BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J16 (865 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 28 0.11 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 7.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 7.1 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 22 7.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 9.4 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 21 9.4 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 27.9 bits (59), Expect = 0.11 Identities = 14/50 (28%), Positives = 27/50 (54%) Frame = -1 Query: 406 SNGLKVARGLQLVDTMALGLAISGTLSNWTLAATTSHTDSEYNITLFSTV 257 +NG+ + R + V T+++ S + N+T A+ S + + Y +LF V Sbjct: 648 TNGIVINRASKRVSTLSIDNVQSTHVGNYTCLASNSASVTTYTTSLFINV 697 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 578 DAWSDFGWSQLP 613 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.1 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 578 DAWSDFGWSQLP 613 D WS F W+ LP Sbjct: 915 DQWSSFYWNLLP 926 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 163 KTHNIAQFFPIQLLNISVGTHLS 95 + H + FPI L ISV T L+ Sbjct: 386 RQHAVTAKFPIYLYRISVETKLN 408 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 74 ARRLPQAAKMGAY 112 ++R+PQ AK GAY Sbjct: 286 SQRVPQLAKNGAY 298 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 459 GLHKILHTSISRLSSWTRHKXIRRDP 536 G+ K+LH I +W + + DP Sbjct: 82 GVRKVLHHLIKNKPNWWQELEAKFDP 107 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,750 Number of Sequences: 336 Number of extensions: 4002 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 23789590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -