BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_K01 (870 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera... 100 4e-20 UniRef50_Q0Q027 Cluster: Putative defense protein; n=1; Antherae... 48 4e-04 UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecro... 46 0.001 UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera... 44 0.004 UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re... 42 0.020 UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor... 38 0.25 >UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera|Rep: Antibacterial peptide - Bombyx mori (Silk moth) Length = 66 Score = 100 bits (240), Expect = 4e-20 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 123 AIICIMIVSCASAWDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGLV 266 AIICIMIVSCASAWDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGLV Sbjct: 10 AIICIMIVSCASAWDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGLV 57 >UniRef50_Q0Q027 Cluster: Putative defense protein; n=1; Antheraea mylitta|Rep: Putative defense protein - Antheraea mylitta (Tasar silkworm) Length = 144 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +3 Query: 177 ELEGVGQRVRDSIISAGPAIDVLQ 248 ELEG+GQRVRDSII AGPAIDVLQ Sbjct: 55 ELEGIGQRVRDSIIIAGPAIDVLQ 78 >UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecropin-D - Antheraea pernyi (Chinese oak silk moth) Length = 36 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/34 (61%), Positives = 26/34 (76%) Frame = +3 Query: 162 WDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGL 263 W+ FKELE GQRVRD+IISAGPA+ + +A L Sbjct: 1 WNPFKELERAGQRVRDAIISAGPAVATVAQATAL 34 >UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera|Rep: Cecropin-B precursor - Bombyx mori (Silk moth) Length = 63 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = +3 Query: 162 WDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGL 263 W FK++E +G+ +RD I+ AGPAI+VL AK + Sbjct: 28 WKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAI 61 >UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep: Cecropin-A precursor - Hyalophora cecropia (Cecropia moth) Length = 64 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/31 (54%), Positives = 23/31 (74%) Frame = +3 Query: 162 WDFFKELEGVGQRVRDSIISAGPAIDVLQKA 254 W FK++E VGQ +RD II AGPA+ V+ +A Sbjct: 28 WKLFKKIEKVGQNIRDGIIKAGPAVAVVGQA 58 >UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor; n=5; Ditrysia|Rep: Antibacterial peptide enbocin precursor - Bombyx mori (Silk moth) Length = 59 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 129 ICIMIVSCASAWDFFKELEGVGQRVRDSIISAGPAIDVLQKA 254 + + + W+ FKE+E R RD++ISAGPA+ + A Sbjct: 12 VVVFATASGKPWNIFKEIERAVARTRDAVISAGPAVRTVAAA 53 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,278,809 Number of Sequences: 1657284 Number of extensions: 8162929 Number of successful extensions: 16421 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 16168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16418 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 77472727479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -