BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J11 (1242 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 39 0.002 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 38 0.003 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 38 0.004 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 37 0.005 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 37 0.005 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 37 0.007 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 33 0.082 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 31 0.44 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 30 0.58 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 30 0.58 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 29 1.0 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 29 1.0 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 1.3 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 28 2.3 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 27 7.1 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 27 7.1 SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces... 23 8.7 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P P PPP P PP P PP P P P Sbjct: 734 PPPPAVIVPTPAPA-PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 35.1 bits (77), Expect = 0.020 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P P P P P PPP PP PPPPP Sbjct: 734 PPPPAVIVPTPAPAP--IPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.1 bits (72), Expect = 0.082 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 1131 LXPPPXPPP---XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 L PP PPP P P P P PP P P P P Sbjct: 729 LKSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 33.1 bits (72), Expect = 0.082 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPP------XPXPPXXPXXPXXXPXPXXP 1241 S PP P P P P P P PP P PP P P P P Sbjct: 731 SPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 3/46 (6%) Frame = +2 Query: 866 PXPPPPXXX---PRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P PPPP P PP PPPPP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPP 777 Score = 27.5 bits (58), Expect = 4.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 327 PPPPXHNXFXGPPPPP 374 PPPP GPPPPP Sbjct: 764 PPPPPGVAGAGPPPPP 779 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 309 PXXXXXPPPPXHNXFXGPPPPP 374 P P PP GPPPPP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPP 765 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 37.9 bits (84), Expect = 0.003 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P+ PP P P P PP PP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 37.1 bits (82), Expect = 0.005 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S P P P PPP PP P P P P P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 36.3 bits (80), Expect = 0.009 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPX---PPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PP P P PP PP P P P P P P P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 34.3 bits (75), Expect = 0.036 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP S PP P P PP PP P P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVP 1744 Score = 30.7 bits (66), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPX--PPPXPXPPXPPXPXP 1193 PPP PP P P PP PPP P P P P Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 29.5 bits (63), Expect = 1.0 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPXTXPPAP--XPXPVXPXXPPPP 884 PPP + PP P P P P PPP Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P PPP PPPP P PP PPPP P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAG------------PPSAPPPPLP 1736 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-----PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + P P P P P P PP P PP P P P Sbjct: 1448 PPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLPPAVPNVPVPSMIP 1499 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP + PP P P P P P Sbjct: 1715 PPPPSAPPMPAGPPSAPPPPLP 1736 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 37.5 bits (83), Expect = 0.004 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PP P P P P P PP P P P P P Sbjct: 150 PPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVP-PMPP 199 Score = 33.9 bits (74), Expect = 0.047 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXP--XPPXP--PXPXPPXXPXXPXXXPXPXXP 1241 A PP P L PP PP P PP P P P P P P P P Sbjct: 120 ASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP 177 Score = 33.1 bits (72), Expect = 0.082 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PP P P PP P P P PP P P Sbjct: 165 PPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 32.7 bits (71), Expect = 0.11 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPX-PPXXPXXPXXXPXP 1232 PP PP PPP P P P P P P P P P Sbjct: 158 PPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Score = 31.9 bits (69), Expect = 0.19 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P PP P PP P P P P P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP-PSAP 188 Score = 29.9 bits (64), Expect = 0.77 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +3 Query: 1095 PPXXXSXPPXX----PLXPPPXPPPXPX--PPXPPXPXPPXXPXXP 1214 PP S PP P+ PP P P PP PP PP P Sbjct: 165 PPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P PPP PP PP P P P Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 P P + PP P P P PPP Sbjct: 152 PSPASAPPIPSKAPPIPSSLPPP 174 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 S PP P PPP PPP PP P P PP Sbjct: 3 SLPPGNP--PPPPPPPGFEPPSQPPPPPP 29 Score = 31.1 bits (67), Expect = 0.33 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP 1172 PP PP P PP PP P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.1 bits (67), Expect = 0.33 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 1137 PPPXPPPXPXPP--XPPXPXPPXXP 1205 PP PPP P PP PP PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PP PP P P P PPPP Sbjct: 2 ASLPPGNPPPPPPPPGFEPPSQPPPP 27 Score = 28.3 bits (60), Expect = 2.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 9 PPPPPPPPGFEP-PSQPPPPPPP 30 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXP 1205 L P PPP P P P PP P Sbjct: 4 LPPGNPPPPPPPPGFEPPSQPPPPP 28 Score = 27.1 bits (57), Expect = 5.4 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP P P P PP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPP PP P P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPP 27 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PP PP P P P P P Sbjct: 5 PPGNPPPPPPPPGFEP--PSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 9.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP 1157 PPP P P PPP PPP Sbjct: 11 PPPPPPGFEP--PSQPPPPPPP 30 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 37.1 bits (82), Expect = 0.005 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ P PP P P P P P P P P P Sbjct: 428 PPSLPPSAPPSLPMGAPAAPPLPPSAPIAP-PLPAGMPAAPPLPPAAPAP 476 Score = 33.1 bits (72), Expect = 0.082 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXX-PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 A PP S PP P P PPP P P PP P P Sbjct: 229 APPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRP 274 Score = 32.3 bits (70), Expect = 0.14 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXPXP 1193 PP PP P PP PP P PP P P P Sbjct: 450 PPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 31.5 bits (68), Expect = 0.25 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A PP S P+ PP PP P PP P P P P Sbjct: 400 APALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLP 450 Score = 31.1 bits (67), Expect = 0.33 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 1095 PPXXXSXP--PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP S P P P P PP P P PP P P P P Sbjct: 447 PPLPPSAPIAPPLPAGMPAAPPLPPAAPAPP-PAPAPAPAAP 487 Score = 30.3 bits (65), Expect = 0.58 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P PP P P P P P P P Sbjct: 420 PPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMP 464 Score = 30.3 bits (65), Expect = 0.58 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 10/57 (17%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP---PXPPPXP--XPPXPPXP-----XPPXXPXXPXXXPXP 1232 PP S PP P P P PP P P PP P PP P P P P Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAP 480 Score = 29.9 bits (64), Expect = 0.77 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P + P P PP PP P P PP P P P P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLP 460 Score = 28.3 bits (60), Expect = 2.3 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPP----PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P R PP PPPP PP PPP P Sbjct: 313 PPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPST 372 Query: 980 XXXPP 994 PP Sbjct: 373 GRQPP 377 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P PPP P P PP P P P Sbjct: 376 PPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPP 425 Score = 27.9 bits (59), Expect = 3.1 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 6/54 (11%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPP------PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P PP P PP P P P P P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAP 277 Score = 27.1 bits (57), Expect = 5.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 PXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 P PP Q PP PP P TG PP Sbjct: 352 PLPP--QGRSAPPPPPPRSAPSTGRQPPP 378 Score = 27.1 bits (57), Expect = 5.4 Identities = 17/63 (26%), Positives = 17/63 (26%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP--PXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P P PP P PP P P P PP P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Query: 986 XPP 994 PP Sbjct: 475 APP 477 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/43 (32%), Positives = 14/43 (32%), Gaps = 1/43 (2%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPR-XXXXXXXXXXXXXXXPPXPPP 961 P P PPP PP PR PP PPP Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPP 295 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-----PPXPPPXPXPPXPPXPXP 1193 PPP + PL P PP PPP P P P Sbjct: 340 PPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPP 378 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 36.7 bits (81), Expect = 0.007 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G G GGG GG G GG GG Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGG 49 Score = 35.9 bits (79), Expect = 0.012 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGX-GGXGGXGXGGGXGG--GXRGXXGGXEXXXGG 1094 G G G GG G GG G GGG GG G RG GG GG Sbjct: 13 GSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGG 59 Score = 32.3 bits (70), Expect = 0.14 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GG GG G G RG GGG G RGG GRG G GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGG-RGGARGGRGGRGGARGGRGG 59 Score = 29.5 bits (63), Expect = 1.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -3 Query: 1180 GGXGGXGXG-GGXGGGXRGXXGGXEXXXGGGXXXA 1079 GG GG G GG GG G GG GGG A Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGA 43 Score = 27.9 bits (59), Expect = 3.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G G G GG GG G Sbjct: 33 GGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 33.1 bits (72), Expect = 0.082 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PPP P + PP PPP PP P P P P P P Sbjct: 1192 PPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 32.3 bits (70), Expect = 0.14 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P+ PP PP P P P PP P P P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLP 1227 Score = 31.5 bits (68), Expect = 0.25 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPX-PPXPXPPXXPXXP 1214 A P P S P PL P PP P P PP P P P P Sbjct: 1009 ARVPPVPKLSSKAPPVPL-PSADAPPIPVPSTAPPVPIPTSTPPVP 1053 Score = 30.7 bits (66), Expect = 0.44 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP L P P P PP P P P P P P Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVP 1053 Score = 29.9 bits (64), Expect = 0.77 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP PP P P P PPP Sbjct: 1192 PPPSEAPPVPKPSVGVPPVPPP 1213 Score = 29.1 bits (62), Expect = 1.3 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 P P S PP P PPP P P P P P P P P P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVP 1095 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP T PP P P P P P Sbjct: 1211 PPPSTAPPVPTPSAGLPPVPVP 1232 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P P + P P + PP P P PP P P P P P P Sbjct: 1095 PKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVP 1143 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P P P + PP P P PP P P P P P P Sbjct: 1115 PAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 A P P + P P PP P P PP P P P P Sbjct: 1120 APPVPKPSVAAPPVPVPSGAPPV--PKPSVAAPPVPAPSGAPPVP 1162 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXP 1214 PP S P P PP P P PP P P P P Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVP 1124 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A P P + P P PP P P P P P P P P Sbjct: 1139 APPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVP 1192 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A P P + P P PP P P PP P P P P P Sbjct: 1021 APPVPLPSADAPPIPVPSTAPPVPIPTSTPPVP--KSSSGAPSAPPPVPAP 1069 Score = 27.5 bits (58), Expect = 4.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 P P S P P PP P PP P P P P P P Sbjct: 1170 PVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 27.1 bits (57), Expect = 5.4 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 A P P + P P P P P P PP P P P P Sbjct: 1158 APPVPKPSVAAPPVPAPSSGIP-PVPKPAAGVPPVPPPSEAPPVP 1201 Score = 26.6 bits (56), Expect = 7.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX-PPXPXPP-XXPXXPXXXPXPXXP 1241 PP S P P P PP P P PP P P P P P P Sbjct: 1112 PPVPAPSGAPPVP-KPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Score = 26.6 bits (56), Expect = 7.1 Identities = 17/60 (28%), Positives = 18/60 (30%), Gaps = 6/60 (10%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXP------PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A P P P + PP P PP P P P PP P P P Sbjct: 1149 APPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVP 1208 Score = 26.2 bits (55), Expect = 9.4 Identities = 13/39 (33%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPP-XPPXPXP 1193 A PPP + P PP P P PP P P Sbjct: 1059 APSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKP 1097 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 30.7 bits (66), Expect = 0.44 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXX--GGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G GG G G GG G GG GG G GG Sbjct: 146 GRGGSRGGFGGNSRGGFGGGSRGGFG-GGSRGGSRGGFRGG 185 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG GG GG G G GGG Sbjct: 133 GPAGRGGRGGFR--GGRGGSRGGFGGNSRGGFGGG 165 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 30.3 bits (65), Expect = 0.58 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P PPP P PP PPPP P PP Sbjct: 229 PKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 29.5 bits (63), Expect = 1.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P P PP PP P P P P Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +2 Query: 875 PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PPP P PP PPPPP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 Score = 23.8 bits (49), Expect(2) = 4.9 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PP P PPP PP P Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLP 247 Score = 21.4 bits (43), Expect(2) = 4.9 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +3 Query: 1149 PPPXPXPPXPPXP 1187 PPP P PP P Sbjct: 273 PPPPATPSQPPRP 285 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 30.3 bits (65), Expect = 0.58 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXGRGXXCXGXG 814 G G GG GG G G G G GGG G GG G G G G Sbjct: 203 GPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFG 262 Query: 813 GXP 805 G P Sbjct: 263 GGP 265 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 29.5 bits (63), Expect = 1.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A +P PP P P P PPPP Sbjct: 722 AIKPQVTPAPPTPAPTPAVKHHPPPP 747 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 29.5 bits (63), Expect = 1.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A P P P P P PP P P P P PP P P P P Sbjct: 571 ALSVPQPPVAPVAPEVPSVPQPPVAPV--VPEAPSVPQPPVAPVAPEVPSVPQRP 623 Score = 28.3 bits (60), Expect = 2.3 Identities = 15/50 (30%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP-XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + PP P P P P P P P P P P Sbjct: 517 PPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVP 566 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 29.1 bits (62), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXP--PXPXPPXXPXXP-XXXPXPXXP 1241 P P P PP P P P P P P P P P P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEP 139 Score = 28.3 bits (60), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP--PXPXPPXXPXXP 1214 PP P PL P PP P P P P P P P P Sbjct: 107 PPLPNEPVPEEPL---PGEPPLPDEPVPEEPLPGEPPLPNEP 145 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 28.3 bits (60), Expect = 2.3 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-----PXXPXXPXXXPXPXXP 1241 P P P PP PP PP P P P P P P P P Sbjct: 507 PIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIPGATAPPGAP 561 Score = 27.9 bits (59), Expect = 3.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP PL P P P P P P P P P Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAP 538 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P PP PP P P P P P Sbjct: 484 PFIPGTSAPLPPTTFAPPGVPLPPIPGAPGMP 515 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 26.6 bits (56), Expect = 7.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 1137 PPPXPPPXPXPPXP 1178 PPP P P P PP P Sbjct: 806 PPPAPLPPPAPPLP 819 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 216 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 250 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 229 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 263 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 242 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 255 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 289 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 268 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 281 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 294 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PPP H PPPP Sbjct: 307 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 23.4 bits (48), Expect(2) = 8.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 944 PPXPPPPP 967 PP PPPPP Sbjct: 370 PPPPPPPP 377 Score = 21.0 bits (42), Expect(2) = 8.7 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP P P Sbjct: 371 PPPPPPPELLNHSP 384 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,039,094 Number of Sequences: 5004 Number of extensions: 37412 Number of successful extensions: 895 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 2,362,478 effective HSP length: 74 effective length of database: 1,992,182 effective search space used: 675349698 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -