BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K05 (859 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) 29 3.7 SB_10098| Best HMM Match : NADH5_C (HMM E-Value=0.94) 29 4.8 SB_32048| Best HMM Match : NADH5_C (HMM E-Value=3.8) 29 4.8 SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 >SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) Length = 2865 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +2 Query: 389 NRETGILLSRQDKNTAEISTIVSQTYKHEY--LQKLI-EQW 502 NR +G+LLSRQ S +S TY+ + L+ L+ E+W Sbjct: 968 NRSSGVLLSRQSTGHMNASIKISTTYETSFSTLRPLVNEEW 1008 >SB_10098| Best HMM Match : NADH5_C (HMM E-Value=0.94) Length = 310 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = -1 Query: 484 LKIFMFICLRYYCRYFCCIFVLAAKQYPCFSISLFGLTITSFL*YFFLKLYRSISLCSTT 305 L++ F+CL Y C ++ L + C + + ++ FF+ L + S S Sbjct: 23 LRVLFFVCLNYNCSR-ASVYDLRVLFFVCLNYNCSRASVYDLRVLFFVCLNYNYSRVSVI 81 Query: 304 TLYLILFVFL 275 Y LFV + Sbjct: 82 YAYCSLFVLI 91 >SB_32048| Best HMM Match : NADH5_C (HMM E-Value=3.8) Length = 347 Score = 29.1 bits (62), Expect = 4.8 Identities = 17/70 (24%), Positives = 30/70 (42%) Frame = -1 Query: 484 LKIFMFICLRYYCRYFCCIFVLAAKQYPCFSISLFGLTITSFL*YFFLKLYRSISLCSTT 305 L++ F+CL Y C ++ L + C + + ++ FF+ L + S S Sbjct: 23 LRVLFFVCLNYNCSR-ASVYDLRVLFFVCLNYNCSRASVYDLRVLFFVCLNYNYSRVSVI 81 Query: 304 TLYLILFVFL 275 Y LFV + Sbjct: 82 YAYCSLFVLI 91 >SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 29.1 bits (62), Expect = 4.8 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 6/77 (7%) Frame = -1 Query: 496 FY*LLKIFMF---ICLRYYCRYFCCIFVLAAK-QYPCF-SISLFGLTITSFL*YFFLKLY 332 F L IF+F + LRY C CIF L+ +Y C +I +F + ++ L Y +L Sbjct: 1898 FLYLCAIFVFALSVSLRYICLCAFCIFALSVSLRYLCLCAICIFAVFVS--LRYLYLCGI 1955 Query: 331 RSISL-CSTTTLYLILF 284 R +L S LYL F Sbjct: 1956 RIFALSVSLRFLYLCAF 1972 Score = 28.3 bits (60), Expect = 8.5 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Frame = -1 Query: 472 MFICLRYYCRYFCCIFVLAAK---QYPCFSISLFGLTITSFL*YFFLKLYRSISL-CSTT 305 +F+ L Y C CIF L+ Y C +I +F L+++ L Y +L + +L S Sbjct: 1841 LFVSLSYLCLCAICIFALSVSLRYLYLC-AICIFALSVS--LRYLYLCAFCIFALYLSLR 1897 Query: 304 TLYL-ILFVF 278 LYL +FVF Sbjct: 1898 FLYLCAIFVF 1907 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,578,677 Number of Sequences: 59808 Number of extensions: 383173 Number of successful extensions: 845 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -