BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J24 (930 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g00810.2 68417.m00112 60S acidic ribosomal protein P1 (RPP1B)... 48 9e-06 At4g00810.1 68417.m00111 60S acidic ribosomal protein P1 (RPP1B)... 48 9e-06 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 48 9e-06 At1g01100.2 68414.m00013 60S acidic ribosomal protein P1 (RPP1A)... 47 2e-05 At1g01100.1 68414.m00012 60S acidic ribosomal protein P1 (RPP1A)... 47 2e-05 At5g47700.1 68418.m05889 60S acidic ribosomal protein P1 (RPP1C) 47 2e-05 At5g24510.1 68418.m02889 60s acidic ribosomal protein P1, putative 46 4e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 46 5e-05 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 43 3e-04 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 8e-04 At3g50180.1 68416.m05486 hypothetical protein 42 8e-04 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 40 0.002 At1g61080.1 68414.m06877 proline-rich family protein 36 0.002 At4g01985.1 68417.m00265 expressed protein 40 0.003 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 40 0.003 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 39 0.004 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 39 0.004 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 39 0.005 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 38 0.007 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.007 At5g46730.1 68418.m05757 glycine-rich protein 38 0.009 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 38 0.009 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 38 0.013 At1g65440.1 68414.m07424 glycine-rich protein 38 0.013 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 37 0.017 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.017 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 37 0.017 At4g21720.1 68417.m03145 expressed protein 37 0.022 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 36 0.029 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 36 0.029 At2g30560.1 68415.m03722 glycine-rich protein 36 0.029 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 36 0.029 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.029 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 36 0.038 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 36 0.038 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.038 At5g61660.1 68418.m07736 glycine-rich protein 36 0.051 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 36 0.051 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 36 0.051 At4g30460.1 68417.m04325 glycine-rich protein 35 0.067 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 35 0.067 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.067 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 35 0.067 At1g27710.1 68414.m03387 glycine-rich protein 35 0.067 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 35 0.088 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 35 0.088 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.088 At1g75550.1 68414.m08780 glycine-rich protein 34 0.12 At1g70990.1 68414.m08190 proline-rich family protein 34 0.12 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 34 0.15 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 34 0.15 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 34 0.15 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 34 0.15 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 34 0.15 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 34 0.15 At1g26150.1 68414.m03192 protein kinase family protein similar t... 34 0.15 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 34 0.15 At3g51290.1 68416.m05614 proline-rich family protein 33 0.20 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.20 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 33 0.20 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 33 0.20 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.20 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 28 0.22 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.27 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.27 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 33 0.27 At4g16700.1 68417.m02523 phosphatidylserine decarboxylase simila... 33 0.27 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.27 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 33 0.27 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 33 0.27 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 33 0.27 At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putat... 33 0.36 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 33 0.36 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 33 0.36 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 33 0.36 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.36 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.36 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.36 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 33 0.36 At1g29380.1 68414.m03592 hypothetical protein 33 0.36 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 33 0.36 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 32 0.47 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 32 0.47 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.47 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.47 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 32 0.47 At4g08230.1 68417.m01358 glycine-rich protein 32 0.47 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 32 0.47 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 32 0.47 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 32 0.47 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 32 0.47 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 32 0.47 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.62 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 32 0.62 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 32 0.62 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 32 0.62 At4g18570.1 68417.m02749 proline-rich family protein common fami... 32 0.62 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 32 0.62 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 32 0.62 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 32 0.62 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.62 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 32 0.62 At2g05510.1 68415.m00583 glycine-rich protein 32 0.62 At1g04800.1 68414.m00476 glycine-rich protein 32 0.62 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 0.63 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 0.82 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 0.82 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.82 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 31 0.82 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 31 0.82 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 31 0.82 At1g62240.1 68414.m07021 expressed protein 31 0.82 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 31 0.82 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 31 1.1 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 1.1 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 1.1 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 31 1.1 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 31 1.1 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At4g33660.1 68417.m04781 expressed protein 31 1.1 At4g21620.1 68417.m03134 glycine-rich protein 31 1.1 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 31 1.1 At4g16240.1 68417.m02464 hypothetical protein 31 1.1 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 31 1.1 At3g44950.1 68416.m04843 glycine-rich protein 31 1.1 At2g30505.1 68415.m03716 Expressed protein 31 1.1 At1g53625.1 68414.m06096 expressed protein 31 1.1 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 31 1.1 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.1 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 31 1.4 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 31 1.4 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 31 1.4 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 31 1.4 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 31 1.4 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 31 1.4 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.4 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 31 1.4 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 1.4 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 31 1.4 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 31 1.4 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 31 1.4 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.4 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 31 1.4 At2g05440.2 68415.m00575 glycine-rich protein 31 1.4 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 31 1.4 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 31 1.4 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 31 1.4 At1g11850.2 68414.m01364 expressed protein 31 1.4 At1g11850.1 68414.m01363 expressed protein 31 1.4 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 31 1.4 At5g56140.1 68418.m07003 KH domain-containing protein 30 1.9 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 1.9 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 1.9 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 30 1.9 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 30 1.9 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 1.9 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 30 1.9 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 30 1.9 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 30 1.9 At2g05440.1 68415.m00574 glycine-rich protein 30 1.9 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 30 1.9 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 30 1.9 At1g02710.1 68414.m00222 glycine-rich protein 30 1.9 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 30 2.5 At5g55390.1 68418.m06901 hydroxyproline-rich glycoprotein family... 30 2.5 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 2.5 At5g11550.1 68418.m01347 expressed protein 30 2.5 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 30 2.5 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 30 2.5 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.5 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 30 2.5 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 30 2.5 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 30 2.5 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 30 2.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 30 2.5 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 30 2.5 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 30 2.5 At1g10620.1 68414.m01204 protein kinase family protein contains ... 30 2.5 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 3.3 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 29 3.3 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 29 3.3 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 29 3.3 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 29 3.3 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 3.3 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 3.3 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 3.3 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 29 3.3 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 29 3.3 At2g15780.1 68415.m01809 glycine-rich protein similar to Blue co... 29 3.3 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 3.3 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 29 3.3 At1g33250.1 68414.m04110 fringe-related protein + weak similarit... 29 3.3 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 29 3.3 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 29 4.4 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 29 4.4 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 4.4 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 4.4 At5g10060.1 68418.m01165 expressed protein 29 4.4 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 29 4.4 At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; gl... 29 4.4 At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus... 29 4.4 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 29 4.4 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 29 4.4 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 4.4 At4g10070.1 68417.m01647 KH domain-containing protein DNA-direct... 29 4.4 At3g62170.1 68416.m06985 pectinesterase family protein contains ... 29 4.4 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 4.4 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 4.4 At3g50870.1 68416.m05570 zinc finger (GATA type) family protein ... 29 4.4 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 29 4.4 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 4.4 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 4.4 At2g22800.1 68415.m02706 homeobox-leucine zipper protein 9 (HAT9... 29 4.4 At2g20550.1 68415.m02400 DNAJ chaperone C-terminal domain-contai... 29 4.4 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 29 4.4 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 4.4 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 29 4.4 At1g12380.1 68414.m01431 expressed protein 29 4.4 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 26 5.0 At5g62820.1 68418.m07885 integral membrane protein, putative MtN... 29 5.8 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 5.8 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 5.8 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 5.8 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 29 5.8 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 29 5.8 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 29 5.8 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 29 5.8 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 5.8 At4g14540.1 68417.m02240 CCAAT-box binding transcription factor ... 29 5.8 At3g43583.1 68416.m04636 hypothetical protein 29 5.8 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 29 5.8 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 5.8 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 29 5.8 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 29 5.8 At2g05530.1 68415.m00585 glycine-rich protein 29 5.8 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 5.8 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 29 5.8 At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK... 29 5.8 At1g15830.1 68414.m01900 expressed protein 29 5.8 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 23 7.0 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 7.7 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 7.7 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 28 7.7 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 7.7 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 28 7.7 At5g11930.1 68418.m01395 glutaredoxin family protein contains IN... 28 7.7 At5g03680.1 68418.m00327 trihelix DNA-binding protein, putative ... 28 7.7 At4g32340.1 68417.m04603 expressed protein 28 7.7 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 28 7.7 At3g51770.1 68416.m05677 tetratricopeptide repeat (TPR)-containi... 28 7.7 At3g42130.1 68416.m04326 glycine-rich protein 28 7.7 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 28 7.7 At3g02540.2 68416.m00243 ubiquitin family protein contains Pfam ... 28 7.7 At3g02540.1 68416.m00242 ubiquitin family protein contains Pfam ... 28 7.7 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 7.7 At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) 28 7.7 At2g37860.2 68415.m04648 expressed protein 28 7.7 At2g37860.1 68415.m04647 expressed protein 28 7.7 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 28 7.7 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 28 7.7 At1g55900.1 68414.m06411 NLI interacting factor (NIF) family pro... 28 7.7 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 28 7.7 At1g30780.1 68414.m03763 F-box family protein 28 7.7 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 28 7.7 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 28 7.7 At1g04660.1 68414.m00463 glycine-rich protein 28 7.7 At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containi... 28 7.7 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 25 7.9 >At4g00810.2 68417.m00112 60S acidic ribosomal protein P1 (RPP1B) similar to acidic ribosomal protein p1 Length = 113 Score = 48.0 bits (109), Expect = 9e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 KAA V++E YWP LFAK E NV DLI N+G+G Sbjct: 33 KAAGVEIESYWPMLFAKMAEKRNVTDLIMNVGAG 66 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 130 MVSKAELACVYSALILVDDDVAVTGEKISTIFQSGG 237 M + ELAC Y+ +IL D+ +A+T +KI+T+ ++ G Sbjct: 1 MSTVGELACSYAVMILEDEGIAITSDKIATLVKAAG 36 >At4g00810.1 68417.m00111 60S acidic ribosomal protein P1 (RPP1B) similar to acidic ribosomal protein p1 Length = 113 Score = 48.0 bits (109), Expect = 9e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 KAA V++E YWP LFAK E NV DLI N+G+G Sbjct: 33 KAAGVEIESYWPMLFAKMAEKRNVTDLIMNVGAG 66 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 130 MVSKAELACVYSALILVDDDVAVTGEKISTIFQSGG 237 M + ELAC Y+ +IL D+ +A+T +KI+T+ ++ G Sbjct: 1 MSTVGELACSYAVMILEDEGIAITSDKIATLVKAAG 36 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 48.0 bits (109), Expect = 9e-06 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPPPP PPP PPP P P P PQ P L + P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP---XGXPLXPXGLXPXPQXXPNXP 679 +P P PPP PPP PPP P P P PQ P P Sbjct: 75 SPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P PPP PPP P P P P P+ P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 37.1 bits (82), Expect = 0.017 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPPP PPP PPP P P P P P Sbjct: 62 PPPPP--PPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXP-TPPI*XLPPKXTPXXXPKFPPXAXLPF 782 PP P P P P PP LPP P P PP LPF Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPS-PPTPDLPF 119 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P P P P PP PP P P+ PP LP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPP---PQLPPPPQLP 101 Score = 28.3 bits (60), Expect = 7.7 Identities = 22/73 (30%), Positives = 23/73 (31%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFX 745 N PPP P P P P P P P P P P P P Q Sbjct: 42 NDNNPPPSPSPEPEPEPADCPPPP---PPPPCPPPPSPPPCPPPPSPPPSPPPPQLP--P 96 Query: 746 XAQIPPXGXPXLQ 784 Q+PP P Q Sbjct: 97 PPQLPPPAPPKPQ 109 >At1g01100.2 68414.m00013 60S acidic ribosomal protein P1 (RPP1A) similar to 60S ACIDIC RIBOSOMAL PROTEIN P1 GB:O23095 from [Arabidopsis thaliana] Length = 112 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 KAA V +E YWP LFAK E NV DLI N+G+G Sbjct: 33 KAAGVSIESYWPMLFAKMAEKRNVTDLIMNVGAG 66 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 130 MVSKAELACVYSALILVDDDVAVTGEKISTIFQSGG 237 M + ELAC Y+ +IL D+ +A+T +KI+T+ ++ G Sbjct: 1 MSTVGELACSYAVMILEDEGIAITADKIATLVKAAG 36 >At1g01100.1 68414.m00012 60S acidic ribosomal protein P1 (RPP1A) similar to 60S ACIDIC RIBOSOMAL PROTEIN P1 GB:O23095 from [Arabidopsis thaliana] Length = 112 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 KAA V +E YWP LFAK E NV DLI N+G+G Sbjct: 33 KAAGVSIESYWPMLFAKMAEKRNVTDLIMNVGAG 66 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 130 MVSKAELACVYSALILVDDDVAVTGEKISTIFQSGG 237 M + ELAC Y+ +IL D+ +A+T +KI+T+ ++ G Sbjct: 1 MSTVGELACSYAVMILEDEGIAITADKIATLVKAAG 36 >At5g47700.1 68418.m05889 60S acidic ribosomal protein P1 (RPP1C) Length = 113 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/34 (61%), Positives = 24/34 (70%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 KAA V +E YWP LFAK E NV DLI N+G+G Sbjct: 33 KAAGVTIESYWPMLFAKMAEKRNVTDLIMNVGAG 66 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/36 (41%), Positives = 26/36 (72%) Frame = +1 Query: 130 MVSKAELACVYSALILVDDDVAVTGEKISTIFQSGG 237 M + ELAC Y+ +IL D+ +A+T +KI+T+ ++ G Sbjct: 1 MSTVGELACSYAVMILEDEGIAITADKIATLVKAAG 36 >At5g24510.1 68418.m02889 60s acidic ribosomal protein P1, putative Length = 111 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/34 (58%), Positives = 24/34 (70%) Frame = +2 Query: 227 KAAAVDVEPYWPGLFAKALEGINVRDLITNIGSG 328 K A V+VE YWP LFAK E N+ DLI N+G+G Sbjct: 32 KTANVNVESYWPSLFAKLCEKKNIDDLIMNVGAG 65 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +1 Query: 133 VSKAELACVYSALILVDDDVAVTGEKISTIFQS 231 +S +ELAC Y+ALIL DD + +T E IS + ++ Sbjct: 1 MSTSELACTYAALILHDDGIEITAENISKLVKT 33 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP PPP PPP P P + P P P P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/71 (30%), Positives = 27/71 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXX 748 P PPPPP PPP PPP P P P P+ P P P + + + Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVY 444 Query: 749 AQIPPXGXPXL 781 PP P + Sbjct: 445 PPPPPSPQPYM 455 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPPP PPP PPP P P P P P+ P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PPP P P P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 +P PPPP PPP PPP P P P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PP PP PPP PPP P P P P P P S P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPP---PPPPPPPPPPPYVYPSPPPP 416 Score = 35.1 bits (77), Expect = 0.067 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP PPP PP P P P P P+ P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPS--PQPYMYPSPP 460 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +2 Query: 566 NPXPPPPPXXP---PPXPPPXGXPLXPXGLXPXPQXXPN 673 +P PPPP P PP PPP P P P P+ Sbjct: 412 SPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPS 450 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P P P P PP PP P P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLPFNFGNP 797 PP P P+ P P PP PP +P PP + P+ + +P Sbjct: 413 PPPPPPSPP-PYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 569 PXPPPPPXX---PPPXPPPXGXPLXPXGLXPXP 658 P PP PP PPP P P P P P P Sbjct: 435 PPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPPPP P P PPP P P P P+ PL GP P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLP-LPGPPP 206 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P P P P P PPP P P P P P+ PL GP P Sbjct: 237 SPTPGPDSPLPSPGPPPSPSP-TPGPDSPLPSPGPDSPLP-SPGPDP 281 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +2 Query: 566 NPXPPP-PPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPH 703 +P P P PP P P P P P P P P+ PL GPH Sbjct: 244 SPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP-SPGPH 289 Score = 31.5 bits (68), Expect = 0.82 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 566 NPXPPPPPXXPPPXP-PPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P P P P P P P PP P P P P+ PL GP P Sbjct: 188 SPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLP-LPGPPP 234 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.5 bits (93), Expect = 8e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP PP PPP P P P P P P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 566 NPXPPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PPPPP PP P PPP P P P P P P S P P Sbjct: 450 SPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 566 NPXPPPPPXXPPP----XPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PPPPP PPP PPP P P P P P P S P P Sbjct: 465 SPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/91 (28%), Positives = 28/91 (30%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQI 757 PPPP PPP PP P P P P P P S P P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPV-YSSPPPPPSPAPTPVYCTRPPPP 540 Query: 758 PPXGXPXLQFRXXXXXXXXXNPPFNXHPTSP 850 PP P QF + P H + P Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP 571 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/69 (28%), Positives = 23/69 (33%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXX 748 P PPPPP PP PP P P P P P P P + + Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYS 561 Query: 749 AQIPPXGXP 775 + PP P Sbjct: 562 SPPPPHSSP 570 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPPPP P PPP P P P P P P S P P Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLT 718 +P PPPPP PP PPP P P P P + P P P T Sbjct: 486 SPPPPPPPVYSPPPPPPPPPP-PPVYSPPPPPVYSSPPPPPSPAPTPVYCT 535 Score = 36.3 bits (80), Expect = 0.029 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PPP PPP P P P P Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 34.7 bits (76), Expect = 0.088 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PP PPP P+ P P P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP PP P P P P P P S P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PPP PPP P P P+ P P P P P P Sbjct: 511 SPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 31.9 bits (69), Expect = 0.62 Identities = 26/106 (24%), Positives = 35/106 (33%), Gaps = 8/106 (7%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP-------QXXPNXPLX*XSGPHPXXLTIA 724 +P PPP P PP P P P + P P P P+ S P P + + Sbjct: 590 SPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYS 649 Query: 725 AQTXXFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFN-XHPTSPXXP 859 + PP P +PP + H +SP P Sbjct: 650 SPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 31.5 bits (68), Expect = 0.82 Identities = 32/138 (23%), Positives = 44/138 (31%), Gaps = 8/138 (5%) Frame = +2 Query: 539 LYYNKXHXXNPXPPPPPXXPPPXPPP--XGXPLXPXGL----XPXPQXXPNXPLX*XSGP 700 +Y + P PPPP PP P P P P P P P P+ P Sbjct: 532 VYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSP 591 Query: 701 HPXXLTIAA--QTXXFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXX 874 P +++ T + PP P PP + + P P+++ Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPP-PPCIEYSPPPPPPVVHYSSPPPPPVYYSS 650 Query: 875 PRAQRXXAXVSSLPSXPP 928 P SS P PP Sbjct: 651 P--PPPPVYYSSPPPPPP 666 Score = 28.7 bits (61), Expect = 5.8 Identities = 28/118 (23%), Positives = 34/118 (28%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 P PPP P P PPP P L P P P+ P P + + Sbjct: 401 PLPPPSLPSP-PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSXPP 928 PP P +PP P P P++ P P PP Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPP-PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 41.5 bits (93), Expect = 8e-04 Identities = 18/42 (42%), Positives = 20/42 (47%) Frame = +2 Query: 536 RLYYNKXHXXNPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQ 661 RL + P PPPPP PPP PPP P L P P+ Sbjct: 16 RLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPPR 57 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 40.3 bits (90), Expect = 0.002 Identities = 34/124 (27%), Positives = 38/124 (30%), Gaps = 6/124 (4%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGP-HPXXLTIAAQTXXFXXA 751 PPPPP PP PPP P P P P P P+ P H + + Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 587 Query: 752 QIPPXGXPXLQFRXXXXXXXXXNPPFNXHPT-----SPXXPLFFXXPRAQRXXAXVSSLP 916 PP P PP P SP P+F P V S P Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Query: 917 SXPP 928 PP Sbjct: 648 --PP 649 Score = 36.3 bits (80), Expect = 0.029 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPPP PP PPP P P + P + P S P P Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP-NXP 679 PPPPP PP PP PL P + P P N P Sbjct: 653 PPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSP 688 Score = 35.1 bits (77), Expect = 0.067 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPPP PP PPP P P + P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 34.7 bits (76), Expect = 0.088 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 +P PPPP PPP PP P P P P Sbjct: 517 SPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PPP PP P P P P + P P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +2 Query: 566 NPXPPPPPXXPPP----XPPPXGXPLXPXGLXPXPQXXPNXP 679 +P PPPP PPP PPP P P P P P P Sbjct: 615 SPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP 656 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP PPP P PPP P P P P P P+ P P Sbjct: 572 SPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPPP PP P P P P P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPP 520 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPP P PP PP P P P P Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPP 529 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP PPP P P P P P + P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPP 528 Score = 29.1 bits (62), Expect = 4.4 Identities = 30/104 (28%), Positives = 32/104 (30%), Gaps = 7/104 (6%) Frame = +2 Query: 575 PPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGP--HPXXLTIAAQTX 736 PPPP PP PPP P P P P P S P P + QT Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQT- 683 Query: 737 XFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHP-TSPXXPLF 865 PP P PPF H SP P+F Sbjct: 684 ---PVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPPPPMF 724 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPP PPP P P P P P P+ Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPV 650 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPPPPPXXPPPXP---PPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP P PPP P PP P+ P P P P S P P Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPP-PPPPVYSPPPPPPVHSPPPP 548 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 569 PXPPPPPXX---PPPXPPPXGXPLXPXGLXPXP--QXXPNXP 679 P PPPPP PPP PPP G P P P Q P P Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +2 Query: 569 PXPPPPPXX---PPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PPP G P P P Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 33.5 bits (73), Expect(2) = 0.002 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN-XPLX*XSGPHP 706 PPPP PPP PPP PL P P P PL + P P Sbjct: 454 PPPP--PPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPP 495 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPPPP P P P+ G P P PL + P P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPP 607 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +2 Query: 569 PXPPPPP-----XXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PPP + P P P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN 673 P PPPPP PPP P+ P P N Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGN 584 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP-----PXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP PP P P P P + P P P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPP 495 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 4/34 (11%) Frame = +2 Query: 569 PXPPPPP----XXPPPXPPPXGXPLXPXGLXPXP 658 P PPP P PPP PPP G P P Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPP 625 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 7/37 (18%) Frame = +2 Query: 569 PXPPPPPXX-------PPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PP G G P P Sbjct: 605 PPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 Score = 25.8 bits (54), Expect(2) = 0.002 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 575 PPPPPXXPPP 604 PPPPP PPP Sbjct: 417 PPPPPPPPPP 426 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 39.5 bits (88), Expect = 0.003 Identities = 36/119 (30%), Positives = 39/119 (32%), Gaps = 1/119 (0%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLK-GGFXXXGXGGGXRN*RXGXPXGGIW 751 GG G A + G G G VG GG G GGG G G + Sbjct: 394 GGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVG 453 Query: 750 AXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 V G G G +G G G G G GGG GGG GG GG Sbjct: 454 GGGGGSVGGGGRGSGGAG--GGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 37.5 bits (83), Expect = 0.013 Identities = 34/125 (27%), Positives = 38/125 (30%), Gaps = 5/125 (4%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWA 748 GG G G G G +G GG G G G + G GG+ Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKG--GGGAGGGVGG 122 Query: 747 XXKXXVWAAXVKXXGWGPEXXQRGXLGXX-----WGXGFNPSGXRGXPXGGGXGGGXXGG 583 A G G G +G G G G G GGG GGG G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Query: 582 GGGXG 568 GG G Sbjct: 183 GGAGG 187 Score = 35.9 bits (79), Expect = 0.038 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -1 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 RG +G G G SG G GGG GGG GG GG G Sbjct: 44 RGSVGVGAGAGGGASGGIGVGGGGGGGGG-IGGSGGVG 80 Score = 35.1 bits (77), Expect = 0.067 Identities = 31/95 (32%), Positives = 32/95 (33%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G VG GG G GGG G GG+ V A G G R Sbjct: 473 GTGGSVGA---GGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGR 529 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G G GGG G G GG Sbjct: 530 GSGGASGGAG--AGGGAGGGVGGGANVGVGVGAGG 562 Score = 34.3 bits (75), Expect = 0.12 Identities = 34/119 (28%), Positives = 37/119 (31%) Frame = -1 Query: 924 GXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAX 745 G G R + G + G G VG GG G GGG G G + Sbjct: 241 GGSGGGSVGGGGRGSGGVGASGGAGGNVGA---GGGLGGGVGGGV----GGGVGGSVGGA 293 Query: 744 XKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 V A G RG G G SG G G G G G GGG G Sbjct: 294 VGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/97 (30%), Positives = 31/97 (31%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G VG GG G GGG G GG+ V A G R Sbjct: 331 GAGGSVGA---GGGVGGGVGGGV----GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGR 383 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G SG GG GG G GG G Sbjct: 384 GSGGASGGASGGASGGASGGASGGASGGVGGAGGAGG 420 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/97 (30%), Positives = 32/97 (32%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G VG G G GGG G GG+ V A G R Sbjct: 407 GASGGVG-GAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGR 465 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G + G GGG G G GGG G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGG 502 Score = 33.5 bits (73), Expect = 0.20 Identities = 32/99 (32%), Positives = 33/99 (33%), Gaps = 2/99 (2%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G VG GG G GG G GG V A G Sbjct: 373 GGGGSVG---GGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVG 429 Query: 678 GXLGXXWGXGFNPSGXRGXPXGG--GXGGGXXGGGGGXG 568 G +G G G G G GG G GGG GGGG G Sbjct: 430 GGVGGGVGGGVG--GAVGGAVGGAVGGGGGGSVGGGGRG 466 Score = 32.3 bits (70), Expect = 0.47 Identities = 30/102 (29%), Positives = 32/102 (31%), Gaps = 2/102 (1%) Frame = -1 Query: 876 GXWKNRGXX--GEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXG 703 G K RG G G + GG G GG G GG + G Sbjct: 158 GGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGG 217 Query: 702 WGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 RG G G G G G GG GGG G GG Sbjct: 218 GTVGAGGRGSGGASGGVGVG--GGAGGSGGGSVGGGGRGSGG 257 Score = 31.5 bits (68), Expect = 0.82 Identities = 35/124 (28%), Positives = 37/124 (29%), Gaps = 4/124 (3%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCX--LKGGFXXXGXGGGX--RN*RXGXPXG 760 GG G A G K RG G G + GG G GG G G Sbjct: 86 GGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Query: 759 GIWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGG 580 G K G G +G G G G G G G GGG G Sbjct: 146 GAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGA 205 Query: 579 GGXG 568 GG G Sbjct: 206 GGRG 209 Score = 31.5 bits (68), Expect = 0.82 Identities = 30/94 (31%), Positives = 34/94 (36%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G G + GG G GGG R G GG+ + A+ G Sbjct: 491 GIGGGAGGGVGGGVGG-GVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAG-------- 541 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G G G N G GG GGG GGGG Sbjct: 542 GGAGGGVGGGANVG--VGVGAGGSTGGGAAGGGG 573 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/94 (28%), Positives = 28/94 (29%) Frame = -1 Query: 849 GEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXL 670 G G G G GGG G GG+ V A G G G Sbjct: 323 GASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 382 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G SG GG GG GG GG G Sbjct: 383 RGSGGASGGASGGASGGASGGASGGASGGVGGAG 416 Score = 30.7 bits (66), Expect = 1.4 Identities = 33/104 (31%), Positives = 38/104 (36%), Gaps = 9/104 (8%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*--RXGXPXGGIWAXXKXX--VWAAXVKXXGWGPE 691 G G +G GG G G G ++ G GG+ A V A G G Sbjct: 143 GAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGT 202 Query: 690 XXQ--RGXLGXXWGXGFNPSGXRGX---PXGGGXGGGXXGGGGG 574 RG G G G +G RG G G GGG G GGG Sbjct: 203 VGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGG 246 Score = 30.7 bits (66), Expect = 1.4 Identities = 27/97 (27%), Positives = 30/97 (30%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G VG +G G GG G GG G G R Sbjct: 455 GGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG-GGGIGGGAGGGVGGGVGGGVGGGVR 513 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G +G G G +G GG G G GGG G Sbjct: 514 GAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGG 550 Score = 30.3 bits (65), Expect = 1.9 Identities = 29/98 (29%), Positives = 33/98 (33%) Frame = -1 Query: 861 RGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQ 682 +G G+ G GG GG G GGI + V A G G Sbjct: 161 KGRGGKSGGGAGGGVGGGVGAGGGAGGSVGA-GGGIGSGGGGTVGAGG---RGSGGASGG 216 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G +G SG G G G GG GGGG G Sbjct: 217 GGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRG 254 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -1 Query: 672 LGXXWGXGFNPSGXRGXPXGGGXGGGXXG--GGGGXG 568 +G G G G G GGG GGG G GGG G Sbjct: 63 VGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASG 99 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G G G GGG GG GG Sbjct: 60 GIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGG 91 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PPP G+ P P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXP 637 +P PPPPP PPP PPP P P Sbjct: 41 SPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P PPPP PPP PPP P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPP 61 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 10/44 (22%) Frame = +2 Query: 569 PXPPPPPXXP----------PPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPPP P PP PPP + P P PQ P Sbjct: 55 PPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLT 718 PP P PPP PPP P P P P N + P P +T Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVT 82 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPP PPP PP P P P P P Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRR----HPPPPRSPEKP 125 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PPP PPP P P P P+ P P P P Sbjct: 63 PPPPQTPPPPPPPQSLP--PPSPSPEPEHYPPPPYHHYITPSP 103 Score = 35.1 bits (77), Expect = 0.067 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPP 616 H P PPPP PPP PPP Sbjct: 97 HYITPSPPPPRPLPPPPPPP 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP--PXGXPLXPXGLXPXPQXXPNXPL 682 P PPPP PPP P P P P P P PL Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL 109 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXG-GGGGXGF 565 G GP RG G G GF P G P G G G G G G GG GF Sbjct: 7 GGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGF 54 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 705 GWGPEXXQRGXL-GXXWGXGFNP-SGXRGX-PXGGGXGGGXXGGGGGXG 568 G GP RG G G G P SG RG P GGG G G G G G Sbjct: 68 GPGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGG 116 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 645 NPSGXRGXPXGGGXGGGXXGGGGGXG 568 N G G P GG G G GGG G G Sbjct: 2 NRGGCGGGPGRGGRGFGGRGGGPGFG 27 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G GF P G P G G G G G GG Sbjct: 30 GPGFGPGGPGFGPGGPGFGPGGPGFGG 56 Score = 28.3 bits (60), Expect = 7.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGG-GXXGGGGG 574 G GP G G GF P G P G G GG G G G G Sbjct: 21 GGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFG 65 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 38.7 bits (86), Expect = 0.005 Identities = 31/104 (29%), Positives = 35/104 (33%), Gaps = 4/104 (3%) Frame = -1 Query: 867 KNRGXXGEVGCXLKG-GFXXX---GXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGW 700 KN G G G ++G G G GGG + G P GG Sbjct: 289 KNGGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKG 348 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G +G G G G GG GG GGGGG G Sbjct: 349 GGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGG 392 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G + +G GGG GGG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 35.9 bits (79), Expect = 0.038 Identities = 31/95 (32%), Positives = 37/95 (38%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G +G +GG G GG + G GG V+ G GP ++ Sbjct: 328 GGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGG-GGGPNGNKGGGGVQMNG-GPNGGKK 385 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G SG G P G GG GGGGG Sbjct: 386 GGGGGGGGGGGPMSG--GLPPGFRPMGGGGGGGGG 418 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 +G G G N G + GGG GGG GGGGG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 31.9 bits (69), Expect = 0.62 Identities = 28/88 (31%), Positives = 32/88 (36%) Frame = -1 Query: 828 KGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXG 649 KGG G G +N G GG + G GP + G G G Sbjct: 323 KGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPL--DGKMGGGGGGPNGNKGGG-GVQMNGG 379 Query: 648 FNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 N G +G GGG GGG GG GF Sbjct: 380 PN-GGKKGGGGGGGGGGGPMSGGLPPGF 406 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPP PPP PPP P P P P P P+ Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPV 586 Score = 37.5 bits (83), Expect = 0.013 Identities = 27/102 (26%), Positives = 32/102 (31%), Gaps = 1/102 (0%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXP-XGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXA 751 PPPP PPP PPP P P P P P P P P + + Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPV----YS 581 Query: 752 QIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXP 877 PP P +PP H P P++ P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 34.3 bits (75), Expect = 0.12 Identities = 32/121 (26%), Positives = 39/121 (32%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFX 745 +P PPPPP PP PP P P P P + P P P + Sbjct: 532 SPPPPPPPVHSPP-PPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPV---- 586 Query: 746 XAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSXP 925 + PP P +PP SP P+F P + V S P P Sbjct: 587 HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVF--SPPPSQSPPVVYSPPPRP 644 Query: 926 P 928 P Sbjct: 645 P 645 Score = 30.3 bits (65), Expect = 1.9 Identities = 25/96 (26%), Positives = 32/96 (33%), Gaps = 4/96 (4%) Frame = +2 Query: 575 PPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXF 742 PPPP PP PPP P P P P + P S P P + + F Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPV-YSPPPPVF 626 Query: 743 XXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSP 850 PP P + + +PP P +P Sbjct: 627 SP---PPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP PPP P G P P P P P P Sbjct: 138 PAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAP 174 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPPP P PPP P P P P P P+ Sbjct: 68 PPPPPLDSSPPPPPDLTP--PPSSPPPPDAPPPIPI 101 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPP PP PP P P L P P P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPP 91 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 566 NPXPPPPPXXPPPXP---PPXGXPLXPXGLXPXPQXXP 670 +P PPP PPP P PP P P P P P Sbjct: 67 SPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFP 104 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 575 PPPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXP 670 PPPP PPP PPP P P + P P P Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPI-VFPPPIDSP 110 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPP PPP PP P P L P + P S P P Sbjct: 30 PPPTDSAPPPSPPADSSP--PPALPSLPPAVFSPPPTVSSPPPP 71 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPP PPP PP + P + P N P Sbjct: 85 PPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSP 118 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 4/34 (11%) Frame = +2 Query: 569 PXPPPPPXXPPP----XPPPXGXPLXPXGLXPXP 658 P PPPP PPP PPP P P P Sbjct: 87 PSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP 120 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 37.9 bits (84), Expect = 0.009 Identities = 30/94 (31%), Positives = 34/94 (36%) Frame = -1 Query: 849 GEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXL 670 G G GG G GGG + G GG + + G+G G Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG--GAHGGGYGSGGGEGGGYG--GGAAGGY 251 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GGG GGG GGGG G Sbjct: 252 GGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285 Score = 35.9 bits (79), Expect = 0.038 Identities = 34/123 (27%), Positives = 38/123 (30%), Gaps = 3/123 (2%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIW- 751 GG G + G G G G GG G GGG G G Sbjct: 88 GGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGN 147 Query: 750 -AXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNP-SGXRGXPXGGGXGGGXXGGGG 577 A A+ +G G G G + SG G GG GGG GG G Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAG 207 Query: 576 GXG 568 G G Sbjct: 208 GYG 210 Score = 35.5 bits (78), Expect = 0.051 Identities = 33/106 (31%), Positives = 34/106 (32%), Gaps = 1/106 (0%) Frame = -1 Query: 882 ARGXWKNRGXXGEVGCXLKGGFXXX-GXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXX 706 A G G G G GG+ G GGG G GG Sbjct: 80 ASGGGSGHGGGGG-GAASSGGYASGAGEGGGGG---YGGAAGGHAGGGGGGSGGGGGSAY 135 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G E G G G SG G GGG G G GGGG G Sbjct: 136 GAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAG 181 Score = 33.9 bits (74), Expect = 0.15 Identities = 33/122 (27%), Positives = 37/122 (30%), Gaps = 1/122 (0%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXG-GGXRN*RXGXPXGGIW 751 GG G E + G G G G G G GG G GG Sbjct: 71 GGYGGAEGYASGGGSGHGG--GGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSG 128 Query: 750 AXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGX 571 A G+G + G G G G G G GGG GG G GG Sbjct: 129 GGGGSAYGAGGEHASGYGNGAGEGGGAGAS-GYGGGAYGGGGGHGGGGGGGSAGGAHGGS 187 Query: 570 GF 565 G+ Sbjct: 188 GY 189 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G G G GG GGG GG GG G Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Score = 31.9 bits (69), Expect = 0.62 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGG-XXGGGGGXG 568 G G G G SG G GGG GGG G GGG G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYG 74 Score = 31.1 bits (67), Expect = 1.1 Identities = 36/119 (30%), Positives = 36/119 (30%) Frame = -1 Query: 924 GXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAX 745 G G A A G G G G GG G GGG G GG Sbjct: 128 GGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGG-GAYGGGGGHGGGGGGGSAGG---- 182 Query: 744 XKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 A G G E G G G G G G GGG GG GGG G Sbjct: 183 ------AHGGSGYGGG-EGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYG 234 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = -1 Query: 717 VKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 V G+G E G G G G G GGG G G GGGGG Sbjct: 48 VSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHG--GGGGG 93 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXX-GGGGGXGF 565 G G G G +G G G G GG GGG G GGG + Sbjct: 218 GGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSY 265 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G G GGG GGGG G Sbjct: 60 GYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 569 PXPPPPPXXP-PPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPP P PP PPP PL P L P P PL Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPL 1103 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP PP P PPP L P L P P P PL P P Sbjct: 1078 SPPPPSPPLPPSSLPPPPPAALFPP-LPPPPSQPPPPPLSPPPSPPP 1123 Score = 35.1 bits (77), Expect = 0.067 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PP PP PP PP P P L P P+ P P P Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPP 1119 Score = 35.1 bits (77), Expect = 0.067 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXP 628 PPPPP PPP PPP P Sbjct: 1110 PPPPPLSPPPSPPPPPPP 1127 Score = 34.7 bits (76), Expect = 0.088 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPP PP PPP P P P P P P Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 31.5 bits (68), Expect = 0.82 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P P P L P PP PP P P PP + P Sbjct: 1079 PPPPSPPLP-PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPP 1119 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 569 PXPPP--PPXXPPPXPPPXGXPL 631 P PPP PP PPP PPP L Sbjct: 1110 PPPPPLSPPPSPPPPPPPPSQSL 1132 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 569 PXPP---PPPXXP---PPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PPP PP PPP P P L P P P P Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQP-PPPPLSPPPSPPPPPP 1126 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN 673 NP P P P PPP PL P P P P+ Sbjct: 1055 NPLPEDSPPLPQESPPPL-PPLPPSPPPPSPPLPPS 1089 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 37.5 bits (83), Expect = 0.013 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G + +G GGG GGG GGGGG G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 +G G G N G + GGG GGG GGGGG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 37.5 bits (83), Expect = 0.013 Identities = 34/131 (25%), Positives = 40/131 (30%), Gaps = 11/131 (8%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGG-GXRN*RXGXPXGGIW 751 GG DG RG + RG ++ + G G G + G GG W Sbjct: 1472 GGRDGHPSGAPRPYGGRGRGRGRGRRDDMNSDRQDGNGDWGNNDTGTADGGWGNSGGGGW 1531 Query: 750 AXXKXXVWAAXVKXXGWGPEXXQRGXLGXX-WGXGF---------NPSGXRGXPXGGGXG 601 GWG E G WG G N SG + GG G Sbjct: 1532 GSESAGKKTGGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGGFG 1591 Query: 600 GGXXGGGGGXG 568 G GGG G Sbjct: 1592 SGSGGGGSDWG 1602 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 37.1 bits (82), Expect = 0.017 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXP-XGLXPXPQXXPNXPLX*XSGPHP 706 H +P PPPPP PP P P + P P P P S P P Sbjct: 723 HTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPP 773 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = +2 Query: 575 PPPP------PXXPPPXPPPXGXPLXPXG-LXPXPQXXPNXPL 682 PPPP P PPP PP G L P G P P PL Sbjct: 777 PPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALPTGPL 819 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 9/46 (19%) Frame = +2 Query: 569 PXPPPPPXXPP---------PXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP PP P PPP P P + P P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 9/46 (19%) Frame = +2 Query: 569 PXPPPP---------PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP P PPP PP P+ P P P P Sbjct: 692 PPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 569 PXPPPPPXXPP---PXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PP P PPP P P G P P P Sbjct: 755 PAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +2 Query: 569 PXPPPPPXXPPPXP------PPXGXPLXPXGLXPXPQ 661 P PPPP PP P PP P P P PQ Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQ 743 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.1 bits (82), Expect = 0.017 Identities = 30/89 (33%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = -1 Query: 825 GGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGF 646 GG G GGG R+ G GG G G + G G G G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGG---------GGGGYSGGGGGGYERRSGGYGSGGGGGG 140 Query: 645 NPSGXRGXPXGGGXGGGXXG--GGGGXGF 565 G G GGG GGG G GGGG G+ Sbjct: 141 RGYGGGGRREGGGYGGGDGGSYGGGGGGW 169 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -1 Query: 693 EXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXG--GGGGXGF 565 E RG G G G + G R GG GGG G GGGG G+ Sbjct: 81 EAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGY 125 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPP PPP PPP P P L P P Sbjct: 59 PPPPSPPPPSPPPPACP-PPPALPPPP 84 Score = 33.1 bits (72), Expect = 0.27 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P PPPP PP PPP P P Sbjct: 62 PSPPPPSPPPPACPPPPALPPPP 84 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PPPP PPP P P P P Sbjct: 66 PPSPPPPACPPPPALPPPPPKKVSSYCPPP 95 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 36.7 bits (81), Expect = 0.022 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXPPPXPPPXGXPLXP 637 NK P PPPP PPP PP P+ P Sbjct: 100 NKVKPKRPPPPPPKPQPPPPPPRSQKPMQP 129 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 36.3 bits (80), Expect = 0.029 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPL--XPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXX 748 PPPPP PP PP PL P + P P P P P L+ T Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPAL-PPKPLPPPLSPPQTTPPPPP 162 Query: 749 AQIPPXGXP 775 A PP P Sbjct: 163 AITPPLSPP 171 Score = 35.5 bits (78), Expect = 0.051 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 NP PPPP P P PP P P P P P Sbjct: 41 NPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSP 78 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PP PPP PP P P + P P PL Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPL 122 Score = 29.9 bits (64), Expect = 2.5 Identities = 31/125 (24%), Positives = 34/125 (27%), Gaps = 5/125 (4%) Frame = +2 Query: 569 PXPPPP-----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQT 733 P PPP P PPP P P P P P P P S P +A Sbjct: 31 PPPPPCICICNPGPPPPQPDP--QPPTPPTFQPAPPANDQPPPPPQSTSPP---PVATTP 85 Query: 734 XXFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSL 913 +PP P PP P SP P P + Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 914 PSXPP 928 P PP Sbjct: 146 PLPPP 150 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 569 PXPPP--PPXXPPPXPPPXGXPLXP 637 P PPP PP PP PP PL P Sbjct: 146 PLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXP 637 PPPP PP PP PL P Sbjct: 272 PPPPQTTPPPPPAITPPLSP 291 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PP P P P P P P Sbjct: 121 PLSPPPPAITPPPPLATTPPALPPKPLPPPLSPP 154 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 N PPPPP P P P P P P P Sbjct: 66 NDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPP 100 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P P P P PP PP P PP A P Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSP--PPVATTP 85 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 36.3 bits (80), Expect = 0.029 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PPP PPP P P P P P Sbjct: 64 PPPPPPTSPPPPSPPP---PSPPPPSPPPPSPPP 94 Score = 35.5 bits (78), Expect = 0.051 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQ 661 P PPPP PPP PPP P + P+ Sbjct: 74 PPSPPPPSPPPPSPPPPSPPPPAFAVGKTPE 104 Score = 32.3 bits (70), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P P PPP PPP PP P P Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP PP PPP P P P P P P Sbjct: 64 PPPP--PPTSPPP---PSPPPPSPPPPSPPPPSP 92 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 36.3 bits (80), Expect = 0.029 Identities = 33/121 (27%), Positives = 38/121 (31%), Gaps = 2/121 (1%) Frame = -1 Query: 924 GXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGX--GGGXRN*RXGXPXGGIW 751 G G + + G G G G KGG G GGG P Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRS 61 Query: 750 AXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGX 571 + + + K G G G G SG G GGG GGG GGG G Sbjct: 62 SYISRDNFESDPKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Query: 570 G 568 G Sbjct: 122 G 122 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -1 Query: 768 PXGGIWAXXKXXVWAAXVKXXG-WGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGX 592 P GG K + G G G G G G N G G GGG GG Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGG--GGGKGGKS 130 Query: 591 XGGGGGXGF 565 GG GG G+ Sbjct: 131 GGGSGGGGY 139 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 672 LGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 +G G G G G G G G G GGGG G Sbjct: 1 MGGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKG 35 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 36.3 bits (80), Expect = 0.029 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPH 703 PPPPP PPP PPP P P P P+ GPH Sbjct: 23 PPPPPSLPPPVPPPP-PSHQPYSYPPPPPPPPHAYY--QQGPH 62 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 651 RPPXPX-PTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLPFNFGNP 797 RPP P P P + L P PP LPP P PP + P+++ P Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPP------PPPSHQPYSYPPP 48 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP 613 P PPPPP PPP P Sbjct: 72 PPPPPPPSAPPPLVP 86 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 36.3 bits (80), Expect = 0.029 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +2 Query: 566 NPXPPPPPXXPPP-----XPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 N PPPPP PPP PPP P P P P + + S P P Sbjct: 569 NKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPP 620 Score = 35.5 bits (78), Expect = 0.051 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPP PPP PPP P P P P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 34.7 bits (76), Expect = 0.088 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPP PPP PPP + P P P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPPPP P PPP P P P P SGP P Sbjct: 715 PPPPPPPLSKTPAPPP-----PPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPP PPP PPP P P P P P Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 29.9 bits (64), Expect = 2.5 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 1/94 (1%) Frame = +2 Query: 548 NKXHXXNPXPPPP-PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIA 724 NK P PPPP P P P P P P P + P P P Sbjct: 569 NKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSF 628 Query: 725 AQTXXFXXAQIPPXGXPXLQFRXXXXXXXXXNPP 826 T AQ PP P R PP Sbjct: 629 GSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPP 662 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +2 Query: 569 PXPPPPPXXPPP-------XPPPXGXPLXPXGL-XPXPQXXPNXPLX*XSGPHPXXLT 718 P PPPP PPP PP PL P P P PL P P L+ Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLS 734 Score = 29.1 bits (62), Expect = 4.4 Identities = 27/99 (27%), Positives = 31/99 (31%), Gaps = 4/99 (4%) Frame = +2 Query: 575 PPPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXPNXPLX*XS--GPHPXXLTIAAQTXXF 742 PPPPP PPP P P P P + S P P + T F Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSF 541 Query: 743 XXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXP 859 +Q PP P L + P N P P P Sbjct: 542 SPSQPPP--PPPLPSFSNRDPLTTLHQPINKTPPPPPPP 578 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXL--TIAAQTXXFXX 748 PP P PPP PP P P P + L P P L T A Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSK 735 Query: 749 AQIPP 763 +PP Sbjct: 736 TPVPP 740 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 35.9 bits (79), Expect = 0.038 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPPP PP PPP P P + P P P P Sbjct: 97 PPPPPTVKPP-PPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 35.5 bits (78), Expect = 0.051 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PPPPP PP PP P P P P P P P +T T Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPC 164 Query: 755 IPPXGXP 775 PP P Sbjct: 165 PPPPPTP 171 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPPP PP PPP P P + P P P Sbjct: 89 PPPPPYVKPP-PPPTVKPPPPPYVKPPPPPTVKPP 122 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLPF 782 PP P P P + P PP PP TP PP P+ Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP P PP P P P P P P Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPL 631 P PPPPP PP P P P+ Sbjct: 163 PCPPPPPTPYPPPPKPETCPI 183 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPP PPP P P P P P Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPPTPYP 173 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 569 PXPPPP----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP P P PPP P P + P P P Sbjct: 74 PCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPP 114 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPP PPP P P P P P P+ P P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P P P P P P PPP P P Sbjct: 154 PPPTPTPEAPCPPPPPTPYPPPP 176 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.9 bits (79), Expect = 0.038 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 569 PXPPPPPXX--PPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PP PPP PP P P L P P+ P P Sbjct: 65 PEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREP 103 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 575 PPPPPXXPPP-XPPPXGXPLXPXGLXPXPQXXP 670 PPP P PPP PPP P P P P+ P Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 32.3 bits (70), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P P PP PPP PPP P P Sbjct: 94 PPPEEPPREPPPPPPPPEEPPPP 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PPP P P PP P P P P P L P P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPP 83 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +2 Query: 569 PXPP----PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PPP PPP P PL P P + P P Sbjct: 68 PLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLPFNFGNP 797 PP P P P PP PP+ P FPP LP F P Sbjct: 30 PPLVFPLLPLSPPPSP-PPSPSSPPRLPPPFPALFPPEPPLPPRFELP 76 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 35.9 bits (79), Expect = 0.038 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P P PPP PP P P P P P P P P+ S P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPK-PVPCPSPPKP 104 Score = 35.5 bits (78), Expect = 0.051 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP-PXGXPLXPXGLXPXPQXXPN---XPLX*XSGPHPXXLTIAA 727 P P P P PP PP P P+ P G P P P P S P P TI A Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIPA 147 Score = 35.1 bits (77), Expect = 0.067 Identities = 19/70 (27%), Positives = 22/70 (31%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFX 745 +P P PPP P PP P P P P P P P + Sbjct: 49 SPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPT 108 Query: 746 XAQIPPXGXP 775 +PP G P Sbjct: 109 PKPVPPHGPP 118 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 569 PXPPPPPX-XPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPP P PPP P P P P P P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACP 69 Score = 31.5 bits (68), Expect = 0.82 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 NP P P P P P P+ P G P P P P P Sbjct: 2 NPPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP P P P PPP P P P P P+ P Sbjct: 22 PVAPPGPS-PCPSPPPKPQPKPPPA--PSPSPCPSPP 55 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 35.5 bits (78), Expect = 0.051 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G +G G G RG G G G G GGGGG G Sbjct: 84 GTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGG 117 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGG-----XXGGGGGXGF 565 GWG G G G+ G GGG G G GGGGG GF Sbjct: 68 GWGRGSGYGYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGF 119 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+G G G G G G G G GG GGGG G Sbjct: 76 GYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 35.5 bits (78), Expect = 0.051 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 693 EXXQRGXLGXXWGXGFNPSGXRGXPXGG---GXGGGXXGGGGGXGF 565 E RG G G G + G R GG G GGG GGGGG G+ Sbjct: 81 EAQSRGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGGW 126 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.5 bits (78), Expect = 0.051 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSG 697 P P PPP PPP G P P G P P P L +G Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAG 713 Score = 34.7 bits (76), Expect = 0.088 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P PPPPP P PPP G P P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPP 701 Score = 34.7 bits (76), Expect = 0.088 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P PPPPP PP PP G P P Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPP 702 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P P PPP PP G P P G P P P Sbjct: 673 PLPGGGPPPPPP-PPGGGPPPPPGGGPPPPPPPP 705 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 35.1 bits (77), Expect = 0.067 Identities = 27/93 (29%), Positives = 33/93 (35%), Gaps = 1/93 (1%) Frame = -1 Query: 843 VGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXL-G 667 +G + GG G G G G GG + ++ G G + G G Sbjct: 46 IGIGIGGGGSGSGAGAGS-----GSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAG 100 Query: 666 XXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GGG GGGGG G Sbjct: 101 SHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGG 133 Score = 35.1 bits (77), Expect = 0.067 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 SG G GGG GGG GGGGG G Sbjct: 119 SGGGGGHGGGGGGGGGRGGGGGSG 142 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXG-GGXXGGGGGXG 568 G G RG GGG G GG GGGGG G Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRG 136 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGG-GGGXGF 565 G G G G G G GGG G G GG G G G+ Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGY 147 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.1 bits (77), Expect = 0.067 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 569 PXPPP---PPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPP PP PPP PPP P P + P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXG--XPLXPXGLXPXPQ 661 P PPPPP PP PP P P G P Q Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQ 309 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PPP PPP P P P P P G P Sbjct: 266 PPPPAAAPPPQPPP---PPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 35.1 bits (77), Expect = 0.067 Identities = 29/89 (32%), Positives = 33/89 (37%), Gaps = 2/89 (2%) Frame = -1 Query: 825 GGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGF 646 GG G GGG R+ G GG + + G G G G G Sbjct: 92 GGGHRGGGGGGYRSGGGGGYSGGGGSYGG----GGGRREGGGGYSGGGGGYSSRGGGGGS 147 Query: 645 NPSGXR--GXPXGGGXGGGXXGGGGGXGF 565 G R G GGG GGG G GGG G+ Sbjct: 148 YGGGRREGGGGYGGGEGGGYGGSGGGGGW 176 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGG 574 SG G GGG GG GGGGG Sbjct: 89 SGGGGGHRGGGGGGYRSGGGGG 110 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 693 EXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 E RG G G G R GG GGG GGGG Sbjct: 83 EAQSRGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGG 122 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.1 bits (77), Expect = 0.067 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 566 NPXPPPPPXX--PPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 +P PPPPP PPP PPP P P P + P Sbjct: 383 SPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 569 PXPPPP----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGP 700 P PPPP P PPP PPP P P + P P GP Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 35.1 bits (77), Expect = 0.067 Identities = 31/98 (31%), Positives = 35/98 (35%) Frame = -1 Query: 861 RGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQ 682 R G G GG+ G G G G GG+ A G G + Sbjct: 93 RHVTGFKGELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGN 152 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G+ SG G GGG GGG GGGG G Sbjct: 153 GGG-----GPGYG-SGGGGIGGGGGIGGGVIIGGGGGG 184 Score = 33.9 bits (74), Expect = 0.15 Identities = 31/97 (31%), Positives = 32/97 (32%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQR 679 G G G GG G GGG G G + W G GP Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGG--NGGGGPGYGSG 162 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GGG GG GGGGG G Sbjct: 163 G--GGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGG 197 Score = 30.3 bits (65), Expect = 1.9 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G+GP G G G GF G G GGG G GGGG G+ Sbjct: 118 GYGPGG---GGGGVVIGGGFG--GGAGYGSGGGLGWDGGNGGGGPGY 159 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 34.7 bits (76), Expect = 0.088 Identities = 19/65 (29%), Positives = 22/65 (33%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTX 736 H P PPP P P PPP P P P P P G H + + + Sbjct: 48 HFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTPAPGHHVIIVVVISLGS 107 Query: 737 XFXXA 751 F A Sbjct: 108 LFFLA 112 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPPP PP PPP P P P P+ P PHP Sbjct: 33 PPPPPFSPPHHPPPPHFS-PPHQPPPSPYPHPHPPPP-SPYPHP 74 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP PP PP P P P P+ P Sbjct: 41 PHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 31.9 bits (69), Expect = 0.62 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PPPP PP PPP P P P P P PHP Sbjct: 22 SPVPPPPSHISPP-PPPFSPPHHP----PPPHFSPPHQPPPSPYPHP 63 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/44 (34%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPPXP-PPXGXPLXPXGLXPXPQXXP 670 +++ H P P P P PPP P P P P + P P P Sbjct: 48 HFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 566 NPXPP--PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 +P PP PP PPP P P P P P P P P Sbjct: 43 HPPPPHFSPPHQPPPSPYPHPHP-PPPSPYPHPHQPPPPP 81 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 34.7 bits (76), Expect = 0.088 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G+ G G GGG GGG GGGGG G Sbjct: 155 GGGYGGGGGYGG-GGGGYGGGGRGGGGGGG 183 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -1 Query: 723 AXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 A V+ G RG G G G G G GGG G G GGGG G Sbjct: 80 APVQGNSGGGSSGGRGGFGGGRGGGRGSGGGYG---GGGGGYGGRGGGGRGG 128 Score = 30.7 bits (66), Expect = 1.4 Identities = 28/86 (32%), Positives = 32/86 (37%), Gaps = 2/86 (2%) Frame = -1 Query: 828 KGGFXXXGXGGGXRN*RXGXPXGG--IWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWG 655 +G G GGG R G GG + + A G G G G +G Sbjct: 105 RGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGG-----YGGGGGGYG 159 Query: 654 XGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G G GGG GGG GGGG Sbjct: 160 GGGGYGGGGGGYGGGGRGGG--GGGG 183 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXG-GGGGXG 568 G G G G GGG GGG G GGGG G Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRG 177 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 SG G P G GGG GG GG G Sbjct: 75 SGPDGAPVQGNSGGGSSGGRGGFG 98 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G G G G GGG G G GGGG G+ Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGY 118 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXGF 565 GGG GGG G GGG G+ Sbjct: 148 GGGYGGGGGGYGGGGGY 164 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXGF 565 GGG GGG GGGG G+ Sbjct: 155 GGGYGGGGGYGGGGGGY 171 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 34.7 bits (76), Expect = 0.088 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +2 Query: 569 PXPPPP---PXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP P PPP PPP P P P P Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP P PPP P P P P P Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P PPP P PPP P P P P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPP 87 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G R G G G G G GGG G G GGGGG G+ Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGW 104 Score = 31.9 bits (69), Expect = 0.62 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 GWG G G G G G G GGG GG G GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = -1 Query: 702 WGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGG----XXGGGGGXG 568 WG G G G G G G GGG GGG GGGG G Sbjct: 67 WGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKG 115 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPP PPP PPP P L P P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 569 PXPPPPPXXPPP---XPPPXGXPLXP 637 P PPPP PPP PPP P P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPP 118 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 33.9 bits (74), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXP 628 P PPPP PPP PPP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTP 282 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXP 628 PPPP PPP PPP P Sbjct: 266 PPPPSSPPPPPPPPPTPP 283 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP 613 P PPPP PPP PP Sbjct: 269 PSSPPPPPPPPPTPP 283 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP 616 N PPP PPP PPP Sbjct: 264 NRPPPPSSPPPPPPPPP 280 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 26/67 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PPPPP PPP P P+ P + P P P P P A + + + Sbjct: 75 PPPPPIYPPPIYSPPPPPIYPPPIY-SPPPTPISPPPKVHHPAPQ----AQKAFYYRQSP 129 Query: 755 IPPXGXP 775 PP G P Sbjct: 130 PPPSGQP 136 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXP-LXPXGLXPXPQXXPNXP 679 PPPPP P P PP G P + P L P P P Sbjct: 351 PPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIP 386 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 654 PPXPX-PTXPFXDX--LXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P PT P L PTPP LPP T P PP LP Sbjct: 299 PPIPLIPTPPTLPTIPLLPTPPTPTLPPIPT---IPTLPPLPVLP 340 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 33.9 bits (74), Expect = 0.15 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPPPP PPP PPP Sbjct: 427 PPPPPPPPPPPPPP 440 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +2 Query: 566 NPXPPPPPXXPPP----XPPPXGXPLXPXGLXPXPQXXPNXP 679 +P PPPP PPP PPP P P P P P P Sbjct: 646 SPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP 687 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPPP PP P P P P P P P S P P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PP PP PPP P P P P P P+ Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPV 674 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 +P PP PPP P PPP P P P P P P+ Sbjct: 669 SPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV 710 Score = 31.9 bits (69), Expect = 0.62 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +2 Query: 569 PXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PP PPP P PPP P P P P P P+ Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPV 792 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +2 Query: 575 PPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP PPP P P P P P P S P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 30.3 bits (65), Expect = 1.9 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP PPP PPP P P P P P P+ P P Sbjct: 758 SPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPP P PP PP P P P P P+ Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPV 778 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPP P PP P P P P P P+ Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPV 785 Score = 29.5 bits (63), Expect = 3.3 Identities = 30/122 (24%), Positives = 35/122 (28%), Gaps = 4/122 (3%) Frame = +2 Query: 575 PPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXF 742 PPPP PP PPP P P P P P P+ S P P + + Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV--QSPPPPPVFSPPPPAPIY 749 Query: 743 XXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSX 922 P P PP + SP P+ P V S P Sbjct: 750 SPPPPPVHSPPPPVHSPPPPPVHSPPPPVH----SPPPPVHSPPPPVHSPPPPVHSPPPP 805 Query: 923 PP 928 P Sbjct: 806 SP 807 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 +P PP PPP P PP P P P P P P+ Sbjct: 662 SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPV 703 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPP----PXPPPXGXPLXPXGLXPXPQXXPNXPL 682 Y+ + PPPP PP PPP P P P P P P+ Sbjct: 675 YSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 724 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP PPP P PPP P P + P + P P P Sbjct: 719 SPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP 768 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPP PPP P P P P P P+ Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPV 681 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPP---PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP PPP P PP P P P P P S P P Sbjct: 705 SPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP PP P P P P P P P Sbjct: 795 PPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 33.9 bits (74), Expect = 0.15 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPPPP PPP PPP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 33.9 bits (74), Expect = 0.15 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPPPP PPP PPP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 33.5 bits (73), Expect = 0.20 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP 613 P PPPPP PPP PP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 NP PPP PP PPP P P P P P Sbjct: 113 NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 32.7 bits (71), Expect = 0.36 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPP PPP PP P P P P P S P P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAP 160 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPPP P P P P P P+ P+ P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 566 NPXPPP--PPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 NP PPP PP P P PP PL P L P P Sbjct: 146 NPPPPPESPPSLPAPDPP--SNPLPPPKLVPPSHSPP 180 Score = 32.3 bits (70), Expect = 0.47 Identities = 31/117 (26%), Positives = 35/117 (29%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PPP P PPP P P P P P+ P P + P + + T Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVS-SPPPESSPPPPPPTEAPPTTPITSPSPPT----NPP 148 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSXP 925 PP P L PP P S P P A LPS P Sbjct: 149 PPPESPPSL---PAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPP 202 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPP PP P G P + P P+ P PL Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPL 104 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 +P PP P PP PP P P P P+ P Sbjct: 140 SPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPP P PPP P P P P P P S P P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P PP P PPP P P P P P P + P P Sbjct: 99 SPPPPLPTEAPPPANPVSSPP--PESSPPPPPPTEAPPTTPITSPSP 143 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 33.9 bits (74), Expect = 0.15 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P P PP PPP PPP P+ P Sbjct: 34 PPPSQPPPAPPPLPPPTYRPIAP 56 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXP 637 NP P PP PPP PPP PL P Sbjct: 67 NPPSPSPPPPPPPRPPP--PPLSP 88 Score = 31.9 bits (69), Expect = 0.62 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPPP PPP PP + P P Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 539 LYYNKXHXXNPXPPPPPXXPPPXPP 613 L++N P PPPP PPP P Sbjct: 64 LHHNPPSPSPPPPPPPRPPPPPLSP 88 Score = 28.7 bits (61), Expect = 5.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXG 622 PPPPP PPP P G Sbjct: 74 PPPPPPRPPPPPLSPG 89 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G G RG G +G G G GGG GGG G GGG G+ Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGG---YGGGEGGGYGGSGGGGGW 159 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 645 NPSGXRGXPXGGG-XGGGXXGGGGG 574 N + RG GGG GGG GGGGG Sbjct: 82 NEAQSRGSGGGGGHRGGGSYGGGGG 106 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 566 NPXPP---PPPXXPPP-XPPPXGXPLXPXGLXPXPQXXP 670 NP PP PPP PPP PPP P P P P Sbjct: 69 NPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 569 PXPPPPPXX-PPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PPP PP P P P P P Sbjct: 67 PANPPPPVSSPPPASPPPATP-PPVASPPPPVASP 100 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 575 PPPPPXXPPP-XPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PPP PPP P P Q P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 569 PXPPPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXP 670 P PPP PPP PPP P P P P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP 71 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 569 PXPPPPPXXPPP---XPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPP PPP PPP P P P P PL Sbjct: 78 PPASPPPATPPPVASPPPPVASP--PPATPPPVATPPPAPL 116 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 566 NPXPP---PPPXXPPP-XPPPXGXPLXPXGLXPXPQXXP 670 NP PP PPP PPP PPP P P P P Sbjct: 69 NPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 569 PXPPPPPXX-PPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP PPP PP P P P P P Sbjct: 67 PANPPPPVSSPPPASPPPATP-PPVASPPPPVASP 100 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 575 PPPPPXXPPP-XPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PPP PPP P P Q P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +2 Query: 569 PXPPPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXP 670 P PPP PPP PPP P P P P Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP 71 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 569 PXPPPPPXXPPP---XPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPP PPP PPP P P P P PL Sbjct: 78 PPASPPPATPPPVASPPPPVASP--PPATPPPVATPPPAPL 116 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P P PPP P PPP P P P P + P S P P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 557 HXXNPXP---PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 H P P PPPP PP P P P P P P P P Sbjct: 592 HSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Score = 32.7 bits (71), Expect = 0.36 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQ-XXPNXPLX*XSGPHP 706 H +P PP PP PPP P P P P P P S P P Sbjct: 571 HVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 31.5 bits (68), Expect = 0.82 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPPP PP P P P P P P P+ Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPV 629 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPP-PXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPP P P P PP P P P P P P S P P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPP 578 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPP P PP P P P P P Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPP 589 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 28.3 bits (60), Expect(2) = 0.22 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 575 PPPPPXXPPPXP 610 PPPPP PPP P Sbjct: 66 PPPPPPLPPPPP 77 Score = 23.8 bits (49), Expect(2) = 0.22 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXP 598 NK P PPPPP P Sbjct: 28 NKEVPPPPPPPPPPVLP 44 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGG-GXXGGGGGXG 568 G +G G G RG GG GG G GGGGG G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G+G G G G + G RG GGG G GGGGG Sbjct: 28 GYGGGDAGYGGRGASGGGSY---GGRGGYGGGGGRGNRGGGGGG 68 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+G G G G + G G G G GGG GGG G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGG-GXXGGGGGXG 568 G +G G G RG GG GG G GGGGG G Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G+G G G G + G RG GGG G GGGGG Sbjct: 28 GYGGGDAGYGGRGASGGGSY---GGRGGYGGGGGRGNRGGGGGG 68 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+G G G G + G G G G GGG GGG G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGG 67 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 33.1 bits (72), Expect = 0.27 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 684 QRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 Q+ LG +G G++ G G P G G GGG G GG G+ Sbjct: 32 QKNYLG--YGGGYSGVGDNGLPFG-GVGGGVSGPGGNLGY 68 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGG-GGGXG 568 G G G+ G G GGG GGG G GGG G Sbjct: 58 GVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGG-GGGXG 568 G G P G G GG GGG GG GGG G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAG 87 >At4g16700.1 68417.m02523 phosphatidylserine decarboxylase similar to SP|P27465 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65 {Cricetulus griseus}; contains Pfam profile PF02666: phosphatidylserine decarboxylase Length = 453 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 645 NPSGXRGXPXGGGXGGGXXGGGGGXG 568 N SG R P GG G G GGGG G Sbjct: 39 NYSGARASPLGGSSGAGAGAGGGGTG 64 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.1 bits (72), Expect = 0.27 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PP PP PPP PPP Sbjct: 219 PKPPSPPRKPPPPPPP 234 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P P PP PPP PP P P PQ P+ P+ S P P Sbjct: 56 PSSPLPPSLPPPSPPGSLTP-------PLPQPSPSAPIT-PSPPSP 93 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 NP PP P PP P P P P P Sbjct: 98 NPRSPPSPNQGPPNTPSGSTPRTPSNTKPSP 128 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXP 628 H PPP P PP PPP P Sbjct: 211 HVVTSLPPPKPPSPPRKPPPPPPP 234 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 33.1 bits (72), Expect = 0.27 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PP PP PP PP P+ P P P S P P Sbjct: 413 PPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPP 458 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPPP PP PP P P P P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 +P PPP PPP PP P P P P Sbjct: 417 SPPLPPPVYSPPPSPPVFSPPPSPPVYSPPP 447 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 +P P PP PPP PP P P P P P+ S P P Sbjct: 426 SPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP---PPPPVHHSSPPPP 469 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PP P PPP PL P P P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPP 429 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPPPXPP-PXGXPLXPXGLXP 652 ++ H +P PPPPP PP P P G P P Sbjct: 53 FHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGL-XPXPQXXPNXP 679 H +P PPPPP PP PP P P G P P+ P Sbjct: 55 HPHSPSPPPPP--PPQWGPP--SPHYPQGQPYSSPAYPPHQP 92 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 33.1 bits (72), Expect = 0.27 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPPPXPP-PXGXPLXPXGLXP 652 ++ H +P PPPPP PP P P G P P Sbjct: 53 FHHPHSPSPPPPPPPQWGPPSPHYPQGQPYSSPAYPP 89 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGL-XPXPQXXPNXP 679 H +P PPPPP PP PP P P G P P+ P Sbjct: 55 HPHSPSPPPPP--PPQWGPP--SPHYPQGQPYSSPAYPPHQP 92 >At5g64290.1 68418.m08076 oxoglutarate/malate translocator, putative similar to SWISS-PROT:Q41364 2-oxoglutarate/malate translocator, chloroplast precursor. [Spinach]{Spinacia oleracea} Length = 563 Score = 32.7 bits (71), Expect = 0.36 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXP 637 PPPPP P P P P G L P Sbjct: 78 PPPPPPSPSPSPSPQGAKLIP 98 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXP 652 P PP PPP PPP P P G P Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 +P PPPPP PP PL P P P Sbjct: 216 SPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPP 250 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQ 661 P P PP PPP PPP L P PQ Sbjct: 214 PHSPFPP--PPPGPPPKEQDFVRPPLPPPPQ 242 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 32.7 bits (71), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPP PP PP P P G P P Sbjct: 38 PPPPGAYPPAGYPPGAYPPAPGGYPPAP 65 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 SG G G G GGG GGGGG G Sbjct: 81 SGGSGGLGGSGGGGGGSGGGGGDG 104 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 642 PSGXRGXPXGGGXGGGXXGGGGGXG 568 P G G G G GG GG GG G Sbjct: 77 PGGNSGGSGGLGGSGGGGGGSGGGG 101 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G SG G GGG G G GG G G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDGSDG 107 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPP 613 NP PPPPP P P PP Sbjct: 44 NPSPPPPPSNPSPPPP 59 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 32.7 bits (71), Expect = 0.36 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPP 613 NP PPPPP PP PP Sbjct: 106 NPPPPPPPSPSPPPPP 121 Score = 31.5 bits (68), Expect = 0.82 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGL 646 PPPP P P PPP P+ G+ Sbjct: 107 PPPPPPPSPSPPPPPGPVKSFGI 129 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PPPP PPP P P Sbjct: 108 PPPPPPSPSPPPPPGP 123 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.7 bits (71), Expect = 0.36 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP P PPP P GL P P Sbjct: 231 PPPPPPPHQAQPPPPP------PSGLFPPP 254 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXG------XPLXPXGLXPXP 658 P PPPP PP PPP G P+ G P P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRPMP 267 Score = 31.5 bits (68), Expect = 0.82 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXG----XPLXPXG 643 H P PPPP PP PPP P+ P G Sbjct: 238 HQAQPPPPPPSGLFPPPPPPMANNGFRPMPPAG 270 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 32.7 bits (71), Expect = 0.36 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGP 700 PPPPP PPP PP P P P P P S P Sbjct: 528 PPPPPLSPPPPSPP---PPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PPPPP P PPP Sbjct: 501 PPPPPPPEYEPSPPPP 516 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPP P P PP P P P P Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +2 Query: 566 NPXPPPPP----XXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQT 733 +P PPPPP PP PPP P P P P P+ P P + Q+ Sbjct: 617 SPPPPPPPTYYAVQSPPPPPPVYYP--PVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQS 674 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 642 PSGXRGXPXGGGXGGGXXGGGGGXG 568 P G GGG GGG GGGGG G Sbjct: 95 PGGGDVGGGGGGYGGGTPGGGGGGG 119 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGGXG 568 G P GGG GGG G G G G Sbjct: 110 GTPGGGGGGGGDTGAGAGGG 129 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 678 GXLGXXWGXGF-NPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G +G G G G G G GGG GGGG G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGX--GGGXXGGGGGXG 568 G G G G G G GGG GGG G GGG G Sbjct: 106 GYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 533 NRLYYNKXHXXNPXPPPPPXXPPPXPPPXGXPLXP 637 N Y H + PPPP PPP PP P P Sbjct: 14 NSPYSPHLHPPSAPLPPPPPLPPPPPPRQSHPESP 48 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 569 PXPPPPPXXP----PPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P P P PP PPP P G P P P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP P PPP P L P P+ P Sbjct: 400 PKPPPPPGPKGPRPPP------PMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP P P G P P P P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPP 403 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +2 Query: 569 PXPPPPPXXP----PPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P P P PP PPP P G P P P P Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP P PPP P L P P+ P Sbjct: 400 PKPPPPPGPKGPRPPP------PMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP P P G P P P P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPP 403 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 32.3 bits (70), Expect = 0.47 Identities = 32/124 (25%), Positives = 37/124 (29%), Gaps = 3/124 (2%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP---QXXPNXPLX*XSGPHPXXLTIAAQTX 736 +P PPP PPP P P P L P P P P S P P L ++ Sbjct: 79 SPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVL-LSPPPP 137 Query: 737 XFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLP 916 + PP P L PP P P P + A P Sbjct: 138 PVNLSPPPP---PVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTP 194 Query: 917 SXPP 928 PP Sbjct: 195 PPPP 198 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 +P PPP PPP P P P L P P Sbjct: 61 SPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP 91 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 566 NPXPPPPP--XXPPPXPPPXGXPLXPXGLXPXP---QXXPNXPLX*XSGPHPXXL 715 N PPPPP PPP P P P L P P P P S P P L Sbjct: 68 NLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVL 122 Score = 28.7 bits (61), Expect = 5.8 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP---QXXPNXPLX*XSGPHPXXL 715 +P PPP PP P P P L P P P P S P P L Sbjct: 43 SPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVL 95 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 32.3 bits (70), Expect = 0.47 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPPPP PPP P PL P P + P P Sbjct: 22 PLPPPPP--PPPPPMRRRAPLPPPPPPPMRRRAPLPP 56 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +2 Query: 569 PXPPPPPXXP----PPXPPPXGXPLXPXGLXPXP 658 P PPPPP P P PPP P+ P P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP 57 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPPP P PPP + L P P P+ Sbjct: 42 PPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPM 79 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +2 Query: 569 PXPPPPP-----XXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP PPP PP + P P P Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G S RG GGG GG GGGGG G Sbjct: 63 GWRVEQSHNRGERGGGGRGGDRGGGGGGRG 92 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G P+ G GGG GGG GGGG G Sbjct: 51 GSKPNKKWGGGMGGGGGGGGGSGGGGGG 78 Score = 32.3 bits (70), Expect = 0.47 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGGXG 568 G GGG GGG GGGGG G Sbjct: 61 GMGGGGGGGGGSGGGGGGRG 80 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GGG G G GGG G G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 32.3 bits (70), Expect = 0.47 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Frame = +2 Query: 569 PXPPP-----PPXXPPPXPPPXGXPLXP 637 P PPP PP PPP PPP P P Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 651 RPPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFP 761 RPP P P P L P PP PP P PK P Sbjct: 8 RPPPPPPPPPRLLVLPPLPPPPPPPPPQLP-FGPKLP 43 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 8/31 (25%) Frame = +2 Query: 575 PPPPPXXPP--------PXPPPXGXPLXPXG 643 PPPPP PP P PPP P P G Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFG 39 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 32.3 bits (70), Expect = 0.47 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G + S RG GGG G G GGGGG Sbjct: 83 GRGQSSSDRRGGYGGGGSGYGGGGGGGG 110 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXP 610 H P PPPPP PPP P Sbjct: 303 HGLPPRPPPPPPSPPPTP 320 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 32.3 bits (70), Expect = 0.47 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = -1 Query: 822 GFXXXGXGGGXRN*RXGXPXGGIW--AXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXG 649 GF G G G + G P GG A + G G G G G Sbjct: 120 GFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYGGNAGGYG 179 Query: 648 FNPSGXRGXPXGGGXGGGXXGGGGGXG 568 NP GGG G GGGGG G Sbjct: 180 GNPPYSGNAVGGGGGYGSNFGGGGGYG 206 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXPPP 604 N+ H P PPPPP PPP Sbjct: 75 NQTHLLPPQPPPPPPPPPP 93 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 +P PPP PP PP P P P PQ P Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPPPXPPPXGXP 628 Y H +P PPPPP PPP P P Sbjct: 127 YQPHHRHHPPPPPPP--PPPRSPNSASP 152 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPPPXPPP 616 +++ H P PPPPP P PP Sbjct: 130 HHRHHPPPPPPPPPPRSPNSASPP 153 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPL 631 +P PPP P PPP P P P+ Sbjct: 420 DPSPPPSPVQPPPPPSPPPQPV 441 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPPP PPP PL P P P Sbjct: 30 PPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +2 Query: 569 PXPPPPP-----XXPPPXPPPXGXP 628 P PPPPP PPP PPP P Sbjct: 43 PPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 575 PPPPPX-----XPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPPP PPP PPP P P P P Sbjct: 31 PPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 569 PXPPPPPXXP---PPXPPPXGXPLXPXGLXPXP 658 P PPPPP P PPP PL P P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPP 46 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PPPPP P PPP P P P Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 31.5 bits (68), Expect = 0.82 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAA 727 N PPP PP PPP PL P P P P P L+IA+ Sbjct: 299 NRADPPPQKSIPPPPPPPPPPLLQQ--PPPPPSVSKAPPPPPPPPPPKSLSIAS 350 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPK 755 PP P P P P P + PP P PK Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPK 344 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 645 NPSGXRGXPXGGGXGGGXXGGGGGXG 568 N G G GGG GGG GGGGG G Sbjct: 26 NSGGSSGCGAGGG-GGGSGGGGGGGG 50 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 684 QRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 Q G G G +G GG G G GGGGG G Sbjct: 5 QTGETPTVAGVGGGGAGCSAGNSGGSSGCGAGGGGGGSG 43 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G SG GGG GGG GGGGG Sbjct: 18 GGAGCSAGNSGGSSGCGAGGGGGGSGGG--GGGGG 50 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 +G G G G GGG G GGG G Sbjct: 24 AGNSGGSSGCGAGGGGGGSGGGGG 47 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPP 616 H +P PPPPP PPP P Sbjct: 116 HRRSPPPPPPPPPPPPTITP 135 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPP 616 H +P PPPPP PPP P Sbjct: 147 HRRSPPPPPPPPPPPPTITP 166 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPL 631 H + PPPP PPP PP P+ Sbjct: 113 HHHHRRSPPPPPPPPPPPPTITPPV 137 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPL 631 H + PPPP PPP PP P+ Sbjct: 144 HHHHRRSPPPPPPPPPPPPTITPPV 168 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTP 740 PP P PT P PTPP+ PP TP Sbjct: 165 PPTPTPTPPVVTPPTPTPPV-ITPPTPTP 192 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLT 718 P PP PPP P P P P P P+ P P +T Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVIT 186 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP PP PP P P P P+ P Sbjct: 218 PTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 P PP P P PPP P P P P Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPP PP PP P P P P Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P PP PPP P P P P P P+ P Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 127 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 P P P P PTPP+ PP TP PP + P Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P PP PPP P P P P P P+ P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 P P P P PTPP+ PP TP PP + P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 155 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P PP PPP P P P P P P+ P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 163 Score = 31.5 bits (68), Expect = 0.82 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 PP P P+ P PTPP+ PP TP PP + P Sbjct: 83 PPPPTPSVP-----SPTPPVSPPPPTPTPSVPSPTPPVSPPP 119 Score = 31.5 bits (68), Expect = 0.82 Identities = 18/66 (27%), Positives = 24/66 (36%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFX 745 +P P PPP PP P P P + P P P+ P P P ++ + Sbjct: 172 DPMPSPPPPVSPPPPTPTPSVPSPPDVTPTP-PTPSVPSPPDVTPTPPTPSVPSPPDVTP 230 Query: 746 XAQIPP 763 PP Sbjct: 231 TPPTPP 236 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P PP PPP P P P P P P+ P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVS-PPPPTPTPSVP 109 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPP 764 P P P P PTPP+ PP TP PP Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPP P P P PP P P P P + P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 118 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 566 NPXPP--PPPXXPPPXPPPXGXPLXPXGLXPXPQ-XXPNXPLX*XSGPHP 706 +P PP PPP P P P P+ P P P P P+ P P Sbjct: 128 SPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSP 177 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPP 764 P P PT P P+PP PP TP PP Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P P P P PP P P P P + P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P P P P PP P P P P + P Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +3 Query: 654 PPXPXPTXPFXDXLXPTPPI*XLPPKXTPXXXPKFPPXAXLP 779 P P P+ P + PTPP +P P PP P Sbjct: 200 PTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTP 241 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G G + G G GGG GGG GG G G+ Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGY 121 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G RG G G G G GG G G GGGGG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 GF G RG GGG GG GG G G Sbjct: 101 GFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 28.7 bits (61), Expect = 5.8 Identities = 31/103 (30%), Positives = 38/103 (36%), Gaps = 4/103 (3%) Frame = -1 Query: 864 NRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWGP--- 694 N G G G +GGF G GGG R G GG + + + G G Sbjct: 89 NSGGGGSSGG--RGGF---GGGGGRGGGRGGGSYGGGYGGR-----GSGGRGGGGGDNSC 138 Query: 693 -EXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 + + G + G G G GG G G GGGGG G Sbjct: 139 FKCGEPGHMARECSQG--GGGYSGGGGGGRYGSGGGGGGGGGG 179 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 31.9 bits (69), Expect = 0.62 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G + G G G G + G G GG GGG GGGG G Sbjct: 71 GHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G GGG G G GGGG G Sbjct: 46 GHGGHGGGGHYGGGGHGHGGHNGGGGHG 73 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.9 bits (69), Expect = 0.62 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G G G GF G GG GGG GG GG GF Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGF 95 Score = 31.5 bits (68), Expect = 0.82 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GGG GGG GGG G G Sbjct: 66 GGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKG 102 Score = 31.5 bits (68), Expect = 0.82 Identities = 31/104 (29%), Positives = 34/104 (32%), Gaps = 2/104 (1%) Frame = -1 Query: 882 ARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXG 703 A G W G G G + GGF G GGG G G+ V K Sbjct: 70 AGGGWIG-GSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFD 128 Query: 702 WGPEXXQRGXLGXXW--GXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G G + G G G G GG G G GG G Sbjct: 129 GGVGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAG 172 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G +G G G GGG GGG GGG G G Sbjct: 65 GGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGG 98 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 31.1 bits (67), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPL 631 PPP PPP PPP PL Sbjct: 296 PPPSPPPPPPPPPPQPL 312 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPP P PPP PPP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 569 PXPPPPPXXPPPXP 610 P PPPPP PPP P Sbjct: 298 PSPPPPPPPPPPQP 311 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPP P PPP PPP Sbjct: 381 PPPSPPPPPPPPPP 394 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PP PP PPP PPP Sbjct: 382 PPSPPPPPPPPPPP 395 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP 613 P P PPP PPP PP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P P PPP PPP P P Sbjct: 296 PPPSPPPPPPPPPPQP 311 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXP 637 P PP PPP PPP P P Sbjct: 245 PQQPPATPPPPPPPPPVEVPQKP 267 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 584 PPXXPPPXPPPXGXPL 631 PP PPP PPP PL Sbjct: 381 PPPSPPPPPPPPPPPL 396 Score = 27.1 bits (57), Expect(2) = 0.63 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP 616 +P PP PPP PPP Sbjct: 243 SPPQQPPATPPPPPPPP 259 Score = 23.4 bits (48), Expect(2) = 0.63 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 596 PPPXPPPXGXPLXPXGL 646 PPP PPP P P L Sbjct: 296 PPPSPPPPPPPPPPQPL 312 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.5 bits (68), Expect = 0.82 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 515 NLXVXXNRLYYNKXHXXNPXPPPPPXXPP--PXPPPXGXPLXPXGLXPXPQXXPNXPLX* 688 N V N Y N PPP P PP P PP P P P P P Sbjct: 138 NKNVPENIWYGNNYCNNTDLPPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPPSA 197 Query: 689 XSG 697 SG Sbjct: 198 ASG 200 Score = 30.3 bits (65), Expect = 1.9 Identities = 22/64 (34%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = +2 Query: 485 NKNIPFCLXXNLXVXXNRLYYNKXHXXNPXPPPPPXXP--PPXPPPXGXPLXPXGLXPXP 658 NKN+P N+ N Y N P P PP P PP PP P P + P P Sbjct: 138 NKNVP----ENIWYGNN--YCNNTDLPPPSPDFPPFSPSIPPPSPPY-FPPEPPSIPPPP 190 Query: 659 QXXP 670 P Sbjct: 191 PPSP 194 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.5 bits (68), Expect = 0.82 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G +G G GG GG GGGGG G Sbjct: 379 GVGGGGAGGYGAGGGGNGGGSFYGGGGGRG 408 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -1 Query: 678 GXLGXXWGXGFNPS-GXRGXPX--GGGXGGGXXGGGGGXG 568 G G +G G G G P GGG GGG GG GG G Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYG 269 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/88 (27%), Positives = 30/88 (34%), Gaps = 7/88 (7%) Frame = -1 Query: 807 GXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGWG---PEXXQRGXLGXX----WGXG 649 G GGG GG + ++ G G P G G +G G Sbjct: 301 GGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 648 FNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 +G G GGG G GGGG G+ Sbjct: 361 MGGAGGGGYRGGGGYDMGGVGGGGAGGY 388 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGX--RGXPXGGGXGGGXXGGGGGXG 568 G +G G G+ G G GGG GG GGGG G Sbjct: 359 GGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGG 397 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G+G G G G G++ G G GG G G G GGG Sbjct: 356 GYGGGMGGAGGGGYRGGGGYDMGGVGGG-GAGGYGAGGGGNGGG 398 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.82 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 +P PPP P PPP P P P P P+ P P Sbjct: 125 SPSPPPTPSLPPPAPKK--SPSTPSLPPPTPKKSPPPP 160 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +2 Query: 569 PXPPPP-PXXPPPXPPPXGXP----LXPXGLXPXPQXXPNXP 679 P PPPP P PP P P P L P P P+ P+ P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPP 129 Score = 29.5 bits (63), Expect = 3.3 Identities = 23/98 (23%), Positives = 29/98 (29%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFX 745 +P P P P PPP P P P+ P+ P PHP + Sbjct: 76 SPSTPIPSTPSTPSPPPPAPKKSPP--PPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPS 133 Query: 746 XAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXP 859 P P PP + H +SP P Sbjct: 134 LPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNP 171 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GG GGG GGGGG G Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGGG 58 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGX---GGGXXGGGGGXGF 565 G WG G G G GG GGG GGGG G+ Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGW 85 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+ E G G WG G GGG GG GGG G Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWG 72 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 31.5 bits (68), Expect = 0.82 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGGG G Sbjct: 612 GGGGGGGGPGGGGGGG 627 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGG 574 G GGG GGG GGGGG Sbjct: 609 GEGGGGGGGGGPGGGGGG 626 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGG G Sbjct: 611 GGGGGGGGGPGGGGGG 626 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 31.5 bits (68), Expect = 0.82 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPPXPPPXGXPLXP 637 +Y++ H P PPPP P P P PL P Sbjct: 70 FYSQFHNSLPPPPPPHLLPLSPPLPPLLPLPP 101 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 31.5 bits (68), Expect = 0.82 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGGG G Sbjct: 96 GGGGGGGGGGGGGGSG 111 Score = 31.5 bits (68), Expect = 0.82 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGGG G Sbjct: 191 GGGGGGGGGGGGGGGG 206 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -1 Query: 645 NPSGXRGXPXG---GGXGGGXXGGGGGXG 568 N G P G GG GGG GGGGG G Sbjct: 81 NAHGRADCPGGIVVGGGGGGGGGGGGGGG 109 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G P GGG GGG GGGGG Sbjct: 174 GSGTGTASGPDVYMHVEGGGGGGGGGGGGGGG 205 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGG G Sbjct: 97 GGGGGGGGGGGGGSGG 112 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GGG GGG G G G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSG 215 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G P G GGG GGG GGG G Sbjct: 80 GNAHGRADCPGGIVVGGGGGGGGGGGGGGGSG 111 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG G G GGGGG G Sbjct: 146 GGGSGEGSGGGGGGDG 161 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.5 bits (68), Expect = 0.82 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +2 Query: 569 PXPPPPPXXPPPXP----PPXGXPLXPXGLXPXP 658 P PPP PPP P PP P P L P P Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP 616 +P PPPP PP PPP Sbjct: 169 SPEPPPPSSLEPPPPPP 185 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PPPP PPP P P P P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEP 172 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G GF G G G G GG GG GG G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYG 151 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGG-GXGGGXXGGGGGXG 568 G G+ SG G GG G GG GG GG G Sbjct: 134 GGGYGGSGGYGGGAGGYGGSGGYGGGAGGYG 164 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGF--NPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+G G G G G +G G GGG GG GG GG G Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSG 183 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G +G G G G GG GGG G GG G+ Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGY 156 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G G N G G GG GG GG GG Sbjct: 146 GAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 28.7 bits (61), Expect = 5.8 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = -1 Query: 825 GGFXXXGXGGGXRN*RX-GXPXGGIWAXXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXG 649 GGF G GGG G GG + G G +G G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYG-G 181 Query: 648 FNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G GG G GG G Sbjct: 182 SGAGGYGGDATGHGGAGGGYGSSGGFG 208 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 648 FNPSGXRGXPXGGGXGGGXXGGGGG 574 + P G GGG GGG GGGGG Sbjct: 117 YTPPYPYGTIGGGGQGGGGQGGGGG 141 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +2 Query: 566 NPXPPPPPXXPPPXP----PPXG--XPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLT 718 NP PP P PPP P PP P+ G P P P S P+P T Sbjct: 64 NPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPP--PSTMYSPPYPYFYT 118 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PPP P P P P P+ P+ P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 30.3 bits (65), Expect = 1.9 Identities = 21/71 (29%), Positives = 24/71 (33%), Gaps = 2/71 (2%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP--XGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXF 742 P P PP PP PPP P P P P P + P P T+A+ Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPP---TVASSPPPP 91 Query: 743 XXAQIPPXGXP 775 PP P Sbjct: 92 VVIASPPPSTP 102 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 566 NPXPPP-----PPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLT 718 +P PPP PP PPP P P P P+ P S P P T Sbjct: 114 SPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTT 169 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPPP PP P P L P P P P Sbjct: 171 PPPPPATSAS--PPSSNPTDPSTLAPPPTPLPVVP 203 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/49 (30%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGL--XPXPQXXPNXPLX*XSGPHP 706 +P PP PPP P P P + P P P+ P + P P Sbjct: 87 SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPP 135 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 PP PP PP PPP P P L P P Sbjct: 1133 PPSPPPQPPSSPPP---PSSPPQLAPAP 1157 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXP 637 +P P PP PPP PP P P Sbjct: 1135 SPPPQPPSSPPPPSSPPQLAPAPP 1158 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 569 PXPPPPPXXPP---PXPPPXGXPLXP 637 P PPPP PP P PPP L P Sbjct: 1141 PSSPPPPSSPPQLAPAPPPSDHCLPP 1166 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -1 Query: 660 WGXGFNPSGXRGXPXGGGXGGGXXGGG-GGXG 568 +G G G G P GGG GGG GG GG G Sbjct: 100 FGGGRRFGGRFGKPGGGGLGGGGLPGGLGGLG 131 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXG--GGGGXGF 565 G G G G G GGG GGG G GGGG G+ Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGGW 105 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 575 PPPPPXXPPPXPP 613 PPPPP PPP PP Sbjct: 32 PPPPPPPPPPPPP 44 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 578 PPPPXXPPPXPPP 616 PPPP PPP PPP Sbjct: 32 PPPPPPPPPPPPP 44 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXG 622 PPPPP PPP P G Sbjct: 33 PPPPPPPPPPPPRKVG 48 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +2 Query: 569 PXPP---PPPXXPPPXPPPXGXP 628 P PP PP PPP PPP P Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPP 42 >At4g21620.1 68417.m03134 glycine-rich protein Length = 131 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = -1 Query: 657 GXGFNPSGXRGXPX---GGGXGGGXXGGGGGXG 568 G GF P G P GGG GGG G GG G Sbjct: 39 GSGFIPGFGNGFPGTGVGGGYGGGFGGPSGGFG 71 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 566 NPXPPPPPXXPPPXP 610 +P PPPPP PPP P Sbjct: 279 HPSPPPPPPPPPPLP 293 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G GGG GGG GGGGG G Sbjct: 13 GAGGGGGHGGGAGGGFGGG-AGGGGGHG 39 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXGF 565 GG GGG GGG G GF Sbjct: 12 GGAGGGGGHGGGAGGGF 28 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 575 PPPPPXXPPPXPP 613 PPPPP PPP PP Sbjct: 45 PPPPPPRPPPPPP 57 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 569 PXPPPPPXXPPPXP 610 P PPPPP PPP P Sbjct: 44 PPPPPPPRPPPPPP 57 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPPPP PP PPP Sbjct: 44 PPPPPPPRPPPPPP 57 >At3g44950.1 68416.m04843 glycine-rich protein Length = 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 645 NPSGXRGXPXGGGXGGGXXGGGGG 574 N G G GG GGG GGGGG Sbjct: 45 NSGGGGGGDDGGDVGGGDDGGGGG 68 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 575 PPPPPXXPPPXPP 613 PPPPP PPP PP Sbjct: 6 PPPPPPPPPPPPP 18 Score = 31.1 bits (67), Expect = 1.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 578 PPPPXXPPPXPPP 616 PPPP PPP PPP Sbjct: 6 PPPPPPPPPPPPP 18 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GG GGG GGGGG G Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCG 83 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G G GGG GGGGG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G GGG GGG GGGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGX--GGGXXGGGGGXG 568 G + G G GGG GGG GGGGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G G G G GGG GGG GGGG Sbjct: 61 GDGGGDGGGDGGGGGCGGGGGCGGG--GGGG 89 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGG 574 G++ G G GGG GGG GGGGG Sbjct: 775 GYHHGGHHG---GGGCGGGHHGGGGG 797 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G GG GGG GGG G G Sbjct: 786 GCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 578 PPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPP PP PPP G P P P P P SGP P Sbjct: 38 PPPGGYPPQGYPPPPHGYP--PAAYPPPPGAYPPAGYPGPSGPRP 80 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/59 (30%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +2 Query: 536 RLYYNKXHXXNPXPPP--PPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 R + + H + PP PP PPP G P P G P P P G +P Sbjct: 12 RFFSHHNHHGHGYPPGAYPPPPQGAYPPPGGYP--PQGYPPPPHGYPPAAYPPPPGAYP 68 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G W G G G GGG GGG GGGG Sbjct: 182 GAPWRGG---QGRGGQQRGGGRGGGGRGGGG 209 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G W G G G GGG GGG GGGG Sbjct: 118 GAPWRGG---QGRGGQQRGGGRGGGGRGGGG 145 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G W G G G GGG GGG GGGG Sbjct: 184 GAPWRGG---QGRGGQQRGGGRGGGGRGGGG 211 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 NP P P P P P P P P P P+ P Sbjct: 96 NPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P P P P PP P P P P P P+ P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPP---KPKPKPAPTPP 95 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP P P P PP P P P+ P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP P P P PP P P P P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP P P P PP P P P P P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP P P P PP P P P P P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKP 57 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 35 PAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 46 PAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 57 PAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P PP P P P P P P P+ P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P P P P PP P P P P P P Sbjct: 95 PNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXP 628 PPPPP PPP PPP P Sbjct: 67 PPPPP--PPPPPPPLQQP 82 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP 616 +P PPPPP PPP P Sbjct: 66 SPPPPPPPPPPPPLQQP 82 >At3g55790.1 68416.m06199 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 103 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 630 RGXPXGGGXGGGXXGGGGGXGF 565 RG GG GGG GGGGG F Sbjct: 58 RGGGGGGRGGGGGHGGGGGEDF 79 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 569 PXPPPPPXXPPPXP 610 P PPPPP PPP P Sbjct: 70 PPPPPPPLSPPPPP 83 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 SG G GGG G G GGGGG G Sbjct: 193 SGDGGGFGGGGSGFGGGGGGGGGG 216 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGP 700 PPPP PPP P P + P P P L S P Sbjct: 74 PPPPQPPPPPPRPCFNGVSAAQRLPLPSNTPTRSLSLISVP 114 Score = 30.3 bits (65), Expect = 1.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 569 PXPPPPPXXPPPXPP 613 P PPPP PPP PP Sbjct: 33 PYTPPPPQLPPPLPP 47 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PP PP PPP PPP Sbjct: 201 PPQPPPHPPPPPPP 214 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 P PPP PPP PPP Sbjct: 202 PQPPPHPPPPPPPP 215 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +2 Query: 551 KXHXXNPXPPPPP----XXPPPXPPP-XGXPLXPXGLXPXPQXXPN 673 + H P PPPPP PPP P P+ + P P PN Sbjct: 17 RNHTAAPPPPPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNPN 62 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +2 Query: 551 KXHXXNPXPPPPP----XXPPPXPPP-XGXPLXPXGLXPXPQXXPN 673 + H P PPPPP PPP P P+ + P P PN Sbjct: 17 RNHTAAPPPPPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNPN 62 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G +G G G G GGG GG GG Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXGF 565 +G G G GGG GGGG GF Sbjct: 60 AGGGGGGSTGNNGGGSGSGGGGGGF 84 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 575 PPPPPXXPPPXPPP 616 PPPPP P P PPP Sbjct: 59 PPPPPSPPQPLPPP 72 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 30.7 bits (66), Expect = 1.4 Identities = 28/98 (28%), Positives = 30/98 (30%), Gaps = 1/98 (1%) Frame = -1 Query: 858 GXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGG-IWAXXKXXVWAAXVKXXGWGPEXXQ 682 G G G GG G GG + G GG + G G Sbjct: 46 GHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 105 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GG GGG GGGG G Sbjct: 106 GGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G GGG G G GGGG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHG 71 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G + G GGG GGG GGGG G+ Sbjct: 100 GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGY 130 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +2 Query: 569 PXPP--PPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PP PP P PPP P P P P P P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P PPP P P P P P P P P P+ Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPV 151 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 P PPP PPP P P P P P P P Sbjct: 109 PTVSPPPVSPPPA--PTSPPPTPASPPPAPASPPPAP 143 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPL 631 N P PP PPP PPP PL Sbjct: 252 NSSPFAPPTPPPPPPPPPPRPL 273 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 569 PXPPPPPXXPPPXP 610 P PPPPP PPP P Sbjct: 235 PGPPPPPPPPPPSP 248 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 763 GGNLGXXKGVXLGGNX*XGGVGXRXSXKGXVGXGLGG 653 GG G G+ LGG GG+G G GLGG Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGG 78 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 672 LGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 LG G G G G GGG GGG GG GG Sbjct: 74 LGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 672 LGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGFXXXXLL 547 LG G G G G G G G G GGGGG G LL Sbjct: 51 LGLGGGAGLGGLGI-GAGIGAGAGLGLGGGGGGLGGGGGGLL 91 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGG-GXGGGXXGGGGGXG 568 G LG G G G GG G GGG GGGG G Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFG 97 Score = 28.3 bits (60), Expect = 7.7 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXG---GGXXGGGGGXG 568 G G G G G GGG G GG GGG G G Sbjct: 67 GIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 763 GGNLGXXKGVXLGGNX*XGGVGXRXSXKGXVGXGLGG 653 GG G G+ LGG GG+G G GLGG Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGG 78 >At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 491 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXP-XGLXPXPQXXP 670 H P PP PP PPP G P P L P P P Sbjct: 44 HSSKPKPPSSSISQPPTPPP-GPPDSPAPSLPPSPSDDP 81 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGG 574 G GGG GGG GGGGG Sbjct: 10 GGGGGGGSGGGIGGGGGG 27 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXGF 565 S G GGG GG GGGGG F Sbjct: 5 SSLGGGGGGGGGSGGGIGGGGGGRF 29 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 3/19 (15%) Frame = +2 Query: 569 PXPPPPPXXP---PPXPPP 616 P PPPPP P PP PPP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPPP P PPP + P P P P Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPP-PPPPMFDP 57 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 575 PPPPPXXPPPX----PP-PXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PP P PPP PP P P P PQ P P GP+P Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYP 239 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPP P PP G P P G P P Sbjct: 220 PPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 569 PXPPPPPXXPPPX----PPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PP PP PPP G P G P P P SGP P Sbjct: 151 PQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPP 200 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +2 Query: 575 PPPP-----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP P PPP G P P G+ P P P Sbjct: 198 PPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMP 237 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPP P PP G P P G P P Sbjct: 220 PPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 569 PXPPPPPXXPPPX----PPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P PP PP PPP G P G P P P SGP P Sbjct: 151 PQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPP 200 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +2 Query: 575 PPPP-----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPPP P PPP G P P G+ P P P Sbjct: 198 PPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMP 237 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -1 Query: 660 WGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 +G G SG G GGG G G GGG G G Sbjct: 121 YGGGGGYSGGGGGYGGGGGGYGGGGGGYGGG 151 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G+ G GGG GGG GGGG Sbjct: 131 GGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = -1 Query: 642 PSGXRGXPXGGGX---GGGXXGGGGGXG 568 PS R GGG GGG GGGGG G Sbjct: 115 PSAPRAYGGGGGYSGGGGGYGGGGGGYG 142 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G GGG GGGGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGG 232 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 SG G GG GG GGGGG G Sbjct: 210 SGGGGGLGGGNGSGGGGGGGGGGG 233 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGGXG 568 G GG GGG GGGGG G Sbjct: 23 GGTCGGSGGGGGGGGGGGSG 42 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 630 RGXPXGGGXGGGXXGGGGG 574 RG GG GGG GGGGG Sbjct: 21 RGGGTCGGSGGGGGGGGGG 39 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 30.3 bits (65), Expect = 1.9 Identities = 33/127 (25%), Positives = 41/127 (32%), Gaps = 7/127 (5%) Frame = +2 Query: 569 PXPPPPPXXPPP-XPPPXGXPLXP---XGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTX 736 P PP P PP PPP P P + P P P P+ S P T Sbjct: 340 PVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPI--YSPPVKPPPIQKPPTP 397 Query: 737 XFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLF---FXXPRAQRXXAXVS 907 + PP P LQ +PP P P P++ P + + Sbjct: 398 TYS----PPIKPPPLQ----KPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIY 449 Query: 908 SLPSXPP 928 S P PP Sbjct: 450 SPPVKPP 456 Score = 29.9 bits (64), Expect = 2.5 Identities = 30/122 (24%), Positives = 37/122 (30%), Gaps = 4/122 (3%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXP-XPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXA 751 PP P PP PPP P P P P P S P T + Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYS-- 316 Query: 752 QIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLF---FXXPRAQRXXAXVSSLPSX 922 PP P +Q +PP P P P++ P + + S P Sbjct: 317 --PPIKPPPVQ----KPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVK 370 Query: 923 PP 928 PP Sbjct: 371 PP 372 Score = 29.1 bits (62), Expect = 4.4 Identities = 27/118 (22%), Positives = 32/118 (27%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PP P PP PPP P P P P S P T + Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYS--- 214 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSXPP 928 PP P + PP P +P P + + S P PP Sbjct: 215 -PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 28.7 bits (61), Expect = 5.8 Identities = 29/121 (23%), Positives = 34/121 (28%), Gaps = 3/121 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PP P PP PPP P P P P S P T + Sbjct: 394 PPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYS--- 450 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLF---FXXPRAQRXXAXVSSLPSXP 925 PP P + +PP P P P + P Q+ S P P Sbjct: 451 -PPVKPPPVH----KPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKP 505 Query: 926 P 928 P Sbjct: 506 P 506 Score = 28.7 bits (61), Expect = 5.8 Identities = 27/118 (22%), Positives = 31/118 (26%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PP P PP PPP P P P P S P T + Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYS--- 550 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAXVSSLPSXPP 928 PP P + PP P +P P + S P PP Sbjct: 551 -PPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 575 PPPPPXXPPPXPPP-XGXPLXPXGLXPXPQXXPNXP 679 PPPP PP PPP P + P P P P Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G GGG G G GGGG G Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHG 71 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G+G G G +G G G G GG GGG GGGG G Sbjct: 74 GYGGGGGHYGGGGGHYGGG---GGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 29.9 bits (64), Expect = 2.5 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = -1 Query: 717 VKXXGWGPEXXQRGXLGXXWGXGF---NPSGXRGXPXGGGXGGGXXGGGGG 574 V+ G+G G G G G N G G GG GGG GGGGG Sbjct: 38 VQPEGYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGG-GGGHYGGGGG 87 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G G G G G GGG GGGGG Sbjct: 60 GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 31/105 (29%), Positives = 35/105 (33%) Frame = -1 Query: 879 RGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWAXXKXXVWAAXVKXXGW 700 RG W + G C GG GG R G P G + V Sbjct: 7 RGGWGDFPGKGVGSCVFGGGGGGPAFGG-----RGGGPGRGYGGGPR--VHGPGYGIGSR 59 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 GP+ G G G P G GGG G G GGG G G+ Sbjct: 60 GPDPGPGFFFG---GAGPGP----GYGGGGGHGPGYGGGGDGRGY 97 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 30.3 bits (65), Expect = 1.9 Identities = 26/104 (25%), Positives = 35/104 (33%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXXAQ 754 PPPPP P P PPP P P P P S P P ++ + + Sbjct: 457 PPPPPPSPSP-PPPYVYSSPP---PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSS 512 Query: 755 IPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQ 886 PP + +PP +SP P+ + P Q Sbjct: 513 PPP------PYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQ 550 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PPPPP PPP P P P Q P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPP 553 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 P P PPP P PPP P P P P S P P Sbjct: 525 PPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 30.3 bits (65), Expect = 1.9 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -1 Query: 702 WGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 +G Q G G G G G G GGG GGG GGGG Sbjct: 22 FGTHSLQAGGNGGGSGKGQWLHGG-GGEGGGGEGGGGEGGGG 62 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G E + G G + G R GGG GG GGGG Sbjct: 54 GGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G + GGG GGG GGGG Sbjct: 69 GGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGGG G Sbjct: 45 GGGEGGGGEGGGGEGG 60 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G RG GGG GG GGGGG G Sbjct: 639 GGRGNRFGGG-GGNRFGGGGGRG 660 >At5g55390.1 68418.m06901 hydroxyproline-rich glycoprotein family protein Length = 1332 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 584 PPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSG 697 P P P PPP + P G P P PN P SG Sbjct: 1292 PHDFPLPPPPPSDFEMSPRGFAPGPN--PNYPYMSRSG 1327 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXP 637 PPPPP PP PP P P Sbjct: 37 PPPPPVYSPPISPPPPPPPPP 57 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXP 637 PPPP PP PPP P P Sbjct: 38 PPPPVYSPPISPPPPPPPPPP 58 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 29.9 bits (64), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PPP PPP PPP Sbjct: 76 PSTAPPPPHPPPPPPP 91 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 569 PXPPPPPXXPPP--XPPPXGXPLXPXGLXPXPQXXP 670 P PPP PPP PPP P P P P P Sbjct: 28 PTATPPPATPPPVATPPPVATP--PPAATPAPATPP 61 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPLXPXGLXP 652 PPP PP P PL P GL P Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIP 500 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPLXPXGLXP 652 PPP PP P PL P GL P Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIP 500 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 581 PPPXXPPPXPPPXGXPLXPXGLXP 652 PPP PP P PL P GL P Sbjct: 477 PPPTQPPAGEKPPPYPLFPPGLIP 500 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GGG GGG GGGGG G Sbjct: 123 GGGGYSYGGG-GGGYGGGGGGYG 144 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G G++ G G GGG G G GG GG GF Sbjct: 124 GGGYSYGGGGGGYGGGGGGYG-GGGDGGGGF 153 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 4/48 (8%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXPPPXPPPXGXPLXP----XGLXPXPQXXPNXP 679 N N PPPPP PP P P G P PN P Sbjct: 20 NSERDINQPPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYPNYP 67 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXG-GGGGXG 568 G G GGG GGG G GGGG G Sbjct: 146 GSHGHGCGGGGGGGGGGLGGGGCG 169 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GGG GGG GGGG G Sbjct: 153 GGGGGGGGGGLGGGGCGGGGCGG 175 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 627 GXPXGGGXGGGXXGGGGGXG 568 G G G GGG GGGGG G Sbjct: 145 GGSHGHGCGGGGGGGGGGLG 164 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGGXG 568 S G GGG GGG GGGG G Sbjct: 147 SHGHGCGGGGGGGGGGLGGGGCGG 170 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXG-GGXXGGGGGXG 568 G G + G G GGG G GG GGGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCG 174 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG-GXGF 565 G + + G G G G G G G GGG GGGG G G+ Sbjct: 571 GRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGY 616 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXX-GGGGGXG 568 G G F G G GG GGG GGGGG G Sbjct: 567 GRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYG 601 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G G GGG GGG GGG G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G +G G G G GGG GGG G G Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG 622 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G PSG R P G G G G GGGG Sbjct: 55 GYGGPPSGSRWAPGGSGVGVG--GGGG 79 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXG 643 PPPPP PPP PPP L G Sbjct: 55 PPPPP--PPPPPPPSENELSGPG 75 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 569 PXPPPPPXXPPP 604 P PPPPP PPP Sbjct: 55 PPPPPPPPPPPP 66 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 29.9 bits (64), Expect = 2.5 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PP P PP PPP P P L P P + PL Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQAL-PPPLPHSHPPL 895 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 545 YNKXHXXNPXPPPPPXXPPPXPPPXGXPL 631 Y++ + + PP P PP PPP PL Sbjct: 24 YHQCYASSSNPPEPESSSPPPPPPPPQPL 52 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -1 Query: 681 RGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 +G G +G G G G G GGG G G G G Sbjct: 178 QGRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G + + G G +G G G G GGG G G GGGG Sbjct: 179 GRQGSRYGGGGGSFGGG--GGGGAGSYGGGGAGAGSGGGGG 217 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXP--LXPXGLXPXPQXXP 670 P P PP PP PP P + P P PQ P Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 P PPP P PP P P P PQ P Sbjct: 74 PNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 545 YNKXHXXNPXPPPP-PXXPPPXPPP 616 + K P PPPP P P P PPP Sbjct: 17 FKKPKNRPPSPPPPLPLPPSPSPPP 41 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXP 652 PP P PP PPP P P L P Sbjct: 59 PPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PP P PP PP P P P P P+ P Sbjct: 47 PPSQPPTQPPTQPPSHPPTQPP--TPPPSQSPSQP 79 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G P GGG GGG GG G Sbjct: 229 GRGRGGFMGRPRGGGFGGGNFRGGRG 254 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 29.5 bits (63), Expect = 3.3 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = -1 Query: 681 RGXLGXXWGXGFNPSG----XRGXPXGGGXGGGXXGGGGG 574 RG G G GF+ G RG P GG GG G GG Sbjct: 34 RGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGG 73 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 H P P P P P P P P P P P P P P Sbjct: 36 HKPVPSPKPKPV-PSPKPKPVPSPSVPSPSVPSPNPRPVTP 75 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 29.5 bits (63), Expect = 3.3 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +2 Query: 575 PPPPPXXPPPXPP-PXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAA 727 PPP P PPP P P P P P PL S P P + A+ Sbjct: 36 PPPSPPSPPPLPKLPFSSTTPPSS--SDPNASPFFPLYPSSPPPPSPASFAS 85 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPL 631 N PPPPP P PPP P+ Sbjct: 265 NSPPPPPPGSWQPSPPPPPPPV 286 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 548 NKXHXXNPXPPPP----PXXPPPXPPPXG 622 N +P PPPP P PPP PP G Sbjct: 260 NNNWMNSPPPPPPGSWQPSPPPPPPPVSG 288 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGG 577 G G N + +G GGG GGG GGGG Sbjct: 106 GGGNNNNNKKGQKNGGGGGGG--GGGG 130 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -1 Query: 639 SGXRGXPX--GGGXGGGXXGGGGGXG 568 +G +G P GGG GGG GGG G Sbjct: 255 NGGKGAPAAGGGGAGGGKGAGGGAKG 280 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 714 KXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGG 577 K G G G G G G G +G P GGG GGGG Sbjct: 254 KNGGKGAPAAGGGGAGGGKGAG---GGAKGGPGNQNQGGGKNGGGG 296 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 GP +G G G G +P + GGG G G GGG Sbjct: 281 GPGNQNQG--GGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGG 320 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGG 574 G + SG RG GGG GGG GGG G Sbjct: 15 GGHSSGRRGGRGGGGRGGG--GGGRG 38 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G GG GGG GGGGG G Sbjct: 11 GRRGGGHSSGRRGGRGGGGRGGGGGGRG 38 >At2g17870.1 68415.m02070 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 301 Score = 29.5 bits (63), Expect = 3.3 Identities = 31/120 (25%), Positives = 40/120 (33%) Frame = -1 Query: 927 GGXDGREETXAXXRXARGXWKNRGXXGEVGCXLKGGFXXXGXGGGXRN*RXGXPXGGIWA 748 GG ++E + R + G N G G + GG GGG R G + Sbjct: 79 GGSLNKKENSS--RGSGGNCFNCGEVGHMAKDCDGGSGGKSFGGGGG--RRSGGEGECYM 134 Query: 747 XXKXXVWAAXVKXXGWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 +A + G G G + G G GG GG GGGGG G Sbjct: 135 CGDVGHFARDCRQSGGGNSGGGGGGGRPCYSCG--EVGHLAKDCRGGSGGNRYGGGGGRG 192 >At2g15780.1 68415.m01809 glycine-rich protein similar to Blue copper protein precursor (SP:Q41001) {Pisum sativum}; contains a Pfam PF02298: Plastocyanin-like domain related to blue copper-binding protein; contains a domain related to blue copper-binding protein Length = 257 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXGF 565 G R G WG G N S G G G G G G G+ Sbjct: 43 GSGSNSRSGWGWGWGQGSNYSSGSASTPGSGWGFGSSRNGSGWGW 87 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.5 bits (63), Expect = 3.3 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 9/37 (24%) Frame = +2 Query: 569 PXPPPPPXXPPP---------XPPPXGXPLXPXGLXP 652 P PPPPP PPP PPP L P + P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 7/31 (22%) Frame = +2 Query: 557 HXXNPXPPPPP-------XXPPPXPPPXGXP 628 H P PPPPP PPP PPP P Sbjct: 43 HPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G+ P+ G G G GF G + GG G GG G Sbjct: 858 GFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGGFSAFGGNSG 901 >At1g33250.1 68414.m04110 fringe-related protein + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 548 Score = 29.5 bits (63), Expect = 3.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 533 NRLYYNKXHXXNPXPPPPPXXPPPXP 610 N L+ + H PPPPP PP P Sbjct: 82 NHLWNKRYHHPIVTPPPPPPSPPSLP 107 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.5 bits (63), Expect = 3.3 Identities = 21/65 (32%), Positives = 23/65 (35%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQTXXFXX 748 P P PPP PPP P P P P+ N P S P P L A Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPP---PPPPKLKNNGP----SPPPPPPLKKTAALSSSAS 291 Query: 749 AQIPP 763 + PP Sbjct: 292 KKPPP 296 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 584 PPXXPPPXPPPXGXPLXP 637 PP PPP PPP P P Sbjct: 26 PPKSPPPPPPPPALPKPP 43 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN 673 NP P PPP PPP P P P P P+ Sbjct: 41 NPCSPVQSSPPPPSPPP---PSTPTTACPPPPSPPS 73 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXP--PPXPPP 616 N +P PPPPP PP PPP Sbjct: 81 NNVDPASPQPPPPPPIENLPPPPPP 105 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXP 628 PP PP PP PPP P Sbjct: 364 PPNPPRQPPSHPPPGSAP 381 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 PPP PP PPP L P PQ P P Sbjct: 306 PPPTIQPPYQPPPPTQSLHQPPYQPPPQ-QPQYP 338 >At5g10060.1 68418.m01165 expressed protein Length = 469 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +2 Query: 569 PXPPPPPXXPPP---XPPPXG-XPLXPXGLXPXP 658 P PPPP PP P G PL P GL P P Sbjct: 394 PNPPPPQFLKPPVMNNPYAFGNIPLMPPGLPPPP 427 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 705 GWGPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G GP G G G G G GGG GG GG GG Sbjct: 149 GGGPGGASGGASGGASGGA--SGGASGGASGGGPGGASGGGPGG 190 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G G P G G GG GG G GG Sbjct: 135 GGASGGGDKPGGASGGGPGGASGGASGGASGG 166 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -1 Query: 651 GFNPSGXRGXPXGGGXGGGXXGGGGG 574 G P G G GG GGG G GG Sbjct: 177 GGGPGGASGGGPGGASGGGPGGASGG 202 >At5g07530.1 68418.m00862 glycine-rich protein (GRP17) olesin; glycine-rich protein 17 (GRP17) PMID:11431566; function: pollen recognition (PMID:10655594) Length = 543 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 699 GPEXXQRGXLGXXWGXGFNPSGXRGXPXGGGX---GGGXXGGGGG 574 G E G G G + SG GGG GGG GGGGG Sbjct: 495 GSEGGMSGSEGGMSESGMSGSGGGKHKIGGGKHKFGGGKHGGGGG 539 >At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus musculus Length = 555 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGG G G Sbjct: 255 GGGAGGGGGGGGSGGG 270 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPP 604 +YN+ P PPPP PPP Sbjct: 245 FYNESAIETPPLPPPPPPPPP 265 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPP 604 +YN+ P PPPP PPP Sbjct: 245 FYNESAIETPPLPPPPPPPPP 265 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 575 PPPPPXXPPPXPPPXGXPLXPX--GLXPXPQXXPNXPLX*XSGP 700 PP P P P P P P G P P P+ P+ S P Sbjct: 494 PPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPP 537 Score = 29.1 bits (62), Expect = 4.4 Identities = 31/128 (24%), Positives = 38/128 (29%), Gaps = 8/128 (6%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPP----XGXPLXPXGL-XPXPQXXPNXPLX*XSGPHPXXLTIAAQ 730 +P PPPPP P P P P P + P PQ P P S P P + Sbjct: 712 SPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHP--PCIEYSPPPPPTVHYNPP 769 Query: 731 TXXFXXAQIPPXGXPXLQFR---XXXXXXXXXNPPFNXHPTSPXXPLFFXXPRAQRXXAX 901 PP P + PP H + P P + P Sbjct: 770 PPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGIS 829 Query: 902 VSSLPSXP 925 +S P P Sbjct: 830 YASPPPPP 837 >At4g10070.1 68417.m01647 KH domain-containing protein DNA-directed RNA polymerase (EC 2.7.7.6) II largestchain - mouse, PIR2:A28490 Length = 725 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPPXPPPXGXPL 631 YY + + P PPP P P P G PL Sbjct: 432 YYGRQGAQSAGPVPPPSGPVPSPAFGGPPL 461 >At3g62170.1 68416.m06985 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase, PF04043 plant invertase/pectin methylesterase inhibitor ;similar to pollen-specific pectin esterase GI:1620652 from [Brassica rapa subsp. pekinensis] Length = 588 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 630 RGXPXGGGXGGGXXGGGGG 574 RG P GG G G GGGGG Sbjct: 253 RGAPAGGDDGIGEGGGGGG 271 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 669 GXXWGXGFNPSGX--RGXPXGGGXGGGXXGGGGGXG 568 G G F G RG GGG GG GGGG G Sbjct: 556 GRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYG 591 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -1 Query: 669 GXXWGXGFNPSGX--RGXPXGGGXGGGXXGGGGGXG 568 G G F G RG GGG GG GGGG G Sbjct: 556 GRFGGRDFRREGSYSRGGGGGGGGGGSDYYGGGGYG 591 >At3g50870.1 68416.m05570 zinc finger (GATA type) family protein Arabidopsis thaliana mRNA for GATA transcription factor 3, PID:e1254739 Length = 295 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 642 PSGXRGXPXGGGXGGGXXGGGGGXG 568 PS P G GGG GGGGG G Sbjct: 122 PSFSANKPSRGCSGGGGGGGGGGGG 146 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G GF G R GG GGG GGG G Sbjct: 8 GGGFRGRGGRDGGGGGRFGGGGGRFGGGGG 37 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP P P P P P + P S P P Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP P P P P P + P S P P Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP P P P P P + P S P P Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 28.3 bits (60), Expect = 7.7 Identities = 27/109 (24%), Positives = 35/109 (32%), Gaps = 2/109 (1%) Frame = +2 Query: 542 YYNKXHXXNPXPPPPPXXPPPXPPPXGXPLXP--XGLXPXPQXXPNXPLX*XSGPHPXXL 715 YY+ PPPP P PPP P P P P P P S P P Sbjct: 73 YYHSPPPPVKSPPPPYVYSSP-PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVK- 130 Query: 716 TIAAQTXXFXXAQIPPXGXPXLQFRXXXXXXXXXNPPFNXHPTSPXXPL 862 + + + PP P + +PP + SP P+ Sbjct: 131 --SPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 177 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHP 706 PPPP PP P P P P P + P S P P Sbjct: 157 PPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PP PP PP PPP Sbjct: 73 PLPPSPPPTLPPSPPP 88 >At2g22800.1 68415.m02706 homeobox-leucine zipper protein 9 (HAT9) / HD-ZIP protein 9 identical to GB:U09341 Length = 274 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 612 GGXGGGXXGGGGGXG 568 GG GGG GGGGG G Sbjct: 226 GGGGGGNGGGGGGSG 240 >At2g20550.1 68415.m02400 DNAJ chaperone C-terminal domain-containing protein contains Pfam profile PF01556: DnaJ C terminal region; similar to DnaJ-like proteins (GI:6179940) [Nicotiana tabacum] and(GI:11863723) [Lycopersicon esculentum]; similar to DnaJ homolog subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat shock protein 40) (HSP40) (DnaJ protein homolog 1) (HDJ-1) (Swiss-Prot:P25685) [Homo sapiens] and (Swiss-Prot:Q9QYJ3) [Mus musculus] Length = 284 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 621 PXGGGXGGGXXGGGGGXG 568 P G G GG GGGGG G Sbjct: 80 PSGSGSSGGREGGGGGGG 97 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 575 PPPPPXXPPP-XPPPXGXPLXPXGLXPXP 658 PPP P PPP PPP P P P Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSP 254 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXG--LXPXPQXXPN 673 +P PPP PP PP P P + PQ PN Sbjct: 229 SPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPN 266 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 29.1 bits (62), Expect = 4.4 Identities = 22/74 (29%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Frame = +2 Query: 566 NPXPPPP----PXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPLX*XSGPHPXXLTIAAQT 733 +P PPP P PPP PPP PL P P+ P S P L+ ++ Sbjct: 54 SPSSPPPLSLSPSSPPP-PPPSSSPLSSLS----PSLSPSPPSSSPSSAPPSSLSPSSPP 108 Query: 734 XXFXXAQIPPXGXP 775 PP P Sbjct: 109 PLSLSPSSPPPPPP 122 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGG 577 G G GGG GGG GGGG Sbjct: 214 GGYGSGGGGGSGGGSVGGGG 233 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPP 616 H PPPP PPP P P Sbjct: 7 HTATQQTPPPPPPPPPAPAP 26 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 26.2 bits (55), Expect(2) = 5.0 Identities = 11/19 (57%), Positives = 11/19 (57%), Gaps = 5/19 (26%) Frame = +2 Query: 575 PPPPPXXPP-----PXPPP 616 PPPPP PP P PPP Sbjct: 9 PPPPPPPPPSFRSIPRPPP 27 Score = 21.0 bits (42), Expect(2) = 5.0 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 596 PPPXPPPXGXPLXP 637 PPP P P P P Sbjct: 50 PPPPPLPPARPFGP 63 >At5g62820.1 68418.m07885 integral membrane protein, putative MtN24, Medicago truncatula, EMBL:MTY15290; contains Pfam PF04535 : Domain of unknown function (DUF588); contains 4 transmembrane domains ; similar to putative ethylene responsive element binding protein (GI:22135858) [Arabidopsis thaliana] Length = 297 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 548 NKXHXXNPXPPPPPXXPPPXPPP 616 NK +P P P P PP PPP Sbjct: 61 NKLTQFSPLPSPIPPPPPQFPPP 83 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 648 FNPSGXRGXPXGGGX--GGGXXGGGGG 574 F+ +G G GGG GGG GGGGG Sbjct: 7 FSMNGVGGGGGGGGRFFGGGIGGGGGG 33 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXP--LXPXGLXPXPQ 661 +P P PP P P PP G P P G P Q Sbjct: 559 SPPPIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQ 592 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXP--LXPXGLXPXPQ 661 +P P PP P P PP G P P G P Q Sbjct: 559 SPPPIAPPGPPAPQPPTQGYPPSNQPPGAYPSQQ 592 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN 673 PPPP PPP PP P+ + P Q N Sbjct: 101 PPPP--PPPPPPVQSVPIASEPVQPVNQFSSN 130 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPN 673 PPPP PPP PP P+ + P Q N Sbjct: 101 PPPP--PPPPPPVQSVPIASEPVQPVNQFSSN 130 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G + SG G GG GG GG G G Sbjct: 7 GSGSSGSGSGGSVSGGSGSGGSGSGGSGSG 36 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGG---GXGGGXXGGGGG 574 G G G G P G G GG G GGG G GGG Sbjct: 319 GFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGG 356 >At4g19200.1 68417.m02833 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 179 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXP 670 PP PP PP P P G P P P Sbjct: 44 PPAGGYPPAGYPPGAYPAAPGGYPPAPGGYP 74 >At4g14540.1 68417.m02240 CCAAT-box binding transcription factor subunit B (NF-YB) (HAP3 ) (AHAP3) family contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to LEC1-like protein (GI:22536010) [Phaseolus coccineus] Length = 161 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 639 SGXRGXPXGGGXGGGXXGGGGG 574 +G +G GGG GGG G GG Sbjct: 119 AGRQGDKEGGGGGGGAGSGSGG 140 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPLXPXGLXPXP 658 +P PPP P PPP P P P P P Sbjct: 28 SPEPPPSPE-PPPSPEKPTSPEQPSSPEPPP 57 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 557 HXXNPXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXP 679 H N PP P P P P P P P P P Sbjct: 16 HRSNHRPPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GG GGGGG G Sbjct: 97 GGGIGGDKFGGGGGGG 112 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +2 Query: 548 NKXHXXNPXPPPPP---XXPPPXPPP 616 N+ H + PPPPP PPP PPP Sbjct: 16 NRRHLHH-YPPPPPYYYLDPPPPPPP 40 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GG GGG GGGG G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGG 36 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GG GG G Sbjct: 75 GGGRGGGRGGGDGGRG 90 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -1 Query: 678 GXLGXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGGXG 568 G G G G+N G G GG GGG GGG G Sbjct: 47 GNGGYNGGGGYNGGG--GHNGGGYNGGGGYNGGGHGG 81 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 669 GXXWGXGFNPSGXRGXPXGGGXGGGXXGGGGG 574 G G+N G G GGG GG GGGG Sbjct: 44 GHGGNGGYNGGG--GYNGGGGHNGGGYNGGGG 73 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 P P P P PP P PL P P P PL Sbjct: 245 PSPAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPPPL 282 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGG 574 G G G G GGG GGGGG Sbjct: 69 GGSGNRNGRGGGGGSGGGGGG 89 >At1g29230.1 68414.m03575 CBL-interacting protein kinase 18 (CIPK18) identical to CBL-interacting protein kinase 18 [Arabidopsis thaliana] gi|14334388|gb|AAK59695 Length = 520 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPP 616 P PPPPP PPP P P Sbjct: 17 PDPPPPP--PPPHPKP 30 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGG 574 G G GGG G G GGGGG Sbjct: 402 GGGGGDGGGGQGTGIGGGGGG 422 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 657 GXGFNPSGXRGXPXGGGXG--GGXXGGGGGXGF 565 G G G G GGG G GG GGG GF Sbjct: 451 GGGGGEQGVTGSDGGGGRGRGGGKVAGGGKKGF 483 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 615 GGGXGGGXXGGGGGXG 568 GGG GGG GGG G G Sbjct: 400 GGGGGGGDGGGGQGTG 415 >At4g23890.1 68417.m03436 expressed protein hypothetical protein, Synechocystis sp., PIR:S76577 Length = 250 Score = 23.4 bits (48), Expect(2) = 7.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 566 NPXPPPPPXXPP 601 NP PPPPP PP Sbjct: 136 NPPPPPPP--PP 145 Score = 23.4 bits (48), Expect(2) = 7.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 578 PPPPXXPPPXPPPXGXPLXPXGLXPXPQXXPNXPL 682 PPPP PPP P G P+ P PL Sbjct: 137 PPPP--PPPPPAKQGSDASAVATDKKPK-APKLPL 168 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 569 PXPPPPPXXPPP 604 P PPPPP PPP Sbjct: 180 PLPPPPPHHPPP 191 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 569 PXPPPPPXXPPP 604 P PPPPP PPP Sbjct: 180 PLPPPPPHHPPP 191 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 581 PPPXXPPPXPPP 616 PPP PPP PPP Sbjct: 97 PPPSPPPPPPPP 108 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 569 PXPPPPPXXPPPXPPPXGXPLXPXGLXP 652 P PPPP PP PP G P G P Sbjct: 46 PPPPPPHGYPPVAYPPHGG-YPPAGYPP 72 >At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEAFY PETIOLE, putative nearly identical to AP2/EREBP-like transcription factor LEAFY PETIOLE [Arabidopsis thaliana] GI:6942018 Length = 211 Score = 28.3 bits (60), Expect = 7.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 566 NPXPPPPPXXPPPXPPPXGXPL 631 +P PPPP PPP PP P+ Sbjct: 91 SPDDPPPP--PPPPAPPSNDPV 110 >At5g11930.1 68418.m01395 glutaredoxin family protein contains INTERPRO Domain IPR002109, Glutaredoxin (thioltransferase) Length = 148 Score = 28.3 bits (60), Expect = 7.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 Query: 575 PPPPPXXPPPXP 610 PPPPP PPP P Sbjct: 23 PPPPPPLPPPAP 34 >At5g03680.1 68418.m00327 trihelix DNA-binding protein, putative similar to DNA-binding protein DF1 [Pisum sativum] GI:13646986 Length = 591 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 636 GXRGXPXGGGXGGGXXGGGGGXG 568 G G GGG G G G GGG G Sbjct: 96 GFSGFLDGGGFGSGVGGDGGGTG 118 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 28.3 bits (60), Expect = 7.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 642 PSGXRGXPXGGGXGGGXXGGGGGXG 568 P G GG G G GGGGG G Sbjct: 83 PQGGSNGGFGGRGGDGAGGGGGGGG 107 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,836,051 Number of Sequences: 28952 Number of extensions: 330187 Number of successful extensions: 10801 Number of sequences better than 10.0: 270 Number of HSP's better than 10.0 without gapping: 1520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5296 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2217402144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -