BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K03 (953 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 23 4.6 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.4 bits (48), Expect = 2.6 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 171 PXRGVSKPPKNXERGPQGXFXXNPPI 94 P +G + PP + GP +PP+ Sbjct: 1105 PLKGTAVPPPSGSSGPGSTGSKSPPV 1130 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.6 bits (46), Expect = 4.6 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = -3 Query: 165 RGVSKPPKNXERGPQGXFXXNPPIFWKGKLKIPQKFL*REFPP 37 R + PP N + NP I G P FL +PP Sbjct: 134 RVMMSPPGNVLNLTMPKYEPNPSIIDPGPALPPTGFLCNNYPP 176 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,250 Number of Sequences: 336 Number of extensions: 1327 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26892580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -