BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J15 (877 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0513 - 16681227-16683936,16685572-16685966 29 3.7 03_01_0527 + 3960982-3961290,3961371-3961464,3961898-3962084,396... 29 6.5 01_06_0203 - 27487469-27489787 28 8.5 >04_03_0513 - 16681227-16683936,16685572-16685966 Length = 1034 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 261 QQGLLHKHESLRKFHDDVQGRIPSQEFGILDLL 359 Q G+LH+ ESL +D+ G IP QE LD L Sbjct: 905 QLGMLHQLESLDLSSNDLSGEIP-QELASLDFL 936 >03_01_0527 + 3960982-3961290,3961371-3961464,3961898-3962084, 3962194-3962449,3962561-3962773,3962856-3962942, 3963089-3963223,3963296-3963409,3963507-3963754, 3963824-3963904,3963979-3964210,3964340-3964438, 3964513-3964701,3964928-3965023 Length = 779 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 742 KPIXSSLVGVSQGNGNRWAYXXNWXVXWXNSGNYNIXSRQGNHP 611 K I +S++ V GN N + + W ++ NY R+GNHP Sbjct: 478 KEIWNSMMLVHWGNTNT-KHKNSTTAYWADNWNYIPIDRRGNHP 520 >01_06_0203 - 27487469-27489787 Length = 772 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 740 LTXPDXCWPKCLLFXNFPSPLYP 808 LT C+PK LLF + SP +P Sbjct: 371 LTGTGVCYPKGLLFNGYKSPAFP 393 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,222,876 Number of Sequences: 37544 Number of extensions: 337369 Number of successful extensions: 666 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -