTQPPPIPPIDP 202 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP--PP 892 P +P P PPP PP PP + P PP P PP PP Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PP P P P PP P PP PPP P + P P Sbjct: 185 PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP-RTQPPPIFPQPTTPAP 232 Score = 30.7 bits (66), Expect(2) = 0.21 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 P PP PP PP PP P P P P Sbjct: 199 PIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +1 Query: 499 PAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPP 639 PAP +P PP P PP PP P P PP Sbjct: 150 PAPMTLP-PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPP 195 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPP 639 P P P PP P PP PP P P PP Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPP 221 Score = 21.8 bits (44), Expect(2) = 0.21 Identities = 11/44 (25%), Positives = 12/44 (27%) Frame = +3 Query: 522 PXXPXXPPXPXXXXXXPXXPPXXXXPXXXXXXXXXXLSPXPPPL 653 P P PP P PP P P PP+ Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPI 200 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 PPP PP P PP PPP PPP PPP P Sbjct: 1157 PPPPPPPP----PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PPP PPP P P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PPP PPP P P PP P P P Sbjct: 1157 PPPPP---PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P PP P PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 34.3 bits (75), Expect = 0.14 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P + P P PPPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P PP PPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P PP PPPP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P P P PPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +2 Query: 704 PPPPXPXAP-PXPXXXXPPPPXXP 772 PPPP P +P P P PPPP P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 571 PXXPPXPXPPXXXPXXPXXXXPPXP 645 P PP P PP P P PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P PPPP PP PP PP PPP P Sbjct: 1157 PPPPP---PPPP----------PPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 812 PPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PPP PP S P P P PPPP Sbjct: 1161 PPPPPPPPSSPSPPP---PPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P PP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P P P P PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 580 PPXPXPPXXXPXXPXXXXPPXPXXSXP 660 PP P PP P P PP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P P PP P P P P PP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXP 613 PPP P P P P P P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 42.7 bits (96), Expect = 4e-04 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 6/125 (4%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGG---XXXXGXGGAXGXG-GGGXXXXX 688 G G G GG GGG G G GGG G GG G G GGG Sbjct: 32 GMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGE 91 Query: 687 XXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXG--EXXGXGGGXXAXX 514 GG G G G G G G G G GGG A Sbjct: 92 GMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGE 151 Query: 513 XXGXG 499 G G Sbjct: 152 GMGGG 156 Score = 38.3 bits (85), Expect = 0.008 Identities = 35/127 (27%), Positives = 35/127 (27%), Gaps = 4/127 (3%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXG---GGXXGGGXGGGGXXXGGXG-XXXXGXGXXGGGXXXXXGXX 729 G G G G G G GG G G GGGG G G G G GGG Sbjct: 56 GGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSR 115 Query: 728 XXXXXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXGXXXXR 549 E G GG G G G G GG G Sbjct: 116 GGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGG-GGIAGEGIS 174 Query: 548 XGGXXGA 528 G GA Sbjct: 175 GGAIFGA 181 Score = 36.3 bits (80), Expect = 0.034 Identities = 35/117 (29%), Positives = 35/117 (29%), Gaps = 5/117 (4%) Frame = -2 Query: 899 GGXXGGXGXXXGXXG-GXG-GGXXGGGXGGGGXXXGGXG-XXXXGXGXXGGGXXXXXGXX 729 GG GG G G G G GG G G GGGG G G G G GGG Sbjct: 36 GGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGR 95 Query: 728 XXXXXXXXXXXXXXXXXXXXXXXGXEXXGXGG--XXXXGXXGXXXGGXGXGGXXGXG 564 E G GG G G G G GG G G Sbjct: 96 GGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEG 152 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -3 Query: 895 GXXGGXXGXXGXXG-GXG-GGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G GG G G G G G GG G G GGG G G G GGG Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGG 86 Score = 32.3 bits (70), Expect = 0.55 Identities = 34/134 (25%), Positives = 34/134 (25%), Gaps = 2/134 (1%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXXXXX 708 G G G G GG GGG G G GG G G GGG Sbjct: 27 GMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMA----GEGMGGGGMAGEGMGRGGMAGEG 82 Query: 707 XXXXXXXXXXXXXXXXGXEXXGXGGXXXXG--XXGXXXGGXGXGGXXGXGXXXXRXGGXX 534 E G GG G G G G GG G G G Sbjct: 83 MGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGGMAGEG 142 Query: 533 GAXXPXXXXGAGXG 492 G G G Sbjct: 143 MGGGGMAGEGMGGG 156 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGG--XGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G GG GG GGG G G G G GG G G G Sbjct: 26 GGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMG 74 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G G G GGG G G GGG G G G GG Sbjct: 132 GMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 42.3 bits (95), Expect = 5e-04 Identities = 31/108 (28%), Positives = 33/108 (30%), Gaps = 5/108 (4%) Frame = +2 Query: 539 SPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXX----P 706 +P +P P P P P P P P P PP P Sbjct: 893 APPTTPTT-PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP 951 Query: 707 PPPXP-XAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPP PP P PPPP P PP P PP S P Sbjct: 952 PPPTSALPPPIPATQVPPPPLPP--LPPPPPPVQTTTAPTLPPASCMP 997 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 5/68 (7%) Frame = +2 Query: 704 PPPPXPXAP-PXPXXXXPPPPXXPXXXXXXXPP----XXXXPPPXSPPXSXPPPXPXXXX 868 PPPP P AP P P PPPP P P P P + PPP P Sbjct: 908 PPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIP---- 963 Query: 869 XXXXPPPP 892 PPPP Sbjct: 964 ATQVPPPP 971 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 PP P P PP P PPP PPP PP P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P P PPP PP PPP P P PP Sbjct: 949 PTPPP---PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP-----XXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXX 868 PPPP P PP P P P PP PPP PPP P Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLP---- 973 Query: 869 XXXXPPPP 892 PPPP Sbjct: 974 PLPPPPPP 981 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXP-PPXXPPPXPPXXPXXPXXPPXXP 896 P P P PPP P P PPP PP P P P Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P P PPPP PP PPP P P P P Sbjct: 894 PPTTPTTPKPTTPAPPPPL--PLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTP 951 Query: 890 P 892 P Sbjct: 952 P 952 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P PPP P P P P PP P P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPP-PLPLAPEPPPPLPPPPPPIQTTRP 934 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 747 PXPPPXXX--PPXXXXPXPPXXXXPPPXPPP--XXPPPXPPXXPXXPXXPPXXP 896 P PPP P P P PPP PPP P P PP P Sbjct: 924 PPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPP 977 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 6/56 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXP------PPXXPPPXPPXXPXXPXXPPXXP 896 P P P PP PPP P PP P P PP P P Sbjct: 937 PTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GG GG GGG GG G G G GG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGG 186 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXG-GXXXXXXXGXXGGGGXXXXGXGGA 724 G GG G GGG E G GGG G G G GGG G G Sbjct: 152 GGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGY 211 Query: 723 XGXGGGG 703 GGG Sbjct: 212 GSYSGGG 218 Score = 32.3 bits (70), Expect = 0.55 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGX---GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G G GGG GGG GG G GGG G Sbjct: 170 GGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGG-GQGYGSYSGGGGGNYDYQG 226 Score = 30.3 bits (65), Expect = 2.2 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG-GA 724 G GG G GG GG+ GG G G GGG G G G+ Sbjct: 157 GYRGGRDRGGGYGGGGEGGYGMGGGDYSGG---CGYGSSYGGGGDYGGGPGYGGGQGYGS 213 Query: 723 XGXGGGG 703 GGGG Sbjct: 214 YSGGGGG 220 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 42.3 bits (95), Expect = 5e-04 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 6/126 (4%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP- 709 PP SP P P P P P P P PP P Sbjct: 261 PPRYPPSPLRYP-PIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLR 319 Query: 710 -PPXPXA-PPXPXXXXPPPPXXPXXXXXXXP-PXXXXPPPXSPPXSXP--PPXPXXXXXX 874 PP P PP P P PP P P P P P P S P PP P Sbjct: 320 YPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPS 379 Query: 875 XXPPPP 892 PP Sbjct: 380 PIRYPP 385 Score = 35.1 bits (77), Expect = 0.078 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP P P PP PP P P PP P Sbjct: 259 PSPPRYPPSPLRYPPIPP-RYPPSLIRYPTLPPRYPPSPPRYPPSPPRYP 307 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P P P P P P PP P P P P Sbjct: 300 PPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYP 349 Score = 33.1 bits (72), Expect = 0.31 Identities = 28/112 (25%), Positives = 28/112 (25%), Gaps = 3/112 (2%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP---PXXXXXXXXXXXXXXXXXX 700 PP P P P P P P P P P P P Sbjct: 289 PPRYPPSPPRYPPSP--PRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHP 346 Query: 701 XPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P PP P P P P PP S S P P Sbjct: 347 RYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYP 398 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPP--PXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP PP P P PP P P PP P Sbjct: 317 PLRYPPSPIR-YPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYP 363 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 753 PPPXXXPPXXXX--PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PP P PP P PP PP PP P P P P Sbjct: 322 PSPIRYPPLPSRYPPSPPRYPSSHPRYPPS-PPRYPPSPPRYPSSHPRYP 370 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P P P P P PP PP P P P Sbjct: 272 PPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYP 321 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXX--PPXXXXPPPXSPPXSXPPPXP 856 P P PP P P PP P PP PP PP PP P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPP--SPPRYP 307 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXG--GGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G G G G G GG GGGG GG G G GGG G Sbjct: 422 GGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDG 478 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXG-GGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GGG G GG GGG GG G GG G G G Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG--XGXXGGG 753 G G G G GG GG GGG GGG GG G G G GGG Sbjct: 433 GCSSGVGDGRGGDGGGDGG--GGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 G GG G G GG GGG GGG GGG G G Sbjct: 450 GGGGGDGGGDGIDGGDGGGD-GGGDGGGDGGGDGGG 484 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G GG G G GG GGG G GGG G G G G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 35.5 bits (78), Expect = 0.059 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G G G G G + GG+ GGG G G GGG G G G G Sbjct: 427 GDGDSDGCSSGVGDGRGGDGGGDGGGG----GDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Query: 711 GG 706 GG Sbjct: 483 GG 484 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGG---GXGGG 813 GG GG G G GG GGG GG G GGG Sbjct: 453 GGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G G G G G G GGG G GG G G GG Sbjct: 427 GDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGG 475 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G G GG GGG G GG G G GGG G Sbjct: 429 GDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GGG + G G G G GGGG G G G GGG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGG 468 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGG 793 G GGGG G GG + GG+ GG GG Sbjct: 448 GDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GGG GGG GG GG GG G G Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G G G GGG GGG GGGG GG G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 GG G G GG GGG GGG GGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G GG GGG GGG GGG GG G G G G Sbjct: 75 GGDTDGGGGCGGGGGG--GGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 GG G G G GG GG GGG GGGG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 G GG G G GG G G GGG GGGG Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 GG G G GG GG GGG GGG G G G G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXG 759 GG G G GGG GG GGGG GG G G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GGG GG G GG GG G G G GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDG 111 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GG + GG GGG GG G GGGG GG G GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGG--GGGGGGGDDCEDGGGDDGEDGG 120 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXG 759 GG GG G G GG GGG GGG G GG G G Sbjct: 81 GGGCGGGGGGGGGVGGGGGG--GGGGGDDCEDGGGDDGEDGGSDNDG 125 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G GG GGG GGGG GG G G GG Sbjct: 76 GDTDGGGGCGGGGG-GGGGVGGGGGGGGGGGDDCEDGG 112 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GGGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGG 104 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 798 GGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG G GGGG GG G GGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GG+ GG GG G GGGG G GG GGG Sbjct: 73 DGGGDTDGGGGCGGGGGGGGGVGGGGGGG----GGGGDDCEDGGG 113 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXP-PPXPPXXPXXPXXPP 887 P P P P PP PPP PP P PP PP P PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 P PP PP P PPP PP PPP P Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PPP P P PPP PP PP PP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 35.1 bits (77), Expect = 0.078 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P PPP PP P PP P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 758 PPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P P PP PPP P PP P PPPP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 704 PPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P PP P P PP PPP PP PPP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPP----------------PPPPEPPEECPPPPP 591 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P AP P PP + P P P PP P P PP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSED-PKPPPPPPEPPEECPPPPP 591 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 752 PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PPPP P PP PPP P + PPP P PPPP Sbjct: 662 PPPPPPPGGQAGGAPPP---PPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P PP PPP P PPP PP P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPP--PPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPPP P P PPPP P PP PPP PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPP----PPPIGGGAPPPPP 704 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP P PP PPP P PP PPP + PPP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPP----PPPPIGGGAPPPPPP 705 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PPPP P PPPP PP PP PP Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +3 Query: 795 PPXXXXPPPXPPPXX-----PPPXPPXXPXXPXXPPXXP 896 P PPP PPP PPP PP P PP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G GG GGG GGG GG G G G G G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNG 81 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG G G G GGG GGG GGGG GG Sbjct: 25 GGGGHGGGH--GYGGGPNGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GGG GGG G GG GG G G G GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGG--GGGGGGGGGGDEDDSG 60 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 G G G G GG GGG GGGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G GGG GG GGG GG G GG G Sbjct: 25 GGGGHGGGH---GYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNG 81 Query: 711 G 709 G Sbjct: 82 G 82 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXG 718 + GG GGG GG G GGGG G G Sbjct: 24 DGGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G G GG G GG G GGGG Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGGG 53 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGG G GG G GGGG Sbjct: 32 GHGYGGGPNGGGGGGGGGGGGGG 54 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G GG GGG GGG GGGG GG G G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXG 773 G G GG GGG GGG GGG GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 G G G G GG GGG GG GGGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 GG G G G GG GGG GGG GGGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGG--GGGRGGGG 364 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGG 755 GG G G GGG GGG GG G GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 833 GGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G GGGG GG G G G GGG G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GGGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGG 364 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGG 706 G GGGG G GG G GGG Sbjct: 344 GGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G G GG G GG G GGGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGG 359 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G G GG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGG 362 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG GGGG Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG 730 GG GG GGG GG G GGGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGG----GRGGGGGFSSRGRG 372 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 704 PPPPXPXAPPXPXX-XXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXX 880 PP P PP P PPPP P PP P SPP + P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNG 508 Query: 881 PP 886 PP Sbjct: 509 PP 510 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 10/58 (17%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP-PXPPXXPXXPXX---------PPXXP 896 P P PP P PP PPP P P PP P PP P P PP P Sbjct: 450 PLPSDEPP----PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP-PXXPXXPXXPPXXP 896 P P P P PP P PPP P P P P PP P Sbjct: 437 PLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLP-LPPELP 484 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 794 PPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP PP PP PP P P PP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP--XSXPPPXPXXXXXXXXPPPP 892 PP P PPP P PP PP PP P P P PP Sbjct: 449 PPLPSDE--PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P PP P PPPP P P PP PPP P Sbjct: 102 PPPPPPPPPPPP----PPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 PP PPP PPP PPP PP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 36.3 bits (80), Expect = 0.034 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 P PPP PPP PPP PP P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P PP PPP PPP PP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 35.9 bits (79), Expect = 0.045 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPP 845 PP P PP PPP PPP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 35.1 bits (77), Expect = 0.078 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 15/62 (24%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP---------------PXXPPPXPPXXPXXPXX 881 P PP P P PP PPP PP P PPP PP P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPP--PPAPCM 150 Query: 882 PP 887 PP Sbjct: 151 PP 152 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP P P PP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PPP PP P P PP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 529 APXXPPXLXXXXPXPXXPPXPXPPXXXP 612 AP PP P P PP P PP P Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = +2 Query: 581 PXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPP 760 P P P P P PP PPPP PP P PP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPP---PPPPPAPCMPPC 153 Query: 761 PXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP P PPP Sbjct: 154 HQTQVVHSVQLHASPPGPPP--APMPAPPP 181 Score = 28.7 bits (61), Expect = 6.8 Identities = 28/120 (23%), Positives = 29/120 (24%), Gaps = 6/120 (5%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXP----XXPXXXXPXPPXXXXXXXXX 673 P A PPP P P P P P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQ 155 Query: 674 XXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPP--XSPPXSXPP 847 PP P P P PPP P PPP +P PP Sbjct: 156 TQVVHSVQLHASPPGPPPAPMP---APPPMVVPSHRHVFHHVTHPAPPPMQMAPAPCMPP 212 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G GG GGG GGG GGG GG G GG Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGG 809 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GG GGG GGG GG G G G G Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRG 803 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG GG G G G GGG GGG GGG GG Sbjct: 757 GGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG GG G GG GGGG GG G G G GGG G Sbjct: 735 GGYGGGYNDRRMQQGGYGNRSGGGYRGGGGY--GGGGGGYRGGGGYGGGHRGGGG 787 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 883 GXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G G G GGG GGG GGG GG G GG GGG Sbjct: 749 GGYGNRSGGGYRGGGGYGGG-GGGYRGGGGYGGGHRGGGGYGGG 791 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G GG GGG GGG GGG GG G G GG G Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGG---GYGGGGHRGGSYSGYRG 803 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG GGG GGG GG G GG GGG G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYG 766 Score = 36.7 bits (81), Expect = 0.026 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG-GA 724 G GGGG GGG GG GGG GG G G G G G Sbjct: 758 GYRGGGGYGGGGGGYRGGGGY-GGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGG 816 Query: 723 XGXGGGG 703 G G GG Sbjct: 817 YGQGSGG 823 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG G G GG GGG GG G GGG G GG Sbjct: 734 GGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGY-GGGHRGGGGYGGGG 792 Query: 720 GXGG 709 GG Sbjct: 793 HRGG 796 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G GG GGG GG GGGG G G G G GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGG-GGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXG-----GGXXXXGGXXXXXXXGXXGGGGXXXXGXGG 727 G GG G GGG GG GG G G GGGG G G Sbjct: 719 GRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGY 778 Query: 726 AXGXGGGG 703 G GGG Sbjct: 779 GGGHRGGG 786 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 41.1 bits (92), Expect = 0.001 Identities = 35/135 (25%), Positives = 36/135 (26%), Gaps = 5/135 (3%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P A P PSP P P P P PP Sbjct: 981 PASRQSKAPIPHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQP 1040 Query: 680 XXXXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXS-----PPXSXP 844 PPP +PP P PPP P P PPP S PP P Sbjct: 1041 L--------PPPRKPSPP-PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Query: 845 PPXPXXXXXXXXPPP 889 P P PPP Sbjct: 1092 DPIPTNPAHPTEPPP 1106 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP-----PXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P PP PP P PPP P P P P P PP Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPI-PTNPAHPTEPP 1105 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/125 (25%), Positives = 32/125 (25%), Gaps = 5/125 (4%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXX--PXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXP 706 PP P P P P P P P P PP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSE---------- 1068 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP---PXSXPPPXPXXXXXXX 877 P P P PP P P PP P PPP P P P Sbjct: 1069 PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELH 1128 Query: 878 XPPPP 892 PPPP Sbjct: 1129 RPPPP 1133 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXX-PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP PPP P PP P P P PP P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/112 (25%), Positives = 29/112 (25%), Gaps = 2/112 (1%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P A PP + P P P P P P P PP Sbjct: 1026 PVPPKRKAS-PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQP 1084 Query: 680 XXXXXXXXPPPPXPXAP--PXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP 829 P P P P P P P P P P PPP P Sbjct: 1085 VPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKP 1136 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXX-PPXXXXPXPPXXX-XPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP PP P PP PPP P P PP P PP P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 35.9 bits (79), Expect = 0.045 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 747 PXPPPXXXP--PXXXXPXPPXXXXPPP--XPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP PPP PPP P PP P P P P Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP--PRQPDPIPTNP 1098 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PP P PPP P P P P P PP P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEP 1069 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 753 PPPXXXPPXXXX-PXPPXXXXPPPXPPPXXPPPXPPXXPXX-PXXPPXXP 896 P P PP P PP PP P PP P P P PP P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKP 1062 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXP--PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P PP P PP P P P P P P PP P Sbjct: 1062 PSPPPSEPAPPPRQPPPPSTSQPVPPPRQP--DPIPTNPAHPTEP--PPRQP 1109 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 6/66 (9%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPP---XXPXXXXXXXPPXXXXPPPXS---PPXSXPPPXPXXXXXX 874 P P P P PP P PP PPP + PP P P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 875 XXPPPP 892 PPP Sbjct: 1073 PRQPPP 1078 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P A PPPP P PPP P PPP P PPP Sbjct: 269 PPIPSASQNATPPPPPPP--PSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Query: 890 P 892 P Sbjct: 327 P 327 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P PPP PP PP PP P PP P Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 704 PPPPXPXAPP--XPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P P PPP P PP PPP P PPP P Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPP---TDFAPP----PPPPEPTSELPPPPP 327 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP 830 P PPP P P P PPP PP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = +2 Query: 635 PXPPXXXXXXXXXXXXXXXXXXXPPPPX----PXAPPXPXXXXPPPPXXP 772 P PP PPPP P PP P PPPP P Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 4/47 (8%) Frame = +3 Query: 747 PXPPPXXXP----PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PPP P P PP P PPP P P P P Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/66 (34%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEX----GGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G G G GGG + GG+ GGG GG G GGG GG+ Sbjct: 141 GDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGS 200 Query: 723 XGXGGG 706 G GGG Sbjct: 201 DGGGGG 206 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G G G G G G GGG G G G GG G GG G G Sbjct: 131 GDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGG 190 Query: 711 GGG 703 GG Sbjct: 191 SGG 193 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G G GG GGG GGGG G G G G GG Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDG---GGGGNDGG 210 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G GGG G G G G G G G G GG G Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G G G G G G GGG GG G G G G G Sbjct: 129 GDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGG 182 Score = 33.5 bits (73), Expect = 0.24 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGG G GGG G GG GG G GGGG GG G Sbjct: 155 GGGSDDGGDDDDGDGGG--SNGSGGGDDGGDGG----DDGGGSGGGGDDGGSDGGGGGND 208 Query: 711 GG 706 GG Sbjct: 209 GG 210 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG G G G G GG GGG GG GG Sbjct: 181 GGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G G GG G G GG G GG GG G Sbjct: 149 GDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDG 198 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXG----GGGXXXGGXGXXXXGXGXXGGG 753 G G G G G GGG GG GGG G G G GGG Sbjct: 139 GDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGG 190 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P P P P PPP P P P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPX-PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P PP PP P PPP PP P P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPP-PPGKPTKPTKPSLPP 824 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P P P P P PP PPP P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPP----PPPGKPTKPTKPSLP 823 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P P P P P PP P + P S PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP-SLPPVPP 827 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP A P PPPP P PP + S PPP P Sbjct: 679 PPPYSDVAMVPPVTRRPPPP-RPMAPKDASLHRASSPPGFTHKGSEPPPKP 728 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G G GG GGG GGG GGGG G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDG 344 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GGG GGG GGG G G G G G G Sbjct: 308 GGGGGDGG--GGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G G G GG GGG GGG GGG G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GGG GGG GGG G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG GGG GGG G G G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 36.3 bits (80), Expect = 0.034 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GGG GGG GGG G G G G Sbjct: 304 GDGDGGGGGDGG--GGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GGG GGG GGGG GG G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG+ GGG GG G G G G G G G Sbjct: 306 GDGGG---GGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG 730 G GGGG G GGG GG GGG G G G G G G Sbjct: 306 GDGGGGGDGG-----GGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GGG + GG GGG G G G G G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGG G GG G GGGG Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGG 326 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GG G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDG 328 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXP---PXXXXPPPXSPPXSXPPPXPXXXXXXX 877 PPP P APP PPP P P PPP +PP + PP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPPVTQGYNMSQY 197 Query: 878 XPP 886 PP Sbjct: 198 PPP 200 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPP 845 PP PPP PPP PP Sbjct: 171 PPGNYPPPPAPPPAYPP 187 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG G G GG GGG GGG GGGG GG Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGG--GGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G GGG G GG GG GG G G G GGG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG GG G G GG GGG GG GGG GG G G G G Sbjct: 312 GGGRGG-GYRSGGGGGYGGGRGGGRGYGGG--RGGGGRRDYGGGSRSG 356 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GGG GG G G GG G GG GG G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG 131 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGG + GG GG G G GGG G GG+ G G Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG GG GGG G G G G GGG G Sbjct: 313 GGRGGGYRSGG--GGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXG---GGGXXXXGXGGAXGXGGG 706 GG GGG GG G G GGG G GG GGG Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 828 GEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GE GGG GG G G GG G GG G GG G Sbjct: 89 GERGGGGSQGGG----YRSGGGGYGGSSRGGYGGGRGGGGYG 126 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG 709 + GG GGG GG G GGG G GG G GG Sbjct: 310 QRGGGRGGGYRSGGG-------GGYGGGRGGGRGYGGGRGGGG 345 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P PPPP P PP PP PP PP P PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPV-PPTEAPPTAPPTGGSCVSKPP 175 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PPP PP PP PP PP PP PP PP Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPX--PPPXXPPPXPPXXPXXPXXPP 887 PPP PP P PP P P PPP P P P P PP Sbjct: 122 PPP---PPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP 844 PPPP P P PP P P PP PP +PP + P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPP---VPPTEAPPTAPP 165 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PP P PP PPP P P P P P Sbjct: 123 PPPPTGTLPPPPVTP-PPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 476 KKXXXXXXPXPXXXXAXXPPP-SPXXSPXXXPXPXXPXXPXPXXXXP 613 KK P P PPP +P P P P P P P P Sbjct: 114 KKYLGGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAP 160 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 39.9 bits (89), Expect = 0.003 Identities = 28/101 (27%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 590 PXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXPXA--PPXPXXXXPPPP 763 P P P P P PPPP PP P PPP Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPR 480 Query: 764 XXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 P PP PP PP PPP P PP Sbjct: 481 GFPPPPFGPPPPFYRGPP---PPRGMPPP-PRQRMPSQGPP 517 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPPP PP P PP P P PPP PPP P Sbjct: 428 PPPPQHTGPPQPR----PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFP 483 Query: 884 PPP 892 PPP Sbjct: 484 PPP 486 Score = 36.3 bits (80), Expect = 0.034 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXX---PXPPXXXXPPP---XPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P PP PPP PPP PPP P P P P Sbjct: 452 PQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P PP PPPP PP PPP P PPP PPPP Sbjct: 446 PQGGGPPQLPPNLPPPPGG--MRGMPPPPMGMYPPPRGFP---PPPFGPPPPFYRGPPPP 500 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXP--PPXPPXXPXXPXXP 884 P PPP PP P PP PP P P P P PP P P P Sbjct: 30 PPPPPYEAPP--PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP P PP P P PP P P P P P P P Sbjct: 29 PPPP--PPYEAPPPPPGP--PGPDGPPGFPGPQGPNGPKGPPGLPGPP 72 Score = 34.7 bits (76), Expect = 0.10 Identities = 32/125 (25%), Positives = 33/125 (26%), Gaps = 4/125 (3%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPP P +P P P P P P P P P P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGP------PGFPGPQGPNGPKGPPGLPGP----------PG 73 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPP----XXXXPPPXSPPXSXPPPXPXXXXXXX 877 PP PP PP P PP P P PP PP P Sbjct: 74 PPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPP 133 Query: 878 XPPPP 892 P P Sbjct: 134 GPAGP 138 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = +3 Query: 747 PXPPPXXXPPXXXX-------PXPPXXXXPPPXPPPXXPP-PXPPXXPXXPXXPP 887 P PP PP P PP PP P P PP P P P P PP Sbjct: 604 PGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = +3 Query: 747 PXPPPXXXPPXXXX-------PXPPXXXXPPPXPPPXXPP-PXPPXXPXXPXXPP 887 P PP PP P PP PP P P PP P P P P PP Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP P PP PP P P PP Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPP-GPPGPKGPP 819 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP P PP PP P P PP Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPP-GPPGPKGPP 904 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP----PXSPPXSXPPP 850 PPPP P P P P P P P PP P PP PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPP 81 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXP-XPPXXXXPPPXPPPXXPP--PXPPXXPXXPXXPPXXP 896 P PP PP P P PP P P PP PP P PP P Sbjct: 42 PGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLP 94 Score = 32.7 bits (71), Expect = 0.42 Identities = 32/128 (25%), Positives = 33/128 (25%), Gaps = 18/128 (14%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXX--SPXXXPXPXXPXXPX--PXXXXPXXPXXXXPXPPXXXXXXX 667 P P A PPP P P P P P P P P P P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG 89 Query: 668 XXXXXXXXXXXXPP-------PPXPXAPPXPXXXXPPP-------PXXPXXXXXXXPPXX 805 PP PP P PP P PP P P P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPG 149 Query: 806 XXPPPXSP 829 PP +P Sbjct: 150 DVGPPGNP 157 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPP 887 P PP PP P PP PP P P P P P P PP Sbjct: 273 PGPPGDMGPP--GLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 318 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP--PXXPPPXPPXXPXXPXXPP 887 P PP PP P P PP PP P P P P P PP Sbjct: 188 PGPPGDMGPPGLPGPQGPQM---PPGPPGLPGAPGPKGPPGTNGPLGPP 233 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXP-PXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P PPP P P P P PP PP PP P P Sbjct: 38 PPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPP--PXXPXXXXXXXPPXXXXPP-PXSPPXSXPPPXP 856 P PP PP P PP P P PP P P PP + P P Sbjct: 349 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGP 402 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP P PP P P P PP Sbjct: 349 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP-GPKGPP 394 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP P PP P P P PP Sbjct: 434 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP-GPNGPP 479 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P PP P PP P P P PP Sbjct: 519 PGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP-GPNGPP 564 Score = 29.9 bits (64), Expect = 2.9 Identities = 28/115 (24%), Positives = 29/115 (25%), Gaps = 6/115 (5%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXP---XPPXXXXXXXXXXXXXXXXXX 700 P P+ SP P P P P P P Sbjct: 628 PGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGNPAGVQGPNG 687 Query: 701 XPPPPXPXAPPXPXXXXPPP--PXXPXXXXXXXPPXXXXPP-PXSPPXSXPPPXP 856 P PP PP PP P P PP PP P PP P P Sbjct: 688 QPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 789 PXPPXXXXPP----PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP P P P P P PP P Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPP 728 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 789 PXPPXXXXPP----PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP P P P P P PP P Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPP 813 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 789 PXPPXXXXPP----PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP P P P P P PP P Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPP 898 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 PP P P PP PP P PP P P P P P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGP 138 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 P PP P +PP P P PP P P PP + P Sbjct: 880 PGPPGPASPPSP----PGPPGPPGPKGPPGPNGCLGPPGDAGP 918 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 P PP PP P P P PP P P P P P Sbjct: 188 PGPPGDMGPPGLPGPQGPQ-MPPGPPGLPGAPGPKGP 223 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 P PP PP P P P PP P P P P P Sbjct: 273 PGPPGDMGPPGLPGPPGPQ-MPPGPPGLPGAPGPKGP 308 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 PP P P PP P P PP P P P P P Sbjct: 351 PPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGP 393 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 PP P P PP P P PP P P P P P Sbjct: 436 PPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGP 478 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP-PXXP 896 PP P P PP P P PP P P P P P Sbjct: 521 PPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGP 563 Score = 28.7 bits (61), Expect = 6.8 Identities = 30/131 (22%), Positives = 30/131 (22%), Gaps = 11/131 (8%) Frame = +2 Query: 533 PPSPXXS--PXXXPXPXXPXXPXPXXXXPXXPXXXXP-------XPPXXXXXXXXXXXXX 685 PP P P P P P P P P P PP Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGPG 586 Query: 686 XXXXXXPP--PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPX 859 P P P P P PP P P SPP PP P Sbjct: 587 YQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPK 646 Query: 860 XXXXXXXPPPP 892 P P Sbjct: 647 GPPGPNGPLGP 657 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 P PP P +PP P P PP P P PP P Sbjct: 710 PGPPGPASPPSP----PGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 P PP P +PP P P PP P P PP P Sbjct: 795 PGPPGPASPPSP----PGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPP 887 P P PP P PP PP P P P P P P PP Sbjct: 358 PGPLGDVGPPGL--PGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 403 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P PP P P P PPP PP PP PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P P P PP PPP PP PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 883 GXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG G GGG GG GG G GG GG G Sbjct: 802 GGMGMSG--GGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGG 845 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +3 Query: 789 PXPPXXXXP--PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PP PPP PP PP P P PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEP--PTPPPTDP 1055 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PP PP PP PP P P PP P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPP--PTEPPTPP 1051 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 731 PXPXXXXPP--PPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P P PP PP P PP P +PP + PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP P PPP P P P PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTP-PPTDPPTQP 1059 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PP PP PP P P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEP--PTPPPTEP 1047 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP 844 P P P PP PP P P PP PP + P + P Sbjct: 1016 PDPLPTDPPTEPPTDPPTP--PPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P PP PP PP P P PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPP--PTEPPTPP 1051 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/50 (28%), Positives = 16/50 (32%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P P P P P P PP P +PP + PP P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P P P PP PP P P PP P Sbjct: 1006 PTNPGTTTNVPDPLPTDPPTEPPTDP--PTPPPTEP 1039 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PP P P PP P PP P Sbjct: 1031 PPTPPPTEPPTPPPTEPPTP 1050 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 39.5 bits (88), Expect = 0.004 Identities = 33/128 (25%), Positives = 35/128 (27%), Gaps = 4/128 (3%) Frame = +2 Query: 521 AXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXX---PXPPXXXXXXXXXXXXXXX 691 A PPPS P P P P P P P Sbjct: 319 APAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPG 378 Query: 692 XXXXPP-PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXX 868 P PP P + P PPPP P PP + P PPP P Sbjct: 379 AGNGPGGPPPPWSKPGGILPGPPPPGPPMLNM-----APSIPPWQTTPGYIPPPPPGFPQ 433 Query: 869 XXXXPPPP 892 PPPP Sbjct: 434 FQPPPPPP 441 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXP----PXXXXPXPPXXXXPPPXPP----PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PP P PP P PP PP P PP P Sbjct: 387 PPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXP--PPXXPPPXPPXXPXXPXXPP 887 PPP P P PP PPP P PPP P P PP Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAP--PP 352 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP---PXPPPXXPPPXPPXXPXXPXXP 884 P PPP P P P P P PPP P PP P P Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP + P PPP P P PPP S PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTI--PSTLPPPPVPSATSAPPP 352 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 7/56 (12%) Frame = +2 Query: 704 PPPPXPXAP------PXPXXXXPPPPXXPXXXXXXX-PPXXXXPPPXSPPXSXPPP 850 PPPP P P P PPP P P PPP + S P P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +3 Query: 789 PXPPXXXXP---PPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P P PPP PP P P PP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPP 342 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPP-XXPPPXPPXXPXXPXXPPXXP 896 PPP P P PP PP PP P PP PP P Sbjct: 386 PPPPWSKPGGILPGPP-----PPGPPMLNMAPSIPPWQTTPGYIPPPPP 429 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GGG GGG GGG G G GGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG GGG GGGG G G GGG G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G GG GGG GGG G G G G G GGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GGG GGG G G GG GGG G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GGG GGG G G G G GGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G GG GGG GGG G G G G GGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G GGG GG GGG G GGGG G G G G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG GGG GG G G G G G GGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG GGG G GG G G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXX-----GGGXGGGGXXXGGXG 789 GG GG G G G G G GGG GGGG G G Sbjct: 48 GGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 837 EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 + GG GGG GG G G GG G GGG Sbjct: 40 DGGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 825 EXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 + GGG GG G G G A G GGGG Sbjct: 40 DGGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGGG G GGG GG+ G G GGG G G A Sbjct: 41 GGGGGGGGG------GGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDA 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXG 798 GG G G GGG GGG G G G Sbjct: 58 GGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 G GG GGG GGG GGGG GG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 GG GGG GGG GGGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGG 795 G GG GGG GGG GGGG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG G G GG GGG GGG GG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 854 GXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXG 759 G GGG GGG GGGG GG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GGG GGG GGGG GG G G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGG 812 GG G G GG GGG GGG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGG 810 G G G GG GGG GGG GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXG 819 GG GG G G GG GGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 32.7 bits (71), Expect = 0.42 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGG 815 G GG G G GG GGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GGGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GGGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 826 GXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GGG GG G GG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G GG G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGDG 79 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +2 Query: 704 PPPPXPXAPPX-PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXX 880 PPPP PP P PPP P P PPP PP P P Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGM---PGMGGMPPPGMPPPMPPGGMPPNMEQPPP 297 Query: 881 PPP 889 PPP Sbjct: 298 PPP 300 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 753 PPPXXXPPXXXXP--XPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PPP PP P P PPP PP PP P P PP Sbjct: 253 PPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 35.1 bits (77), Expect = 0.078 Identities = 31/136 (22%), Positives = 31/136 (22%), Gaps = 7/136 (5%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXX 685 P PP P P P P P P PP Sbjct: 216 PIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMP-PPGFPPMGMPGMGGM 274 Query: 686 XXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP-------PXSPPXSXP 844 PP P PP PPPP PP P P P P Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNPQHMGHQMMPGMMPQQFP 334 Query: 845 PPXPXXXXXXXXPPPP 892 P PPPP Sbjct: 335 PNLMWGMTGQTRPPPP 350 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPP--XPPPXXPPPXPPXXPXXP 875 P PP PP PPP PPP PPP P P Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFP 264 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPX----PPPXXPPPXPP-XXPXXPXXPPXXP 896 PP PP P P P PPP PPP PP P PP P Sbjct: 248 PPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP PP P PPP PP P P PP P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMP--PPGMP 280 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 707 PPPXPXA-PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PP P PP P P P P PP PPP P + PP P P Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPP-QPGYAGGPPPPGIAPGIGGP 81 Query: 884 PP 889 PP Sbjct: 82 PP 83 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 707 PPPXPXAPPXPXXXX-PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PP PP P PPPP P PP S P PP P Sbjct: 53 PPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPP 112 Query: 884 PP 889 PP Sbjct: 113 PP 114 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PP P PP PP P Sbjct: 69 PPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPPQP 116 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GG E GG GGG GG GGGG G GGGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG G GG GG GGG GGGG GG G Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGG 125 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG G G G GG GGG GGGG G G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G G GGG GGG G GG G G GGG Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G GG G G GG GGG GG G GGG G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GGG GG G GG G GGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G GG GG GGG GG GGGG GG G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGG---------GGGGGFYQDSYGGGGGGG 142 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 895 GXXGGXXGXXGXXG-GXGGGXXGGGXGGGXXXXGGXGXXXXGG 770 G GG G G G G GG GGG GGG G GG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXG-GGGXXXGGXGXXXXGXGXXGG 756 G G G GGG G GGG GG G G G GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 5/34 (14%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGG-----XXGGGXGGG 813 GG GG G G GG GGG GGG GGG Sbjct: 111 GGGYGGGGRSYG--GGGGGGGFYQDSYGGGGGGG 142 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGG-GGXXXGGXGXXXXGXGXXGGG 753 GG GG G G G GG GG GG GG G G G GG Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG G G G GG GG GG G GG G Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGG-GGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G G G GG GG GG G G G GG G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSG 832 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG-XGXXGGG 753 GG G G GG GG GG G G GG G G G GG Sbjct: 792 GGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG GG G G GG G G GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGG 807 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXX-GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G GG GG G G G G G G G GG Sbjct: 784 GGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGG 833 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG-XGXXXXGXGXXGGGXXXXXG 735 G G G G G GG GG GG G GG G G GG G Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSG 821 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -1 Query: 885 GGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GG G G GG G GG G GG GGA G GG Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -1 Query: 885 GGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GG G G GG GG GG G G GGA G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADG 840 Query: 705 G 703 G Sbjct: 841 G 841 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEX-GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGX 715 GG G GG GG GG G G G G G GG+ G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Query: 714 GGGG 703 GG Sbjct: 823 ASGG 826 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G G GG G G GG G G G GG G Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG G GG G GG GG G G G G G + G Sbjct: 777 GGASGGAGGSSGGANGGA--GSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGA 834 Query: 711 GGG 703 GG Sbjct: 835 SGG 837 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGG-XXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G G GG G G GG G G G G G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXG---GGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G GG G GG GG G GG G G Sbjct: 789 GANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG GG G G G G G G GG G Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAG 817 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 38.7 bits (86), Expect = 0.006 Identities = 32/134 (23%), Positives = 33/134 (24%), Gaps = 4/134 (2%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPPS P P P P PP Sbjct: 451 PTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 510 Query: 680 XXXXXXXXPPPPXPXAP----PXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PPP AP P P PP P P PP +PP S Sbjct: 511 TVTAPPAAPPPSV-FAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFA 569 Query: 848 PXPXXXXXXXXPPP 889 P PPP Sbjct: 570 PSSAVPTPATAPPP 583 Score = 35.9 bits (79), Expect = 0.045 Identities = 30/115 (26%), Positives = 31/115 (26%), Gaps = 8/115 (6%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPX---PXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXX 700 PPPS P P P P P PP Sbjct: 479 PPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPP 538 Query: 701 XPPPPXPXAP----PXPXXXXPP-PPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP AP P P PP PP P PPP + S PPP Sbjct: 539 PAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 Score = 34.3 bits (75), Expect = 0.14 Identities = 31/126 (24%), Positives = 31/126 (24%), Gaps = 5/126 (3%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPPS S P P P P P P P P Sbjct: 439 PPPSVFASSSGVPTPVTAPPPAPPPSV-FAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAP 497 Query: 710 PPXPXAPPX--PXXXXPPPPXXPXXXXXXX---PPXXXXPPPXSPPXSXPPPXPXXXXXX 874 PP AP P PP P P PPP PP P Sbjct: 498 PPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVT 557 Query: 875 XXPPPP 892 PP P Sbjct: 558 APPPAP 563 Score = 32.3 bits (70), Expect = 0.55 Identities = 28/121 (23%), Positives = 30/121 (24%), Gaps = 1/121 (0%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPPS S P P P P PP PP Sbjct: 363 PPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPP 422 Query: 710 PP-XPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 P + P PPP P PP +PP S P PP Sbjct: 423 PSVFAPSSGVPTPVAAPPP--SVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPP 480 Query: 887 P 889 P Sbjct: 481 P 481 Score = 31.9 bits (69), Expect = 0.73 Identities = 30/122 (24%), Positives = 31/122 (25%), Gaps = 2/122 (1%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP 709 PPPS S P P P P P P P P Sbjct: 381 PPPSVFASSSGVPTPVAAPPPAPPPSV-FAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAP 439 Query: 710 PPXPXAPP--XPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PP A P PPP P P P +PP S P P Sbjct: 440 PPSVFASSSGVPTPVTAPPPAPP--PSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAP 497 Query: 884 PP 889 PP Sbjct: 498 PP 499 Score = 31.9 bits (69), Expect = 0.73 Identities = 34/147 (23%), Positives = 35/147 (23%), Gaps = 17/147 (11%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P PPPS P P P P PP Sbjct: 393 PTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPT 452 Query: 680 XXXXXXXXPPP---------PXPXAPPXPXXXXP----PPPXXPXXXXXXXP----PXXX 808 PPP P P A P P P P P P P Sbjct: 453 PVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTV 512 Query: 809 XPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP +PP S P PPP Sbjct: 513 TAPPAAPPPSVFAPSSGVPTPVTEPPP 539 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP PPP P PP P Sbjct: 519 PPPSVFAPSSGVPTP--VTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G GG GG GG GGG G G G GGG G Sbjct: 141 GGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMG 195 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXG-----GXXXGGGXG 746 G GG G GG GGG GG GGG G G G G GGG G Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMG 183 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GG GGG GG GGG G G G G GGG G Sbjct: 175 GGGMGGGMGGGMGGGMEGGM--GGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 36.7 bits (81), Expect = 0.026 Identities = 31/108 (28%), Positives = 31/108 (28%), Gaps = 3/108 (2%) Frame = -1 Query: 855 GXGGGXEXGGEXGGG---XXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXX 685 G GGG GG GGG GG G GGG G G G GGG Sbjct: 133 GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG 192 Query: 684 XXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG 541 G G G G G G G G G G Sbjct: 193 GMGGGMMEGMQGMGSMGGGMMG--GGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 35.1 bits (77), Expect = 0.078 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG G GGG GG GGG GG G GGG G GG Sbjct: 137 GMSMGGGMGGGMSMGGMGGGM--GGMMGGGSM--GGGMMSMAGGGMGGGMGGGMG-GGME 191 Query: 720 GXGGGG 703 G GGG Sbjct: 192 GGMGGG 197 Score = 34.3 bits (75), Expect = 0.14 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = -1 Query: 888 GGGXXXXXXXXGXGGGXEXGGEXGG-----GXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 GG G GGG GG GG G GG G GGG G G Sbjct: 132 GGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGME 191 Query: 723 XGXGGG 706 G GGG Sbjct: 192 GGMGGG 197 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 8/63 (12%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG--------GXXXGGXGXXXXGXGXXGGGXXX 744 GG GG G GGG GGG GGG G GG G G GG Sbjct: 192 GGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGGMLQMGDSNGGGMS 251 Query: 743 XXG 735 G Sbjct: 252 EMG 254 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G GG G GGG GGG GGG G GG GGG Sbjct: 193 GMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGG--MGGG 238 Score = 32.3 bits (70), Expect = 0.55 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = -1 Query: 900 GXXGGG--GXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXG-GGGXXXXGXG 730 G GGG G G GG GG GG GG G GGG G G Sbjct: 159 GMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMG 218 Query: 729 GAXGXGG 709 G G G Sbjct: 219 GGMGFNG 225 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G G G GGG GGG GG G G GG Sbjct: 188 GGMEGGMGGGM-MEGMQGMGSMGGGMMGGG-MGGGMGFNGMEDGGKEGG 234 Score = 28.3 bits (60), Expect = 8.9 Identities = 24/91 (26%), Positives = 24/91 (26%), Gaps = 1/91 (1%) Frame = -2 Query: 833 GGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXXXXXXXXXXXXXXXXXXXXXGX 654 G G GGG GG G GGG G G Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGG 189 Query: 653 EXXGXGGXXXXGXXG-XXXGGXGXGGXXGXG 564 G GG G G GG GG G G Sbjct: 190 MEGGMGGGMMEGMQGMGSMGGGMMGGGMGGG 220 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG-XGXXXXGXGXXGGG 753 G G G G GGG GGG GGG GG G G G GGG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 36.7 bits (81), Expect = 0.026 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -1 Query: 891 GGGGXXXXXXXXGX--GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXG 718 GG G G GGG GG+ GGG G G GGG G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGD 384 Query: 717 XGGG 706 GGG Sbjct: 385 HGGG 388 Score = 36.3 bits (80), Expect = 0.034 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGX-GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGG G GGG GG+ GGG G GGG G G Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Query: 723 XGXGGG 706 GGG Sbjct: 393 GDHGGG 398 Score = 36.3 bits (80), Expect = 0.034 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGX-GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGG G GGG GG+ GGG G G GGG G G Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Query: 723 XGXGGG 706 G G Sbjct: 398 GDYGDG 403 Score = 35.5 bits (78), Expect = 0.059 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGX-GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGG G GGG GG+ GGG G G GGG G G Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGD 402 Query: 723 XGXGGG 706 G G Sbjct: 403 GDHGDG 408 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P PPP PPP PPP PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 35.1 bits (77), Expect = 0.078 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 819 PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PPP PP P P PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPP 845 P P PP PPP PPP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.3 bits (70), Expect = 0.55 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXP 884 P P PP PPP PP P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PP PP PPP PPP P P P P Sbjct: 860 PRPRPRRPPP------PPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 31.9 bits (69), Expect = 0.73 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPP 760 PPPP P PP P PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.73 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPP 763 PPP P PP P PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP 829 P P P PP P PPPP P P P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXP 772 P P P PP P PPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 731 PXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP 844 P P PPPP P PP PPP S S P Sbjct: 860 PRPRPRRPPPPPPP----PPPPPPPPPPPPASSTGSTP 893 Score = 29.1 bits (62), Expect = 5.1 Identities = 27/113 (23%), Positives = 28/113 (24%), Gaps = 6/113 (5%) Frame = +2 Query: 536 PSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXP--- 706 PS SP P P P P P P P Sbjct: 463 PSISTSPISNPSPRPHPSPHPSSNPSPNPSPNPSSDPSPNPSSNPSSDPSPNPSSNPSSE 522 Query: 707 PPPXPXAPPX---PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P P P + P P P P P P P S P S P P P Sbjct: 523 PSPNPISNPSISTSPISNPHPSSNPSPHPSSNPSSEPSPNPSSNPSSDPSPNP 575 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 565 PXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P PP P PP P P P S P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 747 PXPP--PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP P P P PP PP PP PP PP P P Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 P PP P A P PP P P P PP PP PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P P P PP P PP PP P S PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPP----APPFGGPPSAPPPPP 206 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP P PPP P PP P P PP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P APP P P P PP P +PP PP P PPP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAP-------PPPGAPAAPPAPPFGGPPSAP--------PPP 205 Query: 890 P 892 P Sbjct: 206 P 206 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP---XPPXXPXXPXXPP 887 P PP P PP PPP P P P PP P P PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAP--PPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/39 (30%), Positives = 14/39 (35%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 PP +P +P P P P P P P PP Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 38.3 bits (85), Expect = 0.008 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGG----EXGGGXXXXGGXXXXXXXGXXGGGGXXXXGX 733 G GGG GGG + GG + GGG GG G GG Sbjct: 105 GTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSS 164 Query: 732 GGAXGXGGG 706 GGA GGG Sbjct: 165 GGATSGGGG 173 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G GG GG GG GGG G G GG GGG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGG 144 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG-XXXXGXGXXGGGXXXXXG 735 GG GG G G GG G G GG GG G G GGG G Sbjct: 137 GGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAG 192 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGG--EXGG-GXXXXGGXXXXXXXGXXGGGGXXXXGXG 730 G GGGG GGG GG E GG G GG G GG G Sbjct: 119 GQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSS 178 Query: 729 GAXGXGGG 706 G GGG Sbjct: 179 GTSIAGGG 186 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G GG GG GGG GG G G G GG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGG 148 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGX-GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G G GGG GGG GG G G GGG G Sbjct: 124 GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSG 179 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG GG G GG GG GGG G G Sbjct: 138 GAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATS 197 Query: 720 GXG 712 G Sbjct: 198 AGG 200 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G + G GG GG G GGGG G G G G Sbjct: 94 GTAQAGASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAG 141 Score = 29.5 bits (63), Expect = 3.9 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 2/97 (2%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG--GGXXXXXXXXX 676 GG E GGE GG G G GG GGA G GG GG Sbjct: 104 GGTAEGGGEAGGEAGGQAGG------GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Query: 675 XXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXG 565 G G G G G G G G Sbjct: 158 STSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAG 194 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GG GG+ GG G G GGG G Sbjct: 104 GGTAEGGGEAGGEAGGQAGG---GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTS 160 Query: 720 GXGGGG 703 G GG Sbjct: 161 GSSSGG 166 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGG-XXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 G GGG G GG + G + GG G G G G G G + Sbjct: 132 GSQAGGGAAGGG---GQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSS 188 Query: 723 XGXGGG 706 G G G Sbjct: 189 AGAGAG 194 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXX----GGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G GG GGG GGG GGGG GG GGG G Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 37.1 bits (82), Expect = 0.019 Identities = 30/109 (27%), Positives = 30/109 (27%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXXX 676 G GG GG G G G G GGA G GG G Sbjct: 156 GYGGSVWPGGTGGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGV 215 Query: 675 XXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGGG 529 G GG G G G G G G G G GGG Sbjct: 216 GGRSVWNGVPGGFG-GGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGG 263 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -2 Query: 887 GGXGXXXGXXGGXGG----GXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G GG GG GG GGGG G G G G GGG Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGG 251 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG GG GGE G G G GG G G Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGG 239 Query: 720 GXGGGG 703 G GGGG Sbjct: 240 GGGGGG 245 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 899 GGXXGGXGXXX-GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 GG GG G G GG GGG GGG G G G G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXG--GGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G GG G GG GGGG G G G G GG Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGV--WGNGGGGGGGGGYSGG 250 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +2 Query: 704 PPPPXPXAPPX-PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXX 880 P P PP PPPP P P PP PP PP P Sbjct: 2133 PARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPS 2192 Query: 881 PPPP 892 PPP Sbjct: 2193 GPPP 2196 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 5/67 (7%) Frame = +2 Query: 704 PPPPXPXA---PPXPXXXXPPPPXXPXXXXXXX-PPXXXXPPPXSPPXSXPPP-XPXXXX 868 PPPP A P P PP P PP PP PP PP P Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGA 2209 Query: 869 XXXXPPP 889 PPP Sbjct: 2210 PPMGPPP 2216 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPX-PPXXXXPPPXPPPXXPPPXPPXXP 866 PPP PP P P PP PP PPP P Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P P P P P PP PP PP PP P P Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSV----PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHP 2205 Query: 890 P 892 P Sbjct: 2206 P 2206 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +2 Query: 704 PP--PPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP PP APP P PP P P PP PP P P Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPP-PXXXPPXXXXPXPPXXXXPPPX--PPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P PP P PP PPP PP PP P P P P Sbjct: 25 PTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 P PP P PP P PP P PP PP PP + P P P Sbjct: 20 PKPPQP-TPPKPDTP-PPGTNIPTPPSPNTPPPVTQPPVTQPPVTQP---PVTQPPVTQP 74 Query: 884 PPP 892 PPP Sbjct: 75 PPP 77 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 37.9 bits (84), Expect = 0.011 Identities = 28/111 (25%), Positives = 28/111 (25%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXX 717 G G G G G G G GGG GGG G G G G G Sbjct: 240 GDGDGDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 299 Query: 716 XXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXG 564 G G G G GG G G G G Sbjct: 300 DGDGDGDGDGDGDGDGDGDGDGDGDGDGDGGGGDGGGDDGGDGDGDGDGDG 350 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GGG GGG G G G G G G G G Sbjct: 244 GDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDG 293 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G G G G G GGG GGG G G G G G Sbjct: 309 GDGDGDGDGDGDGDGDGDGDGGGGDGGGDDGGDGDGDGDGDGDGDGDGDRDGDG 362 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP P APP P PP P P P +PP PP P PP Sbjct: 107 PPVPLAPPMPLA--PPVQQAPCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPM 164 Query: 890 P 892 P Sbjct: 165 P 165 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 P P APP P PP P P P +PP PP P PP Sbjct: 64 PLMPLAPPMPLA--PPVQQAPCGAGTMQAPCAGQQMPLAPPMPLAPPVPLAPPMPLAPP 120 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 37.9 bits (84), Expect = 0.011 Identities = 27/109 (24%), Positives = 29/109 (26%), Gaps = 1/109 (0%) Frame = +2 Query: 533 PPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPP 712 PP+P S P P P P P P P P P Sbjct: 181 PPTPHTSIPPTPHTSIPPTPRPTYKHPSYPSYKHPSYPSSHIQASLLPHIQASLLPLIPN 240 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP-PXP 856 P P PP P P PP +P S PP P P Sbjct: 241 TSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 289 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +1 Query: 493 PXPAPXXXX-GXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P P +P L P PP P P P P PP P S P Sbjct: 133 PFPHPTYKHPSYPSPHIQASLLPLIPHTSIPPTPHPTYKHPSYPTYNIPPTPHTSIP 189 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -2 Query: 896 GXXGGX--GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GG G GGGG GG G GGG Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GGG E G GGG GG G GGGG G Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGG-GSGTHSGQAGGGGGSYCGGSSCS 271 Query: 720 GXGGG 706 GG Sbjct: 272 AVTGG 276 Score = 32.7 bits (71), Expect = 0.42 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GG G GG G GG GGGG G G G GGG G Sbjct: 204 GGRAGGMNS--GYNGGPAPGAVGG-FGGGGGGSEDNGASGGGGGYSGGGSGTHSG 255 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA-XGXGGGG 703 G G G G GG G GGGG G G G GGG Sbjct: 209 GMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGG 260 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG 709 GG GG G G GGGG G + G GG Sbjct: 204 GGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGG 244 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GG G GGGG G G G GGG Sbjct: 98 GSNGGGGDDDGSNGG--GGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 37.5 bits (83), Expect = 0.015 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPP 857 PP PPP PPP PPP PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PP P PP PPP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P PPP PPP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 825 PPPXXPPPXPPXXPXXPXXPP 887 PPP PP PP P P PP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP PPP PP P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXP 772 PP APP P PPPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PPPP P PP P P P Sbjct: 82 PPPPPPPPPPPPGAKKPDDP 101 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.5 bits (83), Expect = 0.015 Identities = 32/124 (25%), Positives = 35/124 (28%), Gaps = 3/124 (2%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG G GG + GG+ GGG GG G GG G G G G Sbjct: 40 GGDGVDERGGDDDSGGVGDDGGDDGGGDNDSGG--FGDDGGDDSGGDDDSGGVGDDGGDG 97 Query: 711 GGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGE---XXG 541 GG G G G G G G G+ G Sbjct: 98 GGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGSG 157 Query: 540 XGGG 529 GGG Sbjct: 158 VGGG 161 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G G GG + GG+ GG GG G GGG G G Sbjct: 54 GGVGDDGGDDGGGDNDSGGFGDDGGDDSGGDDDSGG---VGDDGGDGGGDDDSGGVGDDG 110 Query: 720 GXGGGG 703 G GGG Sbjct: 111 GDDGGG 116 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/63 (31%), Positives = 22/63 (34%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G G GG + GG+ GGG GG G GGG G G Sbjct: 104 GGVGDDGGDDGGGDDDSGGVGDDGGDDGGGDDDSGG---VGDDGGDDGGGDDDSGSGVGG 160 Query: 720 GXG 712 G G Sbjct: 161 GDG 163 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 37.5 bits (83), Expect = 0.015 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPP 857 PP PPP PPP PPP PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PP P PP PPP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P PPP PPP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 825 PPPXXPPPXPPXXPXXPXXPP 887 PPP PP PP P P PP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP PPP PP P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXP 772 PP APP P PPPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PPPP P PP P P P Sbjct: 283 PPPPPPPPPPPPGAKKPDDP 302 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P PP P P PP P P PPP PP PP P Sbjct: 212 PVNPPE---PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 35.5 bits (78), Expect = 0.059 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP APP P PPPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPP 247 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXP 866 P PP PPP PP PPP PP P Sbjct: 225 PPPPAAPAPPP-PPAAAPPPPPPPPP 249 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P P PPP P P PP P PP P Sbjct: 215 PPEPDYLEPTP-PPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P P P PP PP PPP P P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPP P PP P PPPP P Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPP 248 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P PP P P PP PP PPP PP + PPP P PPPP Sbjct: 212 PVNPPEPDYLEPTPP----------PPAAPAPPP--PPAAAPPPPP--------PPPP 249 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 725 APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 A P P P P PP PP P + PPP P Sbjct: 203 AAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 532 PXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXP 645 P PP P P P P PP P PP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PP P P P P PP P PP PPP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPP----AAAPPPPPPPPPVKKP 253 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP---XPXXXXXX 874 PPP + P P PPP P PP P PP PPP P Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQ 412 Query: 875 XXPPP 889 PPP Sbjct: 413 TLPPP 417 Score = 32.7 bits (71), Expect = 0.42 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +2 Query: 704 PPPPXPXAPP--XPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXX 877 PPPP PP P P P P PP PPP + S PPP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVP-PPMIGPVTVPPPPLIPPPQA---SIPPPTMIQTLPPP 417 Query: 878 XPPPP 892 PPP Sbjct: 418 SVPPP 422 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPP-----XPPPXXPPPXPPXXPXXP 875 P P PP P PP PPP PPP PPP P P P Sbjct: 385 PMIGPVTVPPPPLIP-PPQASIPPPTMIQTLPPPSVPPP-PIGVPNRP 430 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -1 Query: 846 GGXEXGGEX--GGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G E GG+ GG GG G GGGG GG G GGG Sbjct: 2299 GDFETGGKSFLNGGE---GGESRAGPVGGFGGGGSSRIRPGGGGGYSGGG 2345 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 590 PXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPPPXX 769 P P P P PP PP P PP P PPP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPP-PQASIPPPTMI 411 Query: 770 PXXXXXXXPPXXXXPPPXSPP 832 PP PPP P Sbjct: 412 QTL-----PPPSVPPPPIGVP 427 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 37.1 bits (82), Expect = 0.019 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +2 Query: 704 PPPPX----PXAPPXPXXXXPPPPXX-PXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXX 868 PPPP P +P PPPP PP PP SP S PP P Sbjct: 704 PPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHPPTVSPSSSSAPPRPSTPP 763 Query: 869 XXXXPPP 889 PP Sbjct: 764 SVSSAPP 770 Score = 32.3 bits (70), Expect = 0.55 Identities = 24/75 (32%), Positives = 25/75 (33%), Gaps = 13/75 (17%) Frame = +2 Query: 704 PPPPXP----XAPPXPXXXXPPP-----PXXPXXXXXXXPP----XXXXPPPXSPPXSXP 844 PPPP P + P P PPP P P PP PP SPP S Sbjct: 685 PPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKH 744 Query: 845 PPXPXXXXXXXXPPP 889 PP P P Sbjct: 745 PPTVSPSSSSAPPRP 759 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/78 (24%), Positives = 20/78 (25%), Gaps = 1/78 (1%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXP-XXXXPXPPXXXXXXXXXXXXXXXXXXXP 706 PPP P P P P P P P P PP P Sbjct: 686 PPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPSSKHP 745 Query: 707 PPPXPXAPPXPXXXXPPP 760 P P + P PP Sbjct: 746 PTVSPSSSSAPPRPSTPP 763 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXP 854 P PP PPP PPP PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 816 PPXP-PPXXPPPXPPXXPXXPXXPP 887 P P PP PPP PP P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PPP PPP PP P P Sbjct: 59 PTVPIPPTLPPP-PPPPPPPLPPPPP 83 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P PP PPP PPP PP P Sbjct: 59 PTVPIPPTLPPPPPP-PPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPP 763 PP P PP P PPPP Sbjct: 64 PPTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 37.1 bits (82), Expect = 0.019 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXP 854 P PP PPP PPP PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 816 PPXP-PPXXPPPXPPXXPXXPXXPP 887 P P PP PPP PP P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PPP PPP PP P P Sbjct: 283 PTVPIPPTLPPP-PPPPPPPLPPPPP 307 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P PP PPP PPP PP P Sbjct: 283 PTVPIPPTLPPPPPP-PPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPP 763 PP P PP P PPPP Sbjct: 288 PPTLPPPPPPPPPPLPPPP 306 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G G GG G GG GGG G G G G GGG Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G G GG GGG G G G G G G GGG Sbjct: 417 GGSSAGASGG-GHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G GGG G G G GG G G G GG Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 843 GXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G GGG GG G G G GGA G G GG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG 463 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXG-GGXGGGGXXXGGXGXXXXGXGXXGG 756 GG G G GG G G G G G GG GG G G G Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G G GG GGG G G G G GG GG G Sbjct: 418 GSSAGASGG-GHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGG---GGAGG 463 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G GG G G G G G G GGA G GG Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 G GGG GG G G G G GGGG GGA G Sbjct: 430 GAGGGSAAGGGTGSGSTGNGNAGN----GGAGGGGAGGGSTGGASSSG 473 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXG-GGGXXXXGXGGAXGXGGG 706 GG G GG GG G G G G G G GGG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PP PP PP PP PP PP P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTN--PPAPPTNPPKP 259 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +3 Query: 789 PXPPXXXXPP---PXPPPXXP--PPXPPXXPXXPXXPPXXP 896 P PP PP P PP P PP PP P P P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P P PP P PP PP P P P PP Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPP-PPXXPXXXXXXXPPXXXXPPPXSPP 832 P PP PP PP PP P PP PP +PP Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNP-----PVPPTNPPAPPTNPP 257 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G G GGG GGG GG GG G GG Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGG 49 Score = 33.9 bits (74), Expect = 0.18 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGE----XGGGXXXXGGXXXXXXXGXXGGGGXXXXGX 733 G GGGG G GGG + GG+ G G GG G GG G Sbjct: 2 GYDGGGGDGDGGDGDGGGGG-DGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCERGGD 60 Query: 732 GGAXGXGGG 706 G G G G Sbjct: 61 GDVDGGGDG 69 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP PP PPP P P PP P Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIP-PPPAPP 215 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPP--XXPPPXPP 857 P PP PP P PP PPP PP PPP PP Sbjct: 181 PAPPGVLAPP----PAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 755 PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP P P PPP +PP + PP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 704 PPPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PPP P PP P PPPP PP PPP +PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPA---------PPGALIPPPPAPP 215 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 798 PXXXXPPPXPPPXX-PPPXPPXXPXXPXXPP 887 P PPP PP PPP PP P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 737 PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P PPP PP PPP P PPP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPP 211 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 36.3 bits (80), Expect = 0.034 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GGGG G GG GG+ G GG G G G G G G Sbjct: 355 GGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLG 414 Query: 711 GGG 703 GGG Sbjct: 415 GGG 417 Score = 29.9 bits (64), Expect = 2.9 Identities = 25/105 (23%), Positives = 26/105 (24%), Gaps = 1/105 (0%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG G G GG+ GG G G GG G GG Sbjct: 315 GGAATDNYQSMMGGGSMQSLGGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTL 374 Query: 711 GGGXXXXXXXXXXXXXXXXGXXGG-XGXXXXGXXGXXXXGXGXXG 580 GG GG G G G G G G Sbjct: 375 GGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLGGGGGG 419 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.3 bits (80), Expect = 0.034 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXP 884 PPP PPP PPP PP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.059 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXP 866 PPP PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXP 875 PP PPP PPP PPP P P P Sbjct: 54 PPPPPPPPPPPPP--PPPPPSSSPSRP 78 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PPP PPP PP P P P P Sbjct: 54 PPPPPP--PPPPPPPPPPPPSSSPSRP 78 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXP 772 PPP P PP P PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PPPP P PP P PPPP Sbjct: 54 PPPPPP--PPPPPPPPPPPP 71 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 36.3 bits (80), Expect = 0.034 Identities = 31/120 (25%), Positives = 31/120 (25%), Gaps = 1/120 (0%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXGXXXXXXXXX 708 G G GG GGG G G GG G GG G GGG G Sbjct: 414 GSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYG 473 Query: 707 XXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXG-XGXXXXRXGGXXG 531 G G G GG G G G R GG G Sbjct: 474 GGSYDHYDSYYGGGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFG 533 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 36.3 bits (80), Expect = 0.034 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GGG E G GGG GG GGGG G Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG-SSCK 401 Query: 720 GXGGG 706 G GG Sbjct: 402 GVTGG 406 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G GG G GG GGGG G G G GGG Sbjct: 334 GGRAGNMNS--GYNGGPSPGAVGG-FGGGGGGSEDNGASGGGGGYSGGG 379 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 GG GGG GGG G GG GG G G G Sbjct: 55 GGQGGGGQGGGQGVGGQEVGGQGGGGQGVG 84 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 854 GXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G GGG GGG GG G G G G G Sbjct: 51 GQGVGGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGG 90 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 36.3 bits (80), Expect = 0.034 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXP 884 PP PPP PPP PP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.5 bits (78), Expect = 0.059 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 PP PPP PPP PPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPP 857 P P PPP PPP PPP PP Sbjct: 1308 PESPPPPPPPPPPPP--PPPLPP 1328 Score = 31.5 bits (68), Expect = 0.96 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PPPP P PP P PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 31.5 bits (68), Expect = 0.96 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPP 848 P PP PPP PPP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXP 772 PP P PP P PPPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 825 PPPXXPPPXPPXXPXXPXXPPXXP 896 PP PPP PP P P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 36.3 bits (80), Expect = 0.034 Identities = 33/135 (24%), Positives = 34/135 (25%), Gaps = 1/135 (0%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GG G GGG GGG GA Sbjct: 246 GGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAG 305 Query: 720 GXGGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXG-XXGXGXXXGEXX 544 G GGGG GG G G G G G G + Sbjct: 306 G-GGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRG 364 Query: 543 GXGGGXXAXXXXGXG 499 G GG G G Sbjct: 365 GQSGGAAGTASMGGG 379 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGG---XXXXXXXGXXGGGGXXXXGXGGAX 721 GG G G GG GGG G G GGGG G G Sbjct: 357 GGNSCQRGGQSGGAAGTASMGG--GGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGR 414 Query: 720 GXGGGG 703 G GGG Sbjct: 415 GGHGGG 420 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.034 Identities = 29/115 (25%), Positives = 31/115 (26%), Gaps = 6/115 (5%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXX--PXXXXPXPPXXXXXXXXXXXXXXXXXXX 703 PPP+ P P P P P P P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGD 72 Query: 704 PPP--PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPP P P PP P PPP P PPP +P P P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPLTIP 127 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP P P P PP P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP-IPGDP--PPNTP 118 Score = 35.1 bits (77), Expect = 0.078 Identities = 28/112 (25%), Positives = 30/112 (26%), Gaps = 3/112 (2%) Frame = +2 Query: 566 PXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXXXXXXXXXXXXPPPPXPXAPPXP 739 P P P P P P P P PPP P P P Sbjct: 5 PNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPI-PGNP 63 Query: 740 XXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP-PPXPXXXXXXXXPPPP 892 P P P P P P +PP + P P P PPP Sbjct: 64 PPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 34.7 bits (76), Expect = 0.10 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 6/97 (6%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXP--PXXXXXXXXX 673 P P PPP+ P P P P P P P P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGD 82 Query: 674 XXXXXXXXXXPPP--PXPXAPPXPXXXXP--PPPXXP 772 PPP P P PP P P PPP P Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPP-PNTPIPGDPPPNTP 118 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPX-------PPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP PP P PP P Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP-PXXPPPX-------PPXXPXXPXXPPXXP 896 PPP P P P PPP P P PPP PP P PP P Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 88 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 759 PXXXPPXXXXPX-PPXXXXPPPXPPPXX--PPPXPPXXPXXPXXPPXXP 896 P PP P PP P PPP P PP P PP P Sbjct: 10 PGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIP 58 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G G GG GGG GG G GG GG G Sbjct: 190 GGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG G G G GGG GG GGG GG G Sbjct: 193 GGRGGGRGAPRGRGGPRGGGGGSGGYGGGS--YGGYG 227 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = -2 Query: 857 GGXGG-GXXGGGXGG----GGXXXGGXGXXXXGXGXXGG 756 GG GG G GGG G GG GG G G G GG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGG 225 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = -2 Query: 899 GGXXGGXGXXXGXX-GGXGG---GXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG GG G G GG GG GG G G G G GGG Sbjct: 220 GGSYGGYGNYGGYSQGGYGGYADNSWSGGYGSYDGGYGNGGDYSNGYSSYGGG 272 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG GG GGG GGG GG GG G G G Sbjct: 45 GGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GG GGG GGG G GG GGG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGG--RGGGRG 83 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG GG GGG GGGG G G G G G Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARG 89 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G G G GGG GG GGGG G G G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G G GGG GG G GGGG GG G G GG Sbjct: 33 GRPGFSPRGAGRGGGR---GGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG 813 GG GG G G GGG GGG GGG Sbjct: 54 GGRGGGRGGGGGFKSPRGGGR-GGGRGGG 81 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G G GG GGG GG G GGGG GG G GGG Sbjct: 41 GAGRGGGRGGPRGGGR---GG-------GRGGGGGFKSPRGGGRGGGRGGG 81 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGG---XGGGGXXXGGXG 789 G GG G G GG GGG GGG GG GG G Sbjct: 43 GRGGGRGGPRG--GGRGGGRGGGGGFKSPRGGGRGGGRG 79 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXX---GGGXGGGGXXXGGXG 789 GG G G G G GGG GGG GGG GG G Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGG--RGGGRG 83 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.9 bits (79), Expect = 0.045 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 7/65 (10%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXP--PXXXXP-----PPXSPPXSXPPPXPXXXXXXX 877 P APP P P PP P P P P PP P S P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISA 807 Query: 878 XPPPP 892 PPPP Sbjct: 808 EPPPP 812 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXP-PPXPPXXPXXPXXPP 887 PP P P PP P PPP P PP P P P P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP--PXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P PP P P P P P P P PP P Sbjct: 762 PAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +2 Query: 542 PXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXP 721 P S P P P P P P PP P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 722 XAPPXPXXXXPPPPXXP 772 PP P PPP P Sbjct: 798 HLPPAPNISAEPPPPPP 814 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P P PP PP PP P P PP P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVP-PPCAPIPP 779 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXP--PXXXXPPPXSPPXSXPP 847 PPP P PP P PP P P P PP PP + P Sbjct: 771 PPPCAP-IPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVARKP 819 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 704 PPPPXPXAP-PXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P AP P P PP P P P +P S PP P Sbjct: 761 PPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPP 812 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +1 Query: 493 PXPAPXXXXGXXAPXXPPXLXXXXPXPXXPPXPXPPXXXPXXPXXXXPPXPXXSXP 660 P P+ AP PP + P P P PP P P P P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAP-PQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP P P PP P PPP P P P PP P Sbjct: 2603 PPPDMFPPQMMPPMVPMML-PPMLP---LPPPGLPMQPEAPVQPPPLP 2646 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP PP PP P PP P P P P Sbjct: 2595 PPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQP 2636 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 P P P P PP P PP PPP P P P P Sbjct: 2592 PMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGP 2651 Query: 884 PPP 892 PP Sbjct: 2652 FPP 2654 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 35.1 bits (77), Expect = 0.078 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G GG G GGG GGGG GG GGG Sbjct: 458 GGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXG--XGXXGGG 753 G GG GG GGG G GGGG GG G GGG Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGG 504 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G GG G GG + GG GG G GGG + Sbjct: 440 GSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSN 499 Query: 720 GXGGGG 703 GGGG Sbjct: 500 SCGGGG 505 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGG 755 GG G G G GGG GGG GG GG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG GG GG GGGG G GGG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 32.7 bits (71), Expect = 0.42 Identities = 27/109 (24%), Positives = 28/109 (25%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXXX 676 G GG GG G G G GG+ G GG G Sbjct: 398 GYGGSQFRGGSSGNGAEEGDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGA 457 Query: 675 XXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGGG 529 GG G G G G G G G G GGG Sbjct: 458 GGRSNQNDVEGGFG-GGGGPNGAGGGGGGGGGYSG-GASGSRSNSCGGG 504 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 GG GG G GG GGG GG G G G G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGX---GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG 730 G GGGG GG GGE G G GG G G Sbjct: 419 GYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNG 478 Query: 729 GAXGXGGGG 703 G GGGG Sbjct: 479 AGGGGGGGG 487 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG G GGGG G G G Sbjct: 478 GAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGSDKSQQAGANNGAG 525 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 35.1 bits (77), Expect = 0.078 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P PP PPP P PPP P P PP Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAP--PP 248 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXS 838 P PP PP P PPP P PPP + P S Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAPGS 254 Score = 31.5 bits (68), Expect = 0.96 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 719 PXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P + P P PPPP P P PPP P + PP Sbjct: 206 PRSGPLPPTAAPPPP--PTTGAPPPTPVTNKPPPPRPATTQAPP 247 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGG-GXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G GG GG G GG G GG G G GGG Sbjct: 200 GGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGG 248 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GG GGG GG GG G GGG G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYG 236 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 883 GXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G GGG G G GGG GG GG GG G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGY---GGYG 239 Score = 31.5 bits (68), Expect = 0.96 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 2/94 (2%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXG-GAXGXGGG-GXXXXXXX 682 G GG GG GG GG GGG G G+ G GGG G Sbjct: 200 GGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYD 259 Query: 681 XXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXG 580 G G G G G G G Sbjct: 260 GYGSMGMYNQSSSGYGKSYGGMSGGGSGGRGRGG 293 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G G G GGG GG G GG G GGG G Sbjct: 201 GYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGG 250 Score = 28.7 bits (61), Expect = 6.8 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGG-XXXXXXXGXXGGGGXXXXGXGGAXGX 715 GGGG G GGG GG G GG G GGGG G G Sbjct: 208 GGGGRG------GYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGY 261 Query: 714 GGGG 703 G G Sbjct: 262 GSMG 265 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.078 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG G G G G GGG GG GG G Sbjct: 66 GGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G GG G G GGG G G GGGG G G G Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G G GG GGG G GGG G G G G GG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGG--ISGCGDGGGGGGGAGG 94 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG + G + G G G G GG G GG GGGG Sbjct: 55 GGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG 813 GG GG G GG G GGG GGG Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGG 91 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G G G G G GG G G G G GGG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGG 90 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G G G + G+ GG GG GGG G GG G G GG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDD-------GGGISGCGDGGGGGGGAGG 94 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -2 Query: 887 GGXGXXXGXXGGXGG----GXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG G GG GG GG GGGG GG G G G GG Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG GG GGG GG GGGG GG G G G G Sbjct: 474 GGVGGRSIWNVVPGGFGGG--GGASGGGGGGGGGGGFSGGACGDFTSGLSPTCG 525 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGG--GXXXGGXGXXXXGXG 768 GG G G GG GGG GGG GG G G G G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG GG GGE G G GG G GG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 720 GXGGGG 703 G GGGG Sbjct: 501 GGGGGG 506 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -2 Query: 866 GXXGGXGG--GXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG GG G GGG GGGG G G G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGG 526 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GG GGG GGG G G G GG G Sbjct: 487 GGFGGGGGASGGG-GGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGG 816 GG GG G G GG GGG GG G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACG 514 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 35.1 bits (77), Expect = 0.078 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 PPP PP P PP P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 35.1 bits (77), Expect = 0.078 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PPP PP PPP P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 PP P PP PP PPP P P P P P Sbjct: 95 PPPPATPPPP--TMPPTPPPPQTPAPPGPDTPAPP 127 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 PPP PP PPPP P PP P P +P P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTP------APPGPDTPAPPAPGGCGAKPHTRIVGGTKAPP 148 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXP-PXXPXXPXXP 884 P PP PP PP PP P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PPP PP P P P P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 794 PPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP PPP + P + PPP P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPP P PP P PP P P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTP 124 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPP 763 PPPP APP P PP P Sbjct: 110 PPPPQTPAPPGPDTPAPPAP 129 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 35.1 bits (77), Expect = 0.078 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXG-GXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GG G G G G GGG GGG GGG GG G G GG Sbjct: 162 GGDDGDGGGDDDDGGDGDGGGDDGGGADGGG-ADGGDDDGGDGDGDDDGG 210 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGX---GGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G G GG GG GGG GGG GG G G Sbjct: 156 GHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDG 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GG G GGG GGG GG G GGG G G Sbjct: 141 GGDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGG---DGDGGGDDGGGADGGGADGGD 197 Query: 720 GXGGGG 703 GG G Sbjct: 198 DDGGDG 203 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG G G GGG GGG GG GG G G G Sbjct: 168 GGGDDDDGGDGDGGGDDGGGADGGG-ADGGDDDGGDGDGDDDGGDDDG 214 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 35.1 bits (77), Expect = 0.078 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP-PPXPXXXXXXXX 880 PPPP PP P P PP PP PP P P P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Query: 881 PP 886 PP Sbjct: 178 PP 179 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PP P P A P PP P P PP PP + P P Sbjct: 137 PPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQP 185 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +3 Query: 753 PPPXXXPPXXXXPXP-PXXXXPPPXPPPXXPPPXPPXXPXXP-XXPPXXP 896 PPP PP P P P P PP PP P P PP P Sbjct: 148 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 710 PPXPXAPPXPXXXXP-PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP PP P P P PP P P PP PP P Sbjct: 148 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 747 PXP-PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P P P P PP P P PP PP P P Sbjct: 160 PQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYPQTQP 203 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P P PP PP P PP PPP P P P PP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPP--PPPLPAGVPAPPPPPP 320 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 752 PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PPPP P PP P +PP PPP P PPPP Sbjct: 280 PPPP--PPLTGGMLPPPFGGHPAAAPP---PPPLPAGVPAPPPPPPP 321 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 PPP P P PP P PPP PP Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 620 PXXXXPXPPXXXXXXXXXXXXXXXXXXXPPPPXPXAPPXPXXXXPPP 760 P P PP PPPP P P P PPP Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 771 PPXXXXPXPPXXXX--PPPXPP-PXXPPPXPPXXPXXPXXPPXXP 896 P P PP PPP P PP PP P PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPP 320 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPPP PP PPP PP P +PP PPP Sbjct: 280 PPPP----PPLTGGMLPPPFGGHPAAAPPPPPLPAGVP--APPPPPPPP 322 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 34.3 bits (75), Expect = 0.14 Identities = 34/124 (27%), Positives = 34/124 (27%), Gaps = 2/124 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGG-A 724 G G G G G G GG G G G G GGG GG Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Query: 723 XGXGGG-GXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEX 547 G GGG G GG G G G G G G G G Sbjct: 302 RGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLG-RGPGGGWGRMQGGGMGRGPG 360 Query: 546 XGXG 535 G G Sbjct: 361 QGWG 364 Score = 32.7 bits (71), Expect = 0.42 Identities = 32/120 (26%), Positives = 32/120 (26%), Gaps = 1/120 (0%) Frame = -1 Query: 855 GXGGGXEX-GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGGXXXXXXXX 679 G G G GG G G G GGG G G G GGG Sbjct: 233 GRGSGSPMWGGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGG------WGR 286 Query: 678 XXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXGXGGGXXAXXXXGXG 499 GG G G G G G G G G G G G G G Sbjct: 287 GSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 346 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G G GG G GGG G G G G G GGG G Sbjct: 244 GMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWG 293 Score = 31.1 bits (67), Expect = 1.3 Identities = 33/125 (26%), Positives = 33/125 (26%), Gaps = 1/125 (0%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G G G G G GG G G G G GGG G Sbjct: 258 GGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGR 317 Query: 720 GXGGG-GXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXX 544 G GGG G GG G G G G G G G Sbjct: 318 GPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQG-WGCRGMGCGWGCGN 376 Query: 543 GXGGG 529 G GG Sbjct: 377 GRFGG 381 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPP----PXPPPXXPPP 848 P PP P P PP PP P PPP PPP Sbjct: 1334 PLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P P A P PPPP P PP PPP P + PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP--PALNGGPP 231 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPP 820 PPPP P PP PPPP P PP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPP--PPPFGAPPPPALNGGPP 231 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P PP P P PP PPP P PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP PP P PP P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPP 887 PPP PPP P PP P PP Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PPP PP P P P P P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAP 221 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PPP P P P P P P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P PP P P P P P P P P PP P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P P P PP PP P P P P PP Sbjct: 1670 PGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 747 PXPPPXXXP-PXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P PPP P P P P P P PP PP P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP 1706 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXP-PXXXXPPPXPPPXXPP--PXPPXXPXXPXXPPXXP 896 P PPP PP P P P P PP P P P P P P Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 1/64 (1%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXP-PPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXX 880 PPPP PP P P P P P P P P P Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPMG 1723 Query: 881 PPPP 892 PP P Sbjct: 1724 PPGP 1727 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 795 PPXXXXPPPX--PPPXXPPPXPPXXPXXPXXPP 887 PP PPP PP PPP PP P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 794 PPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP PP PP PPP P PPP Sbjct: 210 PPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 PPP PP P PP PP P PPP Sbjct: 215 PPPMGGPPGGYPPPPP----PPGAGDPAYPPP 242 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PXXPXPXXXXPXXPXXXXPX-PPXXXXXXXXXXXXXXXXXXXPPPPX-----PXAPPXPX 742 P P P P P PP PPP P APP P Sbjct: 246 PPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPN 305 Query: 743 XXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P PP P PP P PPP Sbjct: 306 FTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXP---PPXPPPXXPPPXPPXXP 866 PP PP PP P P PPP PPP PP P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPP--PPPLPPAMP 322 Score = 32.7 bits (71), Expect = 0.42 Identities = 29/129 (22%), Positives = 31/129 (24%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXX 685 P + PP S P P P P P PP Sbjct: 217 PSPSPSAAPPSSLRVKPVSGRLGLSNIKPPPP---PVPPPTIPSVPPGSETYVPPGSATY 273 Query: 686 XXXXXXPPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXX 865 P P P P PPP P P PPP P + P Sbjct: 274 ESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNFTSPSP----PPPPPLPPAMPAMDDLLP 329 Query: 866 XXXXXPPPP 892 PPPP Sbjct: 330 PEVLSPPPP 338 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP---XXPPXXP 896 PPP P P P P PPP PP P P PP P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP----PXPXXXXX 871 PPPP P P P PP P P S P PP P Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPS 370 Query: 872 XXXPPPP 892 PPPP Sbjct: 371 PIMPPPP 377 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP P P PP PPP PP P P PP P Sbjct: 297 PPPAPPLPNFTSPSPP----PPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXG 798 GG G G GG GGG GGG GG G G Sbjct: 406 GGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 GG GGG GGG GGGG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXG 798 G GG GGG GGG G GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXG 774 GGG GGG GGGG GG G G Sbjct: 514 GGG--GGGGGGGGGGGGGRGGRGRG 536 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 833 GGGXGGGGXXXGGXGXXXXGXG 768 GGG GGGG GG G G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PP + P PP P P PP PPP +PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PP P PPP PPP PPP PP Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPP--PPPTPP 371 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 713 PXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 P APP P P P P P PPP PP PPP Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 P PP P PP PPP PPP PPP Sbjct: 343 PQPPTPTTPKTHPQLGPP----PPPPPPPPTPPP 372 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P P P PP PPP PP P Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP P P PPP PP P P Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 756 PPXXXPPXXXXPXP-PXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PP P P P P P PPP PP P P PP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPP--PPPPTPPP 372 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P P P P P PPP PP P Sbjct: 331 PSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTP 370 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 704 PPPPXPXAPPXP 739 PPPP P PP P Sbjct: 359 PPPPPPPPPPTP 370 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 13/47 (27%), Positives = 13/47 (27%) Frame = +2 Query: 506 PXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 P A PPS S P P P P P PP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PPP PP PP PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 PP P PP P PP PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXP 842 PPP PP P PP PP PP P Sbjct: 430 PPPT--PPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPP--XPPXXP 866 P P PPP PPP PP PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGG-GXXXGGXGXXXXGXGXXGGG 753 G G GG GG GG GG G GG G G GGG Sbjct: 420 GAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGG--GXXXXGGXGXXXXGGXXXGGGXG 746 G GG GG GG GG G G G G GGG G Sbjct: 420 GAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -2 Query: 899 GGXXGGX--GXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG G G GG GG GG G GG G Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXG--GGGXXXGGXG 789 G G G G GGG GGG G GGG GG G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDG 42 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GG GG GGG GG G G G G Sbjct: 11 GEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDG 50 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 G G GG GG GG GGG GG G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGG 36 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G GG G G G GGG G G GG G G G G Sbjct: 11 GEGGGDGGDSGG-GSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDG 56 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG 709 GGG + GG+ G G G G G G G G GG Sbjct: 21 GGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGG 67 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G G G GG+ GGG G G GGG G G G G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGG------DGGDGGGGSDGGDGEGDDDGDGEG 52 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP--PXXPPPXPPXXPXXPXXPPXXP 896 P P P P P P P PP P PP P P PP P Sbjct: 511 PTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P PP P P P P PP PP P S PP P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYP--PPQPYPPTQPSYPP--TPSSYPPTQP 555 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 PP P PP P P P P P PP + S PP P P Sbjct: 180 PPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAA---SYPPTAPSYNPTAPSYP 236 Query: 887 P 889 P Sbjct: 237 P 237 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PP P PP P P P P PP P S PP P Sbjct: 201 PPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPP---TPSSYPPTQP 247 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.5 bits (73), Expect = 0.24 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGG---GGXXXXGXGGAX 721 GGGG GG GG GGG GG G GG GG G GG Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGGGMHGGG----GGYGNYGGYGGYGGNPQGGYGFAGYGGQY 1305 Query: 720 GXGGGG 703 G GG Sbjct: 1306 GGPRGG 1311 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG--GXXXGGXGXXXXGXGXXGGG 753 GG G GGG GGG G G G G G G G G G Sbjct: 1252 GGAFSSRDYRQHRGGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYG 1302 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PPP PPP PPP PP Sbjct: 32 PPPSPPPSPPPPSPP 46 Score = 33.5 bits (73), Expect = 0.24 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PPP PPP PPP PP Sbjct: 155 PPPSPPPSPPPPSPP 169 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 812 PPPXSPPXSXPPPXP 856 PPP SPP S PPP P Sbjct: 31 PPPPSPPPSPPPPSP 45 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 812 PPPXSPPXSXPPPXP 856 PPP SPP S PPP P Sbjct: 154 PPPPSPPPSPPPPSP 168 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPX--PPXXXXPPPXPPPXX-----PPPXPPXXPXXPXXPPXXP 896 P PPP P P PPP PPP PPP PP PP P Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPP 82 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +2 Query: 752 PPPPXXPXXXXXXX---PPXXXXPPPXSPPXSX-----PPPXPXXXXXXXXPPPP 892 PPPP P P PPP PP PPP P PPPP Sbjct: 27 PPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPP 81 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 P PPP P PP PPP PP Sbjct: 52 PPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 GG G G G G GG GGG GGG GG Sbjct: 622 GGQGGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGG 656 Score = 31.9 bits (69), Expect = 0.73 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = -2 Query: 899 GGXXGGXGXXX-GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G G GG GGG GGG G G G G GG G Sbjct: 625 GGMFGTPGGQQSGFHGGIGGGGMGGGFSGQGGGFPTSQAQADGFGTSQGGFGASQG 680 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 PP P P PP PPP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PP P P P P PPP PP P P P Sbjct: 357 PPSTPAPTPAPLSSTP-CAPFAPPPPPPPPPPPAPGSTP 394 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P P P P P P PP P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 >SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP---XXXXXX 874 PPP PP P PPP P P P + PPP Sbjct: 117 PPPSMAPYPPGPNQGTPPPSTQQQPGSGGYPMMYPQQPGYYPAGTAPPPYSEAGVAGTSE 176 Query: 875 XXPPPP 892 PPPP Sbjct: 177 PLPPPP 182 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG GGG GGG GGGG G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGG 810 G GG GGG GGG GGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG GGG GGG GGG G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 Score = 32.7 bits (71), Expect = 0.42 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG GGG GGG GG G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDG 362 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 762 GGGGXXXXGXGGAXGXGGGG 703 GGGG G GG G GGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G GG GGG GGG G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXG----GGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G GG GG GG GGGG G G G G GG Sbjct: 233 GGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGG 284 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGG GG GG+ G G GGGG GG Sbjct: 216 GGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGA 275 Query: 720 GXGGG 706 G GGG Sbjct: 276 GGGGG 280 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGG 824 G GG G G G GGG GGG Sbjct: 262 GGGGGACGCNGGGAGGGGGYSGGG 285 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GG G G GG GG GGG G G GG G GG G G Sbjct: 124 GGGDGGGGSDGG--GGSDGGG-GDGEDDDGGDGDDDDGGDVEDDGDG 167 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXGXXXXGXGXXG 759 GGG GGG GGG GG G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDG 153 Score = 27.5 bits (58), Expect(2) = 2.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 833 GGGXGGGGXXXGGXGXXXXGXGXXGGG 753 GGG GGGG GG G G G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDG 150 Score = 21.4 bits (43), Expect(2) = 2.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGG 813 G G GG G GGG GGG Sbjct: 65 GGGDGDNDDGGDGEDD-GGGDGGG 87 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P P PP P P PPP P P P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAP-TPPPALPSTPTLPLAPRPRP 75 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/61 (27%), Positives = 17/61 (27%), Gaps = 1/61 (1%) Frame = +2 Query: 710 PPXPXAP-PXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPP 886 PP P P P P PP P P P P S P PP Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQPTTRTQYSGGGAIPP 94 Query: 887 P 889 P Sbjct: 95 P 95 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 32.7 bits (71), Expect = 0.42 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPP 887 PPP P P PPP PP P P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 PP P P PPP PPP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP 832 PPPP P AP P PP P P SPP Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGPEVALHVEVSSPP 466 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPP 857 P PP PPP PPP P P Sbjct: 426 PPPPPAPLPPPPPPPPQPTTALP 448 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGGXG 789 GGG GGG GGGG GG G Sbjct: 1004 GGGGGGGGGGGGGGRRGGRG 1023 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 854 GXGGGXXGGGXGGGGXXXGGXG 789 G GGG GGG GGGG G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGG 794 GG GGG GGG GG GG Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGG 1024 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 GG GGG GGG G G G G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP P P PP PP P P P PP Sbjct: 379 PGFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPP 425 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXX-PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP P P P PPP PP P P P PP P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGP-GPGMPPMRP 446 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPP 646 P P PP P P P P P P P P P P Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMP 442 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 GG G G GGG G GG G GG G G GG G Sbjct: 575 GGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNG 629 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXX--GGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G GG G G G GG GG G GG G G GG Sbjct: 597 GDYNGGDGDYNGGDGDYNGGDDDYNGGDGDSNGGDGGDNGTGDGDGDYNGG 647 >SB_7383| Best HMM Match : SapA (HMM E-Value=1.2e-13) Length = 492 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GGG GG+ GGG GG G G G G G G G Sbjct: 132 GGGPGYGGDYGGGLGHCGGPGHGHGPGHGHGHGAGLVHGDGGPGPGHG 179 >SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) Length = 169 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PP PP P PP PP P P PP Sbjct: 36 PRPPYDDRPPSESRPRPPYDERPPSESRPRPPYERPP 72 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP-PPXSPPXSXPPPXP 856 PP P P PP P PP P PP P S P P Sbjct: 30 PPSESRPRPPYDDRPPSESRPRPPYDERPPSESRPRPPYERPPSESRPRP 79 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 725 APPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSP 829 +PP P PPPP P PP PPP P Sbjct: 510 SPPPPPPASPPPPL-PAEEDNSPPPLPAGPPPDEP 543 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PPP PP P P PP P P PPP P Sbjct: 511 PPPPPPASPPP---PLPAEEDNSPP-PLPAGPPPDEP 543 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PP PPP P P P P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGP 538 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P PP PPP P P PP P P PP P Sbjct: 511 PPPPPPASPPP-PLPAEEDNSPPPLPAGP--PPDEP 543 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 812 PPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP SPP S PPP P PPP Sbjct: 159 PPSSSPPLSSPPPPPPSTPSSSLLPPP 185 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PP P PP P PP P P P P P Sbjct: 209 PNAPPGLMPPPGMLP-PPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 795 PPXXXXPPPX--PPPXXPPPXPPXXPXXPXXPP 887 PP PPP PP PP P P P PP Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPP 249 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 3/51 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPP---PPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 PP P P P PP PP PP PPP PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 758 PPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP P PP PP PP PP PPPP Sbjct: 208 PPNAPPGLMP--PPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 31.9 bits (69), Expect = 0.73 Identities = 21/88 (23%), Positives = 21/88 (23%), Gaps = 2/88 (2%) Frame = +2 Query: 590 PXPXXXXPXXPXXXXPXPPXXXXXXXXXXXXXXXXXXXPP--PPXPXAPPXPXXXXPPPP 763 P P P P PP P P P PP P P Sbjct: 598 PEPFELRKALPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAP 657 Query: 764 XXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 P P P P PP PP Sbjct: 658 YPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXS--PPXSXP--PPXPXXXXXXX 877 PP P P P PP P PP PP + PP + P P P Sbjct: 620 PPQPETAPKPFPNITPPEVRP--SLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPS 677 Query: 878 XPPP 889 PPP Sbjct: 678 RPPP 681 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G G G GG GG GG G G GG G G G Sbjct: 513 GDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GGG GG+ GG GG G G G G GA G G G Sbjct: 478 GGGANVGGDIGGNNGAIGGDNDDGAIG--GDDGATVDGDDGAIGGGAIG 524 Score = 29.9 bits (64), Expect = 2.9 Identities = 31/121 (25%), Positives = 32/121 (26%), Gaps = 5/121 (4%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG---GGXXXXXXXXX 676 GG G GGG GG G G G G G GG GG Sbjct: 435 GGIGDGAIGGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAI 494 Query: 675 XXXXXXXGXXGGXGXXXXGXXGXXXXG-XGXXGXXGXGXXXG-EXXGXGGGXXAXXXXGX 502 G G G G G G G G G G + G G G Sbjct: 495 GGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGG 554 Query: 501 G 499 G Sbjct: 555 G 555 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = -1 Query: 885 GGXXXXXXXXGXGGGXEXG--GEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG G G G G GGG GG G G G G G G G Sbjct: 495 GGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGG 554 Query: 711 G 709 G Sbjct: 555 G 555 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G GGGG G G GG+ G GG G G G G GG Sbjct: 474 GCDGGGGANVGGDIGGNNGA--IGGDNDDG--AIGGDDGATVDGDDGAIGGGAIGDGGDN 529 Query: 720 GXGGGG 703 G G G Sbjct: 530 GGGDDG 535 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P A P PPPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPP--XXXXPPPXSPPXSXPPP 850 PPPP P PP P P PP PPP +PP PPP Sbjct: 684 PPPPAP--PPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPP---PPP 729 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 31.9 bits (69), Expect = 0.73 Identities = 30/128 (23%), Positives = 31/128 (24%), Gaps = 8/128 (6%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGG--------XXXXGGXXXXXXXGXXGGGGXXXXG 736 GGG G GG G + GGG GG G GG G Sbjct: 78 GGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDG 137 Query: 735 XGGAXGXGGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXX 556 A G G GG G G G G G G Sbjct: 138 YDAAGGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYD 197 Query: 555 GEXXGXGG 532 G GG Sbjct: 198 DGDDGGGG 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 31/125 (24%), Positives = 34/125 (27%), Gaps = 4/125 (3%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGX-EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGX 715 GGGG G GGG + G + G GG GGGG G A G Sbjct: 25 GGGGSDDDGYDAGGGGGSYDDGYDAAG-----GGGSDDDGYDAAGGGGSDHDGDDAAGGG 79 Query: 714 GGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG-- 541 G GG G G G G G + G Sbjct: 80 GSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYD 139 Query: 540 -XGGG 529 GGG Sbjct: 140 AAGGG 144 Score = 29.5 bits (63), Expect = 3.9 Identities = 28/118 (23%), Positives = 31/118 (26%), Gaps = 1/118 (0%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGX-EXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGX 715 GGG G GGG + G + GG GG GGGG G A G Sbjct: 12 GGGDSYDDGDDAGGGGGSDDDGYDAGG-----GGGSYDDGYDAAGGGGSDDDGYDAAGGG 66 Query: 714 GGGGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXGXXGXXGXGXXXGEXXG 541 G GG G G G G G + G Sbjct: 67 GSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDG 124 Score = 29.5 bits (63), Expect = 3.9 Identities = 29/119 (24%), Positives = 30/119 (25%), Gaps = 8/119 (6%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGG--GXGGGG------XXXGGXGXXXXGXGXXGGGXXXX 741 G GG GG GG G GGGG GG G G GGG Sbjct: 24 GGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDD 83 Query: 740 XGXXXXXXXXXXXXXXXXXXXXXXXXXGXEXXGXGGXXXXGXXGXXXGGXGXGGXXGXG 564 G G + G GG G GG G G Sbjct: 84 DGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAG 142 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGG----XXXXGGXXXXXXXGXXGGGG 751 GGGG GGG + G+ GGG GG G GGG Sbjct: 168 GGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGGGDDDDYDGDDDGGG 218 >SB_25393| Best HMM Match : Collagen (HMM E-Value=0.00015) Length = 391 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPP 889 PP PP PP P PP PPP PPP PP Sbjct: 286 PPVDIQPPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVD---IQPPPVDIQQPPVDIQPP 342 Query: 890 P 892 P Sbjct: 343 P 343 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 3/51 (5%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPP---XSPPXSXPPP 850 PPP PP PP PP PPP PP PP Sbjct: 292 PPPVDIQPPPVDIQPPPVDIQQPPVDIQPPPVDIQPPPVDIQQPPVDIQPP 342 >SB_23882| Best HMM Match : Cyt-b5 (HMM E-Value=9.2e-19) Length = 167 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G GGG + GG+ GG G GGGG G G G G G Sbjct: 111 GGGGGDDSGGDDDGG--GVGDDDDDDDDDDDGGGGDHGGGDGTPRGRAGEG 159 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXP 842 P PPP PP PP PPP P P Sbjct: 81 PPPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 P P PP P PP PPP PPP P Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPV---YMPPPMP 107 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP PP P PPP P Sbjct: 81 PPPPPIYMPPPPVYMPPPPVYMP 103 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 2/34 (5%) Frame = +1 Query: 565 PXPXXPPX--PXPPXXXPXXPXXXXPPXPXXSXP 660 P P PP P PP P P PP P P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMPMGDVP 112 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXP-XXPPXXP 896 P P PPP PP P P P PP P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 GG G G G GG GG GGG G G G G GG Sbjct: 747 GGDDDGDGDGDGD-GGSNGGGDGGGDGDGDGDGDGDGDGDGEYNDDGG 793 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 31.5 bits (68), Expect = 0.96 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 P PP PP P P PPP +PP PP P Sbjct: 243 PPISGPPTTSMSGPPIPVHHGMPPQYGPGRRDMPPPGAPPGMLPPGMP 290 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP---PPXSPPXSXPP 847 PP PP P PP P PP P PP PP PP Sbjct: 248 PPTTSMSGPPIPVHHGMPPQYGP--GRRDMPPPGAPPGMLPPGMPPHGMPP 296 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGG 813 GG GG G G G GG GGG G G Sbjct: 369 GGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 845 GGXXGGGXGGG-GXXXGGXGXXXXGXGXXGGG 753 GG GGG GGG G GG G G G G G Sbjct: 368 GGGRGGGRGGGRGGFRGGRG--GRGGGGRGAG 397 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.5 bits (68), Expect = 0.96 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPP 887 PPP P PPP PP P PP Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 797 PXXXXPPPXSP-PXSXPPPXPXXXXXXXXPPP 889 P PPP P P PPP P PPP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPP 830 PPP P P PP PP PP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGG------GXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 G GG G GG G G GG GGG GG GG GGG Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGG 381 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXG 736 G GGGG GGG GG GGG GG G GGGG G Sbjct: 338 GGFGGGGATVASRP---GGG---GGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXG 712 GG G GGG GGG GG G GG GG G G Sbjct: 328 GGSGGSGTSEGGFGGGGATVASRPGGGGGYSGG-------GLASSGGSTLSSEGGVAGGG 380 Query: 711 G 709 G Sbjct: 381 G 381 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 31.5 bits (68), Expect = 0.96 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPP--PPXXPXXXXXXXPPXXXXPPPXSPPXSX--PPPXPXXXXX 871 P P P AP P PP PP P S S PPP P Sbjct: 187 PAPGDPGAPEPPEPDNPPASPPMASLSQDRHSASGNAVTHPTSQENSYTGPPPPPYTSLP 246 Query: 872 XXXPPPP 892 PPPP Sbjct: 247 PDDPPPP 253 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP P PPP PPP P PP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPP 276 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXP 844 P PP PP PPPP P PP SPP P Sbjct: 254 PIPPPTKPPPRVASRRPPPPLPP----PDSSEAQAQQPPLSPPVGKP 296 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PPP PP PP PP PPP P P Sbjct: 254 PIPPPTKPPPRVASRRPP-----PPLPPPDSSEAQAQQPPLSP 291 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 31.5 bits (68), Expect = 0.96 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGG 812 GG G G G GGG GG GGG Sbjct: 371 GGEPGAFGSGSGFGGGGSSGGGGGG 395 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 813 PPPXPPPXXPPP-XPPXXP 866 PPP PPP PPP PP P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 840 PPPXPPXXPXXPXXPPXXP 896 PPP PP P P PP P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXP 854 PP PP PPP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEX-GGEXGGGXXXXGGXXXXXXXGXXG-GGGXXXXGXGGAXG 718 GGG G GGG + G GGG G G G GG G GG G Sbjct: 475 GGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGGLNGIGGMNGMRGIGGMNG 534 Query: 717 XGG 709 G Sbjct: 535 MDG 537 >SB_50455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +3 Query: 144 TLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLSLV 311 T+ AT + T T++I TTT+ T T ++TT+ T T +T+++ +++ Sbjct: 12 TIITNATTTIITLSTTIITT-TTTITTTTTTITTTITPTITTTTTIITTTITTTII 66 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGG 794 G G G G GG GGG G GGG G Sbjct: 333 GSAGDGSGDRGFLGGGGGGGGSSGGGGGRDDESG 366 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 G G GGG GGGG GG G Sbjct: 338 GSGDRGFLGGGGGGGGSSGGGGG 360 >SB_35900| Best HMM Match : EGF_CA (HMM E-Value=2.5e-38) Length = 839 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 174 TTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSS 293 T A + + PKTTT +ET TTV + T P + TS+ Sbjct: 229 TDAPATTLAPKTTTALETTVEAKTTV-VPETTPALETTSA 267 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 141 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 269 P L+ T+ T A S + P+TT ET TTV TV Sbjct: 326 PALETTSAPESTAATESTVAPETTVSQETTVAPETTVPTETTV 368 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGG-XXXXGXGGAXGXGGG 706 GGG G E GGG G G GGGG G GG G GG Sbjct: 82 GGGGSGGCEGGGGCVGCEG--GGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -1 Query: 846 GGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 GG E GG GG GG G GGG G GG G GGG Sbjct: 78 GGCEGGGGSGG---CEGGGGCVGCEG--GGGCVGCEGGGGCVGCEGGG 120 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGG--XXXGGXG 789 GG GG G G GGG G GGGG GG G Sbjct: 83 GGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGG 121 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGG 752 GG G G G GGG G GGG G G G GGG Sbjct: 78 GGCEGGGGSGGCEGGGGCVGCEGGG-GCVGCEGGGGCVGCEGGGG 121 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGG 756 G G GGG GG GGGG G G GG Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGG 112 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 G G G G G GGG GGG G G G G Sbjct: 225 GEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDG 260 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXG 768 G G G G G G G GGG GGG G G G G Sbjct: 221 GEGEGEGDGDGDGDGNGDGDGGGG-DGGGDGDGDDGGVGDGDG 262 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG GG G G GGG G GG G GG Sbjct: 201 GFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGG---RGGFGGDFGGDGG 247 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 874 GXXGXXGGXG--GGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG G GG GG GG G G G GGG G Sbjct: 192 GYDGGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRG 236 >SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 936 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXG-GGXEXGGEXGGGXXXXGGXXXXXXXGXX---GGGGXXXXGX 733 G GGG G GG + G+ GG GG G GGGG G Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDVGC 548 Query: 732 GGAXGXGGG 706 G GGG Sbjct: 549 GCDESSGGG 557 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = -1 Query: 855 GXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXG---GGGXXXXGXGGAXGXGGGG 703 G GG + G+ GG GG G GGG G G GGGG Sbjct: 489 GGDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGG 542 >SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG G G G GG G GGG GGG G Sbjct: 36 GGYNGVDGDGDGSDGGVVNGDNGGGDNGGGDNGDSDG 72 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P P P P PP P P P P PP P P P Sbjct: 122 PRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG G GGG G G G G G GGG G Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMG 57 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 883 GXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GG G GGG G G GG G GG G G G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRG--QGGGMGRGPGGGWGRGSGGG 47 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXG-GEXGGGXXXXGGXXXXXXXGXXG---GGGXXXXGXGGA 724 GGG G G G G G GG GG G G GGG G GG Sbjct: 21 GGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGR-GPGGG 79 Query: 723 XGXGGGG 703 G G GG Sbjct: 80 LGRGPGG 86 Score = 29.5 bits (63), Expect = 3.9 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 1/120 (0%) Frame = -1 Query: 888 GGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGG 709 G G G G G GG G G G G GGG GG G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 61 Query: 708 GGXXXXXXXXXXXXXXXXGXXGGXGXXXXGXXGXXXXGXG-XXGXXGXGXXXGEXXGXGG 532 GG G G G G G G G G G G G Sbjct: 62 GGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRGMGCGWGCGNGRFG 121 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAX 721 G G G G G G GG G G G G GGG G GG Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGR-GPGGGW 64 Query: 720 GXGGGG 703 G GG Sbjct: 65 GRMQGG 70 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGG-A 724 G G G G G G GG G G G G GGG GG Sbjct: 14 GGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMG 73 Query: 723 XGXGGG 706 G GGG Sbjct: 74 RGPGGG 79 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGXG-GGXXGGGXG---GGGXXXGGXGXXXXGXGXXGG 756 GG G G G G G G GGG G GGG G G G G G Sbjct: 38 GGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 89 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 174 TTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSS 293 T A + + PKTTT +ET TTV + T P + TS+ Sbjct: 2291 TDAPATTLAPKTTTALETTVEAKTTV-VPETTPALETTSA 2329 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 174 TTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSS 293 T A + + PKTTT +ET TTV + T P + TS+ Sbjct: 776 TDAPATTLAPKTTTALETTVAAKTTV-VPETTPALETTSA 814 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +3 Query: 141 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 269 P L+ T+ T A S + P+TT ET TTV TV Sbjct: 2022 PALETTSAPESTAATESTVAPETTVSQETTVAPETTVPTETTV 2064 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G GG GG GG G GG G G G G G Sbjct: 177 GFPGGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAG 218 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGX-GGGXXGGGXGGGGXXXGGXG 789 GG GG G GG G G GG G G GG G Sbjct: 188 GGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGGMPGGPG 225 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 P PP P P PP PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP PPP P P P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 825 PPPXXPPPXPPXXPXXPXXPPXXP 896 PPP PPP P P PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 P P P PP P P PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 PP PPP PPP PP P Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMP 105 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPP 763 PPP P PP PPPP Sbjct: 82 PPPPPPPPPASNVPAPPPP 100 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P A P PPP P Sbjct: 84 PPPPPPPASNVPAPPPPPPVMPP 106 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 P PPP P PP PP PPP Sbjct: 582 PIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP PP PP PP P P PP P Sbjct: 26 PPTDPPTDPPTDPPTDP--PTDPPTDP 50 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PP PP PP PP P P PP Sbjct: 27 PTDPPTDPPTDPPTDPPTDPPTDP--PTDPP 55 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 PP PP PP PP PP PP P Sbjct: 26 PPTDPPTDPP---TDPPTDPPTDPPTDPPTDP 54 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 P PP PP PPP P P P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P PP PP PPP PP PP P P Sbjct: 230 PKPPTA--PPNTPPPPVTPP-PPNTPGPP 255 >SB_32428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/49 (30%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 704 PPPPXPXAPPXPXX-XXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPP 847 P P PP P PPPP PP PP + + PP Sbjct: 96 PAQPDTDVPPPPATTSAPPPPTTTAPPATTSPPTTTDSPPTTAAETLPP 144 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP-PPXSPPXSXPPPXP 856 PPP APP P PP P P PP P P P Sbjct: 105 PPPATTSAPPPPTTTAPPATTSPPTTTDSPPTTAAETLPPTDAPTEAPTEPP 156 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXP-PXXXXPPPXSPPXSXPPP 850 P PP P P P P P P P P P P S P P Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKP 192 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +2 Query: 710 PPXPXAPPXPXXXXPPPPXXPXXXXXXXP-PXXXXPPPXSPPXSXP-PPXP 856 P PP P P P P P P P P P S P PP P Sbjct: 152 PEPETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/80 (25%), Positives = 21/80 (26%) Frame = +2 Query: 500 PXPXXXXAXXPPPSPXXSPXXXPXPXXPXXPXPXXXXPXXPXXXXPXPPXXXXXXXXXXX 679 P P P P+P P P P P PP Sbjct: 1388 PAPMLAPMLAPMPAPCAPPECHTHSVQVKQTHHMAPAPPPPMAFPPMPPAPGQVITHLQH 1447 Query: 680 XXXXXXXXPPPPXPXAPPXP 739 PPPP P APP P Sbjct: 1448 IVHHKILPPPPP-PPAPPCP 1466 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P P P P P PPP PPP P P P P Sbjct: 926 PSPEPLPEVDIMRSPTPT----PPPSPPPKEPTPPPSSKP 961 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 5/68 (7%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPP-----PXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXX 868 PP P P P P P P P P P PP SP P P Sbjct: 945 PPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSPHKQTRPISPVGAS 1004 Query: 869 XXXXPPPP 892 P P Sbjct: 1005 NLYKPLTP 1012 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 848 GGGXXGGGXGGGGXXXGG 795 GGG GGG GGGG GG Sbjct: 164 GGGGGGGGGGGGGRRGGG 181 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 884 GXGXXXGXXGGXGGGXXGGGXGGG 813 G G GG GGG GG GGG Sbjct: 158 GRNRRRGGGGGGGGGGGGGRRGGG 181 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGG 810 GG GGG GGG GGG Sbjct: 166 GGGGGGGGGGGRRGGG 181 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 747 PXPPPXXX-PPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P PPP PP P P P PPP P PP Sbjct: 228 PAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPP 265 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXP 883 PPP AP P PPP PP PPP P P Sbjct: 175 PPPGHYPAPGQPGGYYPPP-----GGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPA 229 Query: 884 PPP 892 PPP Sbjct: 230 PPP 232 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPP----PXPPXXPXXPXXPP 887 PP P PP PPP P PP P P P PP Sbjct: 218 PPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPP 265 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +2 Query: 728 PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 PP P PP P P P P P P P P P P Sbjct: 232 PPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEP 286 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/48 (31%), Positives = 15/48 (31%), Gaps = 1/48 (2%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPP-XXPPPXPPXXPXXPXXPPXXP 896 PP PP P P P P P P P P P P P Sbjct: 241 PPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEP 288 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/64 (26%), Positives = 17/64 (26%), Gaps = 2/64 (3%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPP--PPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXX 880 PPP P P PP P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEP 290 Query: 881 PPPP 892 P P Sbjct: 291 EPEP 294 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 813 PPPXPPPXXPPPXP 854 PPP PPP PPP P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 816 PPXPPPXXPPPXPP 857 PP PPP PPP PP Sbjct: 211 PPPPPPPPPPPPPP 224 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +2 Query: 713 PXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP--XSXPPPXPXXXXXXXXPP 886 P APP PPP P P PPP PP S PPP PP Sbjct: 270 PFNQAPPGFPPRWGPPPHMP-------PDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPP 322 Query: 887 P 889 P Sbjct: 323 P 323 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GGG + GG GG G GGGG G G GGG Sbjct: 8 GGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDG-GNDDDDGGG 54 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG GGG G GG G G G GGG G Sbjct: 4 GDDGGGGGG--GNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDG 45 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 GG GGG G G GGGG G G Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGG 3721 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGG 795 G G GGG GGG GG G GG Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGG 3721 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 771 GXXGGGGXXXXGXGGAXGXGGGG 703 G GGGG G GG G G GG Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGG 3721 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 849 GGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GGG + GG GG G GGGG G G GGG Sbjct: 48 GGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDG-GNDDDDGGG 94 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 866 GXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG GGG G GG G G G GGG G Sbjct: 44 GDDGGGGGG--GNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDG 85 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P P P P P PPP PP P P P P Sbjct: 155 PTTTKKPTTKPTPAPHSSPSPTPPPPPIIPPCPPVINLLIPTARPCMP 202 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGG 810 GG G G GG GGG GGGG Sbjct: 47 GGVGDDDGGGGGCGGGDDDDDGGGGG 72 >SB_10235| Best HMM Match : Coiled (HMM E-Value=6) Length = 158 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G G GGG GG GGG G G G G G Sbjct: 105 GDNDGCGGGDDDGGRGGGDDDDGDADGDGDGDDDDGDGDG 144 >SB_51906| Best HMM Match : DUF1621 (HMM E-Value=0.22) Length = 266 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/53 (28%), Positives = 33/53 (62%) Frame = +3 Query: 162 TNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLSLVLAV 320 TN++TT+ T++I T T+ T T ++ T+ IT T+ +T ++ +++ + + Sbjct: 168 TNIITTSNTNIITTTTITITITIT-ITITITITITI-TITITITITITITITI 218 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PP PPP PPP PP Sbjct: 163 PPQPPPPPLPPPPPP 177 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 813 PPPXPPPXXPPPXPP 857 PPP PPP PP PP Sbjct: 162 PPPQPPPPPLPPPPP 176 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PPP P P P P PP PP PP Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +2 Query: 704 PP--PPXPXAPPXPXXXX-PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PP PP P P P PPPP P P P PPP Sbjct: 867 PPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 710 PPXPXAPPX--PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPP---XSXPPPXPXXXXXX 874 P P APP P PP P PP PPP P S Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDG 909 Query: 875 XXPPPP 892 PPPP Sbjct: 910 RKPPPP 915 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPP 833 PP P P PP PPP P P Sbjct: 867 PPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 156 TATNLLTTARTSLILPKTTTL-METATNLSTTVHITWTVPKADLTSSLPLSLVLAVGSKE 332 T +L TTA + P+TTT + T +TT + T P+A T+SL + LA + E Sbjct: 566 TTASLATTAPEATTAPETTTALLVTTAPETTTASLVTTAPEA-TTASLATTASLATTAPE 624 Score = 29.1 bits (62), Expect = 5.1 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = +3 Query: 144 TLKETAT-NLLTTARTSLILPKTTTL-METATNLSTTVHITWTVPKADLTSSLPLSLVLA 317 T ET T +L TTA + P+TTT + T +TT + T P+A T+SL + A Sbjct: 519 TAPETTTASLATTAPETTTAPETTTASLATTAPETTTASLVTTAPEA-TTASLATTAPEA 577 Query: 318 VGSKEYLRKLI 350 + E L+ Sbjct: 578 TTAPETTTALL 588 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +3 Query: 156 TATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTSSL 296 T +L+TTA + P+TTT E T TT T T+SL Sbjct: 139 TTASLVTTAPEATTAPETTTAPEATTAPETTTASLVTTAPETTTASL 185 >SB_8632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1296 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +3 Query: 144 TLKETATNLLTTARTSLILPKTTTLMETA-TNLSTTVHITWTVPKADLTSSLPLSLVL 314 T+ +TAT+ T TS +L +T L+ T T+ +T+ H+T LTS+ ++ V+ Sbjct: 434 TVTDTATS--TAVVTSTVLVASTRLLSTVKTHTATSTHVTTATSTDTLTSTAIVTSVM 489 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP PP P PPP P Sbjct: 366 PPPPHSPPPPLPVIQLNPPPARP 388 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PPP PPP P P PP P Sbjct: 363 PTPPPPPHSPPPPLPVIQLNP--PPARP 388 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 847 GGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 GGG GGG G G G G G G G G Sbjct: 12 GGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDG 45 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGG 795 G G G G G G G GGG GGG G Sbjct: 251 GDGDGDGDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -1 Query: 828 GEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGGG 703 G+ GG G G G G GG G GGGG Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGG-GGXXXXGXGGA 724 G GG G G G G GG GG G GG GG G GG Sbjct: 199 GGIGGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGV 258 Query: 723 XGXGGGG 703 G G Sbjct: 259 IAGAGAG 265 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 895 GXXGGXXGXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXGGGXG 746 G GG G G GG G G GGG GG G G G Sbjct: 242 GGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGGIPGGILPGLAHGNLAG 291 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGG 810 G GG G G G G GGG GG G Sbjct: 288 GSAGGISASGGAGGSGGAGGVGGGGGGTG 316 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXGXXXXG 774 GG GG GG GGGG GG G G Sbjct: 297 GGAGGSGGAGGVGGGG---GGTGSCDLG 321 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 364 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 378 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPYEP 385 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 346 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPYEPGRPPHEP 392 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 371 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP--PXSPP--XSXPPPXPXXXXXX 874 PP P PP P P P P PP P PP PP P Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYE 384 Query: 875 XXPPP 889 PP Sbjct: 385 PGRPP 389 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP--PXSPP--XSXPPPXPXXXXXX 874 PP P PP P P P P PP P PP PP P Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHE 391 Query: 875 XXPPP 889 PP Sbjct: 392 PGRPP 396 >SB_18540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 286 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +3 Query: 144 TLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTS 290 T TA N TT T+ TTT T +TT + T T P TS Sbjct: 104 TATVTAPNATTTTPTATTTTTTTTTTTTPYATTTTPNTTTTTPNTTTTS 152 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 159 ATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVPKADLTS 290 AT +TT ++ P TT TAT +TT T T P A T+ Sbjct: 96 ATATITTYTATVTAPNATTTTPTATTTTTTT-TTTTTPYATTTT 138 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGG 794 GG GGG GGG GG GG Sbjct: 186 GGGGGGTTGGGGSGGEGTTGG 206 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 878 GXXXGXXGGXGGGXXGGGXGGGG 810 G G GG GGG GGG GGGG Sbjct: 147 GSVRGRGGGRGGG--GGGCGGGG 167 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 130 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 144 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPYEP 151 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 112 PPHEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPYEPGRPPHEP 158 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P PP PP P PP P P P PP P Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPPHEP-GRPPHEPGRPPHEPGRPPHEP 137 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP--PXSPP--XSXPPPXPXXXXXX 874 PP P PP P P P P PP P PP PP P Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYE 150 Query: 875 XXPPP 889 PP Sbjct: 151 PGRPP 155 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPP--PXSPP--XSXPPPXPXXXXXX 874 PP P PP P P P P PP P PP PP P Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHE 157 Query: 875 XXPPP 889 PP Sbjct: 158 PGRPP 162 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPP----PXXPPP--XPPXXPXXPXXPP 887 P P P P P P P P PP P PPP P P PP Sbjct: 580 PAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPP 632 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 707 PPPXPXA---PPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXX 877 PPP P P P P P P PP P PP P Sbjct: 593 PPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAGYPGY 652 Query: 878 XPPP 889 PPP Sbjct: 653 GPPP 656 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXG 736 GGG G G G GG+ GG GG G GGGG G Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDV-GGDDGDGGNCDGDGYGDVGGGGDDDDG 89 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 831 GGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 G GGG GG G G G G GG G GGG Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRG-GGRGGFGGG 374 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXG 788 G G GGG GGG G G GG G Sbjct: 148 GPVRGRGGGGRGGGRGHGRGGSGGGG 173 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 PPP PP P PP PPP P P P Sbjct: 5 PPPPPPPP----PIAAEFTAPPAPPPPPNPAPDVP 35 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPPP P A PPPP P Sbjct: 8 PPPPPPIAAEFTAPPAPPPPPNP 30 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +3 Query: 774 PXXXXPXPPXXXXPP-PXPPPXXPPPXPP 857 P P PP PP P P P P P PP Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPP 857 P P P PP P P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXP 854 P P P PP PP P P P P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXP 854 PP PP PPP PP P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRP 1598 >SB_32416| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0021) Length = 358 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 PP PPP P P P P P P Sbjct: 152 PPYQVPPPPTPQPYHPHPYPSSGP 175 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXP---PPXSPPXSXP-PPXPXXXXX 871 P P P P P P PP P P P PP P + P PP Sbjct: 179 PEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRPEYAHPYPPRRPEYAH 238 Query: 872 XXXPPPP 892 P PP Sbjct: 239 PFLPLPP 245 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 756 PPXXXPPXXXXPXPPXXXXPPPXPP 830 P PP P PP PPP PP Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPPPP 216 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPP 857 PP PPP PP PPP PP Sbjct: 197 PPPSGAPPP-PPIGAPPPPPP 216 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPP 763 PPP PP P PPPP Sbjct: 197 PPPSGAPPPPPIGAPPPPP 215 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXG 788 G G GGG GGG G G GG G Sbjct: 65 GPVRGRGGGGRGGGRGHGRGGSGGGG 90 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXG 788 G G GGG GGG G G GG G Sbjct: 318 GPVRGRGGGGRGGGRGRGRGGSGGGG 343 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPPPXXP 772 PPP P PP PPPP P Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPP 806 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 789 PXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 P P PPP P P P PP P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEP 816 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXP 884 PP P PP P PPP PP P P P Sbjct: 784 PPPEYPPPPPGLARP--NPPPPNPPLQVTSIPGEPAPP 819 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 789 PXPPXXXX--PPPXPPPXXPPPXPPXXP 866 P PP PPP PPP P PP P Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXP-PPXPPP 833 P PPP P PP P PP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P PP P PP PPP PP P P P Sbjct: 522 PAPQPPSP--PAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXP 772 P P P +PP P PPP P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSP 543 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPP 845 PPP PP P PP P P P PP Sbjct: 432 PPPLPQPPPSIIP-PPTTPLPQTVPTPPRPP 461 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 759 PXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 P PP P PP PPP P P PP P Sbjct: 429 PSHPPPL---PQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 771 PPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPPXXP 896 PP P P P P PPP PP P PP P Sbjct: 423 PPGGGVPSHPP---PLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXP 884 PP PPP PP P P P P Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 795 PPXXXXPPPXPPPXXPPPXPPXXP 866 PP PPP P PP PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 816 PPXPPPXXPPPXPPXXPXXPXXPP 887 PP PP P PP P P PP Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +3 Query: 156 TATNLLTTARTSLILPKTTTLMETATNLSTTVHITWT 266 T T TT T+ I TTT T TN +TTV+ T T Sbjct: 545 TITTNYTTTVTTTITNYTTTFTITITNYTTTVNTTIT 581 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G G G GG G GGG GG G G GGG Sbjct: 189 GASAGGGGGVGTTGGSTGAA-GGGGGGTSTSTGSSGSTGTSMVTSGGG 235 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G GG G G GGG GGGG GG GGG G Sbjct: 248 GGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNAG 301 >SB_47112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 970 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 141 PTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTVP 272 PT ++T TNL +T R +TTT + + +TT T T+P Sbjct: 188 PTTQQTTTNLPST-RQPTTNQQTTTTLPSTKQPTTTQQTTTTIP 230 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -3 Query: 874 GXXGXXGGXGGGXXGGGXGGGXXXXGGXGXXXXGGXXXG 758 G G G G GG G G GG G GG G Sbjct: 73 GYTGFFSGSGRNSSSGGSGAGHATLGGNGESLEGGLEYG 111 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXX--XXPPPXPPPXXPPPXP 854 P PP P PP P P PP PPP P Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 PPP P P P P P PP PP P Sbjct: 51 PPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPXPXAPPXPXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPP 850 PPP P P P PP P P P +PP PPP Sbjct: 50 PPPPPTRPSHSCGPHPVPP----------TPLVQHPEPEAPPQLPPPP 87 >SB_39126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 747 PXPPPXXXP-PXXXXPXPP--XXXXPPPXP-PPXXPPPXPPXXPXXPXXPPXXP 896 P PPP P P P PP P P PP P P P P P P Sbjct: 7 PIPPPKLEPIPPEIDPIPPEVDTISPEIDPIPPDINPILPEVDPILPEIDPIPP 60 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 886 GGXXGXXGXXGGXGGGXXGGGXGG 815 GG G G G GG GGG GG Sbjct: 302 GGNAGGNGGNAGGNGGMTGGGAGG 325 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 887 GGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXG 789 GG GG GG G G GG GG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGGGAG 324 >SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) Length = 229 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 865 GXXGGXGGGXXGGGXGGGXXXXGGXG 788 G G GGG GGG G G GG G Sbjct: 118 GPVRGRGGGGRGGGRGYGRGGSGGGG 143 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 Query: 755 PPPXXPXXXXXXXPPXXXXPPPXSPPXSXP 844 PPP P PP P P +PP + P Sbjct: 179 PPPLNPYQPPPFPPPHLMYPQPTAPPAAIP 208 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGG 753 G G G G GG G GGG GG G G GGG Sbjct: 235 GASAGGGGGVGTTGGSTGAA-GGGGGGTSTSTGSSGSTGTSMVTSGGG 281 >SB_42829| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=8.2) Length = 127 Score = 29.1 bits (62), Expect = 5.1 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = -2 Query: 899 GGXXGGXGXXXGXXGGX-------GGGXXGGGXGGGGXXXGG-XGXXXXGXGXXGG 756 GG GG G GG GGG GG G G GG G G G GG Sbjct: 58 GGVMGGSVMGDGVIGGGVMDDSVMGGGVIGGSVMGDGVMGGGVMGGSVMGGGVMGG 113 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 752 PPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXP 856 PPPP P PP PP PP P Sbjct: 488 PPPPPSDAMMQGMGAPSMSEPPAGGPPMGQGPPRP 522 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXP 866 PP P P P PPP PPP P P Sbjct: 70 PPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSP 107 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +2 Query: 737 PXXXXPPPPXXPXXXXXXXPPXXXXPPPXSPPXSXPPPXPXXXXXXXXPPPP 892 P PP P PP PP + PPP P PP Sbjct: 64 PPVASTPPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPP 115 >SB_3187| Best HMM Match : WD40 (HMM E-Value=2.2e-08) Length = 1259 Score = 29.1 bits (62), Expect = 5.1 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -1 Query: 891 GGGGXXXXXXXXGXGGGXEX--GGEX--GGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGA 724 GGGG GGG GGE GGG GG G GG GG Sbjct: 874 GGGGLTIGGGEVTIGGGEVTIGGGEVTIGGGELTIGGGELTIGGGELTIGGGELTIGGGE 933 Query: 723 XGXGGG 706 GGG Sbjct: 934 LTIGGG 939 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXP 875 P P P P P PPP PP PP P P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPPQQFIPSPQFP 474 Score = 24.6 bits (51), Expect(2) = 5.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 704 PPPPXPXAPPXPXXXXPPP 760 PPPP P PP P P P Sbjct: 454 PPPPPPSQPP-PQQFIPSP 471 Score = 22.6 bits (46), Expect(2) = 5.5 Identities = 10/31 (32%), Positives = 10/31 (32%) Frame = +2 Query: 530 PPPSPXXSPXXXPXPXXPXXPXPXXXXPXXP 622 PPP P S P P P P P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQP 462 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 896 GXXGGXGXXXGXXGGXGGGXXGGGXGGGGXXXGGXGXXXXGXGXXGGGXXXXXG 735 G G G G GGG G G G GG G G GGG G Sbjct: 228 GRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSV-FKPVDLGSGGGGSWGGAG 280 >SB_42229| Best HMM Match : Na_H_Exchanger (HMM E-Value=3.9) Length = 678 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +3 Query: 156 TATNLLTTART-SLILPKTTTLMETATNLSTTVHITWTVPKADLTSSLPLSLVLAV 320 T +L+T T L++ T L+ T + V IT T+P +T+ LPL ++ + Sbjct: 278 TILHLVTITTTLPLVVITTILLLVVITTILPLVAITTTLPLVAITTILPLVVITTI 333 >SB_38582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1438 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/74 (28%), Positives = 32/74 (43%) Frame = +3 Query: 90 YKNEILHDFPSSLCWLWPTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 269 + N I H ++ T+K T + TA T+ TTT T T +TT T T Sbjct: 12 HHNNIHHHHYATTKTTAATIKTKTTIIAITAITTTTTTTTTTTTTTTTTTTTTTTTTTTT 71 Query: 270 PKADLTSSLPLSLV 311 A T ++ ++ V Sbjct: 72 ATA-TTKTITITTV 84 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 774 PXXXXPXPPXXXXPPPXPPPXXPP 845 P P PP PPP PPP PP Sbjct: 29 PPEAPPLPPFAPLPPPVPPP--PP 50 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 798 PXXXXPPPXPPPXXPPPXP 854 P PPP PPP PP P Sbjct: 813 PHEDSPPPPPPPPPPPEEP 831 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/74 (28%), Positives = 32/74 (43%) Frame = +3 Query: 90 YKNEILHDFPSSLCWLWPTLKETATNLLTTARTSLILPKTTTLMETATNLSTTVHITWTV 269 + N I H ++ T+K T + TA T+ TTT T T +TT T T Sbjct: 134 HHNNIHHHHYATTKTTAATIKTKTTIIAITAITTTTTTTTTTTTTTTTTTTTTTTTTTTT 193 Query: 270 PKADLTSSLPLSLV 311 A T ++ ++ V Sbjct: 194 ATA-TTKTITITTV 206 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -3 Query: 895 GXXGGXX-GXXGXXGGXGGGXXGGGXGGGXXXXGGXG 788 G GG G G GG GGG G GG G G Sbjct: 262 GYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 885 GGXXXXXXXXGXGGGXEXGGEXGGGXXXXGGXXXXXXXGXXGGGGXXXXGXGGAXGXGGG 706 GG G GG G G GG G GGG GG G GG Sbjct: 244 GGSITEGWVGGKAGGMNSGYNGGPPPGAVGGF------GGWGGGSEDNGASGGGGGYSGG 297 Query: 705 G 703 G Sbjct: 298 G 298 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 900 GXXGGGGXXXXXXXXGXGGGXEXGGEXGGGXXXXGG 793 G GG G GGG E G GGG GG Sbjct: 262 GYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGG 297 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 753 PPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPP 848 PP P P PPP PPP PP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVPP 146 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 747 PXPPPXXXPPXXXXPXPPXXXXPPPXPPPXXPPPXPPXXPXXPXXPP 887 P PPP P P P PP PP P PP Sbjct: 602 PTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPP 648 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 813 PPPXPPPXXPPPXPPXXP 866 P P PPP PP PP P Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 857 GGXGGGXXGGGXGGGGXXXGGXG 789 G GGG GGG G GG G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDG 106 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 856 GGXGGGXXGGGXGGGXXXXGGXG 788 GG GG GGG GGG G G Sbjct: 86 GGGGGDGGGGGDGGGDGDGDGDG 108 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,992,116 Number of Sequences: 59808 Number of extensions: 548999 Number of successful extensions: 19238 Number of sequences better than 10.0: 278 Number of HSP's better than 10.0 without gapping: 1779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7123 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -