BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J15 (877 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyc... 26 8.1 SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe... 26 8.1 >SPBC1703.07 |||ATP citrate synthase subunit 1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 615 Score = 25.8 bits (54), Expect = 8.1 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = -2 Query: 477 EHSLVHVDSGVAXCFVETFKIXGIIEQLEQRDGFFPHFFVKDREFQILGKESDLVHHH 304 ++ +++VD +A CFV+ + G LE+ + + + + + F +LG+ L+ HH Sbjct: 539 DNLILNVDGCIAVCFVDLLRNCGAF-TLEEANEYI-NLGILNGMF-VLGRSIGLIGHH 593 >SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 25.8 bits (54), Expect = 8.1 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = -2 Query: 333 GKESDLVHHHEIFVGFHVCVAVLAGLDVEVLGDFVVLSFIADLVNVVE-KRQNLLLLFDE 157 G S +HHH++ + H + L G EV G L++ +D + + N++ ++D Sbjct: 279 GSRSGAIHHHDVRIANHQ-IGTLQGHSSEVCG----LAWRSDGLQLASGGNDNVVQIWDA 333 Query: 156 RS 151 RS Sbjct: 334 RS 335 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,896,863 Number of Sequences: 5004 Number of extensions: 50383 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 438479610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -