BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J19 (849 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc... 27 2.5 SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccha... 26 7.8 >SPBC23E6.07c |rfc1||DNA replication factor C complex subunit Rfc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 934 Score = 27.5 bits (58), Expect = 2.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 540 LNEHHKNRRSSQXXRNPTGL*RYQAV 617 L ++HKNR+S+ P GL Y+AV Sbjct: 387 LQDYHKNRKSNFNKPGPDGLGLYKAV 412 >SPAC57A10.02 |cdr2||GIN4 family protein kinase Cdr2|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.8 bits (54), Expect = 7.8 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = +3 Query: 432 RIRGITQERTCEQKASKRPGTVKRPRCWRFSIGSXPLNEHHKNRRSSQXXRNPT 593 R+ E T + S G+ PR RF++G+ + + N +Q N T Sbjct: 511 RVTSRMSEHTGNRVVSFPRGSAFNPRVTRFNVGNEQFSNNIDNNNYNQPYANAT 564 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,750,283 Number of Sequences: 5004 Number of extensions: 50292 Number of successful extensions: 144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -