BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J21 (884 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 26 0.34 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 1.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 7.4 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 9.7 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 26.2 bits (55), Expect = 0.34 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 341 LKAEPRASSRSTESVTPNSSSYANYWKMSIWS 436 +K + S+ ST S T S++Y N SIWS Sbjct: 189 IKPQLHVSTGSTSSPTIASATYTNSANSSIWS 220 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 9 ITTHYREFLRFXLVERCPTGNVAP 80 + HY EF+R+ L E P G V P Sbjct: 400 LENHYEEFVRYELGELAP-GLVGP 422 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 392 NSSSYANYWKMSIWSQKRP 448 NSSS N + +WS+K P Sbjct: 43 NSSSCGNGNRCDLWSEKFP 61 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 372 DLELALGSAFSFLKP 328 D EL SAFS++KP Sbjct: 145 DDELRSSSAFSYIKP 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,916 Number of Sequences: 336 Number of extensions: 1770 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -