BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K05 (859 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g17830.1 68418.m02090 hypothetical protein contains Pfam doma... 32 0.56 At4g39770.1 68417.m05632 trehalose-6-phosphate phosphatase, puta... 29 4.0 At1g31840.1 68414.m03912 pentatricopeptide (PPR) repeat-containi... 28 6.9 At5g33303.1 68418.m03951 hypothetical protein 28 9.1 At3g57290.1 68416.m06377 eukaryotic translation initiation facto... 28 9.1 At1g78090.1 68414.m09100 trehalose-6-phosphate phosphatase (TPPB... 28 9.1 >At5g17830.1 68418.m02090 hypothetical protein contains Pfam domain, PF04515: Protein of unknown function, DUF580 Length = 474 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -2 Query: 477 YSCLYVCDTIVDISAVFLSWRLSSIPVSLFLSLVSQSHP 361 ++C +VC+ + A F L +I V LFL L+ +S+P Sbjct: 109 WNCFFVCNIRATVKATFWFTPLFTISVGLFLILLDKSNP 147 >At4g39770.1 68417.m05632 trehalose-6-phosphate phosphatase, putative similar to trehalose-6-phosphate phosphatase (AtTPPB) [Arabidopsis thaliana] GI:2944180; contains Pfam profile PF02358: Trehalose-phosphatase Length = 349 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 380 KERNRETGILLSRQDKNTAEISTIVSQTYKHEYLQKLIEQWK 505 +ER + GIL+S+ K T+ ++ E+LQ+L+E WK Sbjct: 303 RERRQGLGILVSKFPKETSASYSLQEPDEVMEFLQRLVE-WK 343 >At1g31840.1 68414.m03912 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR domains: Pfam profile: PF01535: PPR repeat Length = 690 Score = 28.3 bits (60), Expect = 6.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 629 LQQGNK*SVSFVLCRSTLLTELTKCHRVTNTSPYF 525 L Q NK S +C + ++ L KCHR+ + S +F Sbjct: 591 LMQRNKISADIAVC-NVVIHLLFKCHRIEDASKFF 624 >At5g33303.1 68418.m03951 hypothetical protein Length = 336 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 49 IDRLR*SPQVVSKMYFTKIVFIRHHLHND 135 +D ++ Q SK ++F+RHHLH D Sbjct: 32 LDTIKDGNQTPSKDKSKAMIFLRHHLHED 60 >At3g57290.1 68416.m06377 eukaryotic translation initiation factor 3E / eIF3e (TIF3E1) identical to eukaryotic initiation factor 3E subunit [Arabidopsis thaliana] gi|12407658|gb|AAG53613 Length = 441 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 102 FCKIHFRNDLWALAESINRN 43 +CKIH R D+ LAE +N N Sbjct: 353 YCKIHQRIDMGVLAEKLNLN 372 >At1g78090.1 68414.m09100 trehalose-6-phosphate phosphatase (TPPB) identical to trehalose-6-phosphate phosphatase (AtTPPB) GI:2944180 [Arabidopsis thaliana] Length = 374 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +2 Query: 380 KERNRETGILLSRQDKNTAEISTIVSQTYKHEYLQKLIEQWK 505 +ER + GIL+S+ K+T ++ + +++L++L+E WK Sbjct: 327 RERGQGFGILVSKVPKDTNASYSLQDPSQVNKFLERLVE-WK 367 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,412,538 Number of Sequences: 28952 Number of extensions: 273644 Number of successful extensions: 604 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1999652000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -