BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J11 (1242 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 64 2e-10 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 52 1e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 51 2e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 51 2e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 49 7e-06 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 48 2e-05 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 47 3e-05 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 46 6e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 46 8e-05 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 45 1e-04 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 45 1e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 45 1e-04 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 44 3e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 43 4e-04 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 6e-04 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 42 0.001 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 42 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 42 0.001 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 41 0.002 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 41 0.002 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 41 0.002 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 40 0.004 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 40 0.004 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 40 0.004 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 40 0.004 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.005 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 40 0.005 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 40 0.005 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 40 0.005 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 39 0.007 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 39 0.009 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 39 0.009 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 38 0.013 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 38 0.017 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.017 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.022 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 38 0.022 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 38 0.022 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.022 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.029 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.029 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 37 0.029 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 37 0.029 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 37 0.038 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 37 0.038 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 37 0.038 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 37 0.038 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.038 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 0.051 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 36 0.051 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.067 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 36 0.067 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 36 0.067 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.067 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.089 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 36 0.089 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 36 0.089 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 36 0.089 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 36 0.089 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 36 0.089 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 35 0.12 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 35 0.12 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 35 0.12 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.12 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.14 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 35 0.15 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 35 0.15 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.15 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.20 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 34 0.20 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.20 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 34 0.20 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 34 0.20 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 34 0.27 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 34 0.27 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 34 0.27 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 34 0.27 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 34 0.27 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 33 0.36 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 33 0.36 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.36 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.36 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) 33 0.47 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 33 0.47 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.59 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.62 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.62 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 33 0.62 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.62 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.62 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.62 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 33 0.62 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 32 0.82 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 32 0.82 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 32 0.82 SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) 32 1.1 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) 31 1.4 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 31 1.4 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.4 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 31 1.4 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 31 1.9 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 31 1.9 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 31 1.9 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 31 2.5 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 31 2.5 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27) 31 2.5 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 2.5 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 2.5 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.5 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 30 3.3 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 30 3.3 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 30 3.3 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 30 3.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.2 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 30 4.4 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.4 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 30 4.4 SB_30560| Best HMM Match : Herpes_UL73 (HMM E-Value=4.5) 30 4.4 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 30 4.4 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 30 4.4 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 30 4.4 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 30 4.4 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.4 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 30 4.4 SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) 30 4.4 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.4 SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) 30 4.4 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 30 4.4 SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.4 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.5 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 5.8 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 29 5.8 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 29 5.8 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 29 5.8 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 29 5.8 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 5.8 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 29 5.8 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 5.8 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 5.8 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 7.7 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 29 7.7 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 29 7.7 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 7.7 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 7.7 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.7 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 29 7.7 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 7.7 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 29 7.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 64.1 bits (149), Expect = 2e-10 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP PP P PP P P P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 63.7 bits (148), Expect = 3e-10 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP PP P PP P P P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 61.7 bits (143), Expect = 1e-09 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP PPP P PP PP P PP P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 61.3 bits (142), Expect = 2e-09 Identities = 24/49 (48%), Positives = 24/49 (48%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP PPP P PP PP P PP P P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 61.3 bits (142), Expect = 2e-09 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP P PPP P PP PP P PP P P P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 60.5 bits (140), Expect = 3e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP P P PP P P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 60.5 bits (140), Expect = 3e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PP P PP PP P PP P P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 60.5 bits (140), Expect = 3e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P P PP PP P PP P P P P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 60.5 bits (140), Expect = 3e-09 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P P PPP P PP PP P PP P P P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 55.2 bits (127), Expect = 1e-07 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP P PPP PP P PP PP P PP P P P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 51.2 bits (117), Expect = 2e-06 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPPP P PP PPPPP P P Sbjct: 365 PPPPP---PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Query: 992 P 994 P Sbjct: 422 P 422 Score = 50.0 bits (114), Expect = 4e-06 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PP P P+ PP PPPPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 992 P 994 P Sbjct: 426 P 426 Score = 49.6 bits (113), Expect = 5e-06 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P P PP P PP PPPPP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 49.2 bits (112), Expect = 7e-06 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPP P PP PPPP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 992 P 994 P Sbjct: 428 P 428 Score = 49.2 bits (112), Expect = 7e-06 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PP P P PP PPPP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 992 P 994 P Sbjct: 432 P 432 Score = 48.8 bits (111), Expect = 9e-06 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP P PPPP P PP PPP P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 992 P 994 P Sbjct: 429 P 429 Score = 48.8 bits (111), Expect = 9e-06 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP PPPP P PP PP PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 992 P 994 P Sbjct: 430 P 430 Score = 48.8 bits (111), Expect = 9e-06 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPP P PP P PPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 992 P 994 P Sbjct: 431 P 431 Score = 48.4 bits (110), Expect = 1e-05 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 + PPP PPP P PP PP P PP P P P P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 48.0 bits (109), Expect = 2e-05 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P P PPPP P PP PPPPP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 Query: 992 P 994 P Sbjct: 441 P 441 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPP 387 Score = 35.5 bits (78), Expect = 0.089 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P PPP PPP P P PP Sbjct: 408 PPPPPPPPPPPAP-PPPPPPPPPPPPALRLACAPP 441 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP PPAP P P P PPP Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.27 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 1090 PPPPXXXXXXXXXXXXXXXXXXXXXXXPXPPPPXPPXXPXXPXXXPXPPXL 1242 PPPP P PPPP P P P P PP L Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 31.9 bits (69), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P SP P PP PPPP PPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PP PPPP PPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 30.3 bits (65), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 30.3 bits (65), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 30.3 bits (65), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P P PP PPPP PPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/49 (46%), Positives = 23/49 (46%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP PPP P PP PP P PP P P P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPP-PNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 52.4 bits (120), Expect = 7e-07 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP PP P PP P P P P P Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP-NPPYPPPPNAP 229 Score = 51.6 bits (118), Expect = 1e-06 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PP P PP PP P PP P P P P P Sbjct: 167 PPPPNAPYPP--PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP-PYPP 213 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 8/58 (13%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-------PXPXPPXPPXPXPPXXPXXP-XXXPXPXXP 1241 PPP PP P PPP PP P P PP PP P PP P P P P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 50.0 bits (114), Expect = 4e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P P P P PP P P P P P Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 49.6 bits (113), Expect = 5e-06 Identities = 37/144 (25%), Positives = 37/144 (25%), Gaps = 2/144 (1%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PP P P P P P PPPP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPP--PXPXP 1169 A PPP PP P PPP PP P P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP--PPNPPYPPPPNPPYPPPPNA 201 Query: 1170 PXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P PP P P P P P Sbjct: 202 PNPPPPNPPYPP--PPNAPNPPYP 223 Score = 48.0 bits (109), Expect = 2e-05 Identities = 35/141 (24%), Positives = 35/141 (24%), Gaps = 4/141 (2%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PPP P P P P P P PP PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXX--PLXPPPXPP--PXP 1163 PPP PP P PPP PP P P Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Query: 1164 XPPXPPXPXPPXXPXXPXXXP 1226 P PP P PP P P P Sbjct: 216 NAPNPPYPPPPNAPNPPYPPP 236 Score = 48.0 bits (109), Expect = 2e-05 Identities = 34/138 (24%), Positives = 35/138 (25%), Gaps = 1/138 (0%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXP-PPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 PPP PP P P P P PPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 P PPP + PP P PPP P P PP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP--PNAPNPP 221 Query: 1173 XPPXPXPPXXPXXPXXXP 1226 PP P P P P P Sbjct: 222 YPPPPNAPNPPYPPPPNP 239 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPPP PP PPPP P P Sbjct: 177 PPYPPPPNP-PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Query: 992 P 994 P Sbjct: 236 P 236 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXX 985 PP P + P P PPP P PPPP PP P P PP P Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPY 156 Query: 986 XPP 994 PP Sbjct: 157 PPP 159 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP----PXPXX 979 PP P P P PP P PPP P PP PPPP P P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Query: 980 XXXPP 994 PP Sbjct: 201 APNPP 205 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P P PPP P PPPP P PP P PP P P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPP-PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Query: 992 P 994 P Sbjct: 214 P 214 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP P PPPP PP PPPP P P Sbjct: 168 PPPNAPYPPPPYPPPPNPPYPPPPNPP---YPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Query: 992 P 994 P Sbjct: 225 P 225 Score = 37.1 bits (82), Expect = 0.029 Identities = 29/118 (24%), Positives = 29/118 (24%), Gaps = 1/118 (0%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G PP P PPP PPPP P PP PP PP P Sbjct: 82 GHPPTNFSPNPPYPPPPYPP-YPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY 140 Query: 986 XP-PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPP 1156 P P PP PP P PPP Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP-PPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P P PP P PP PP P PP PPPP Sbjct: 188 PPPPNP--PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 31.1 bits (67), Expect = 1.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 807 AXRPPPXTXPP--APXPXPVXPXXPPPP 884 A PPP PP P P P P PPPP Sbjct: 172 APYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP P P P P PPPP Sbjct: 201 APNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P SP P + PP PPPP + PP PP Sbjct: 85 PTNFSP-NPPYPPPPYPPYPPPPPYPPPPNPPYPP 118 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P P P P + PP PPPP N PPP P + Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPP--NAPNPPPPNPPY 211 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 51.6 bits (118), Expect = 1e-06 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GGG G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 51.2 bits (117), Expect = 2e-06 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GGG G GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 50.0 bits (114), Expect = 4e-06 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G GG GG G GGG GGG G GG G G A Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGA 707 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GGG G G G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GGG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 46.8 bits (106), Expect = 4e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G GG GG G GGG GGG G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 36.7 bits (81), Expect = 0.038 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG GG G GGGG G GGG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGG--------GGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 33.9 bits (74), Expect = 0.27 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGGG GG G GGGG G GGG G G G GG Sbjct: 660 GDGGGGGGGGGGG-------------GGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGG 680 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGG 683 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGG 684 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGG 685 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGG 686 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGG 687 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGG 688 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGG 689 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGG 690 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGG 691 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGG 692 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGG 693 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGG 694 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGG 695 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGG 696 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGG 697 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGG 698 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGG 699 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGG 701 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 682 GGGGGGGGGGGGGGGGGGGGAG 703 Score = 31.1 bits (67), Expect = 1.9 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G G GG GGG A Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGGGA 702 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGG 686 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G G GG G G A Sbjct: 684 GGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GAGG G G Sbjct: 688 GGGGGGGGGGGGGGAGGAGAGAG 710 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXAXXXA 794 GGGG G G G G GG GG A A Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GG G G Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAG 708 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 51.2 bits (117), Expect = 2e-06 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP P PPP PPP P PP PP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 49.2 bits (112), Expect = 7e-06 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PPP P PP PP P PP P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 48.0 bits (109), Expect = 2e-05 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P PPP PPP P PP PP P PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 46.8 bits (106), Expect = 4e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PPP PP P PPP PPP P PP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP-PPPPTP 496 Score = 45.6 bits (103), Expect = 8e-05 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP P PP PP P PP P P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.1 bits (87), Expect = 0.007 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPP-PXPXPPXP 1178 A PPP PP P PPP PP P P PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.7 bits (81), Expect = 0.038 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 36.7 bits (81), Expect = 0.038 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P PPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 G P P P P PPP P PPPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 32.7 bits (71), Expect = 0.62 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P PPP P PPPP PP PPPPP P PP Sbjct: 464 PPPPPPPPPPPPPP--------------------PPPPPPPPPPFPPPPPP 494 Score = 32.3 bits (70), Expect = 0.82 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P P PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXF 380 PP PPPP PPPPP F Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPF 488 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P P PP Sbjct: 474 PPPPPP-PPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P P PP PPPP F PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG G G G GG GGG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 50.0 bits (114), Expect = 4e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G GGG GGG G GG GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG 814 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GGG G G GGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GG G G GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G G G GGG G GG GGG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G GGG GGG G GG GGG Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 46.8 bits (106), Expect = 4e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G G G GGG G GG GGG Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF-GDGGGYADGDGGG 849 Score = 46.4 bits (105), Expect = 5e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GGG GG GGG Sbjct: 774 GDGGDGGGGGDGG--GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 45.6 bits (103), Expect = 8e-05 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GGG G GG G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 45.2 bits (102), Expect = 1e-04 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG GG G G GGGG G GGG G G G G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Query: 813 G 811 G Sbjct: 872 G 872 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G G GG G GGG GGG G G G G A Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYA 843 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX--GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GGG G GG GGG Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GG G GGG GGG G GG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGG 813 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GGG GGG G G GGG Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 43.2 bits (97), Expect = 4e-04 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG--GXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GG G GGG GG GGG Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 42.7 bits (96), Expect = 6e-04 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG GG G GGG GGG G G + GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGG-GGGGGGGDGGGYGDGDGGGGGG 817 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G G GGG GGG G GG G G Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GGG G G GG GGG Sbjct: 812 GGGGGGGGGGGGGGDGG-GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX----GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G G GGG G GG GGG Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 39.5 bits (88), Expect = 0.005 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG G G G GGGG G GGG G G G G Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Query: 813 G 811 G Sbjct: 876 G 876 Score = 39.1 bits (87), Expect = 0.007 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG GG G G GGGG G GGG G G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGY-GDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Query: 813 G 811 G Sbjct: 835 G 835 Score = 37.5 bits (83), Expect = 0.022 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG GG G G GGGG G GGG G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGD--GDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 813 G 811 G Sbjct: 837 G 837 Score = 37.1 bits (82), Expect = 0.029 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG GG G GGGG G GGG G G G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGG------------GGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Query: 813 G 811 G Sbjct: 818 G 818 Score = 33.9 bits (74), Expect = 0.27 Identities = 32/124 (25%), Positives = 32/124 (25%) Frame = -2 Query: 1235 GGXGXXXGXXGXXGGXGGGGXGXXXXXXXXXXXXXGXPGGXGXXXGGGGXXXXXXXXXXX 1056 GG G G G GG GGGG G GG G GGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGG----------------GGGGGGGGGGGGDGGGYGDGDG 812 Query: 1055 XXXXXXXXXXXXXXXXXXXXXXXGXXXXXXXXXXXXXXXXXXGGRGXGGGGXGXXXXXGG 876 GG G GGGG G GG Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Query: 875 GGXG 864 GG G Sbjct: 873 GGGG 876 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGG 801 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGG 802 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGG 821 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.2 bits (112), Expect = 7e-06 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP---XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PP PPP P PP PP PP P P P P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 47.6 bits (108), Expect = 2e-05 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + P P PP P PPPP P PPPPP P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 992 P 994 P Sbjct: 407 P 407 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX----PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PPP PP PP PP P P P P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 44.0 bits (99), Expect = 3e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX-PPPXPPPXPXPPXPPXP-XPPXXPXXPXXXP 1226 PPP PP P PPP PPP PP PP P P P P P Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 42.7 bits (96), Expect = 6e-04 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPPXPXXX 982 PP P + P P PP P PPPP P PP PP PPP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGP-----PPPPPPTNGPPPPPPPTNGPPPPPPPT 411 Query: 983 XXPP 994 PP Sbjct: 412 NGPP 415 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P P PPP P P P P PP P P P Sbjct: 366 PPPPPTNKPPPPP-PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 34.3 bits (75), Expect = 0.20 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPP 1181 P P PPP PPP PP PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP N GPPPPP Sbjct: 369 PPTNKPPPPPPPTN---GPPPPP 388 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP N GPPPPP Sbjct: 379 PPTNGPPPPPPPTN---GPPPPP 398 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP N GPPPPP Sbjct: 389 PPTNGPPPPPPPTN---GPPPPP 408 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPP 883 G PP P P PPP PPPP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPP 380 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPP 390 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPP 400 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 388 PPPTNGPPPPPPPTNGPPPPPPP 410 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 49.2 bits (112), Expect = 7e-06 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P + PP P PPP PPP P PP P P PP P P P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPP--PPPPPSPPRP 240 Score = 48.8 bits (111), Expect = 9e-06 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP--PXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP PP P P P P P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 46.0 bits (104), Expect = 6e-05 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP---PXPXPPXXPXXPXXXPXP 1232 PP PP P P P PPP P PP P P PP P P P P Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXP 1214 P PP P PP PPP P P P PP P PP P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P PPPR P PPPP P PP PPPPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPP-------------SPSPPRPPPPPPP 235 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPX---PPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P P PPP P PPPP PR PP PPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 38.3 bits (85), Expect = 0.013 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 RPPP PP P P P P PPPP Sbjct: 210 RPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 35.5 bits (78), Expect = 0.089 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 9/50 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP---------PXPXPPXPPXPXPPXXPXXP 1214 PPP PP P PPP PP P P P PP PP P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P PP PP PP P P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 29.9 bits (64), Expect = 4.4 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P + PPPP P PP PPPPP P PP Sbjct: 195 PTSPSQITQPPPPPPRPP--------------PSPPPPPPPPSPSPPRPPP 231 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P PP PPPP + PPPPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P PP PPPP PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 48.0 bits (109), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G GG GGG G GG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 47.2 bits (107), Expect = 3e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GGG GGG G GG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 45.6 bits (103), Expect = 8e-05 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G G G G G G GGG G GG GGG A Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRA 116 Score = 38.3 bits (85), Expect = 0.013 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGR 838 GG G GGGGG GG G G GGG G GGG GR Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 34.7 bits (76), Expect = 0.15 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGGG GG G GGG G GGG G G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDG---GGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDG 93 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 90 GGDGGGGGGGGDGGGGGGGGGG 111 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GGG GGG RG G GGG Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 1/50 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGG 1094 G G G G GG G G GG G GGG G GG G GG GG Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGG 171 Score = 39.9 bits (89), Expect = 0.004 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G G G G G GG G RGGG G G G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Query: 813 G 811 G Sbjct: 187 G 187 Score = 33.5 bits (73), Expect = 0.36 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G G GG G GG G RG G GG G G G GRG G G Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 33.5 bits (73), Expect = 0.36 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G G G GGG G RG GG G G GGG GRG GG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEG-GGGRGRGTGGGSRGG 192 Score = 33.5 bits (73), Expect = 0.36 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG GG RG GGGG G GGG RG G G Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGG-----RGGGEGGGGRGRGTGGG-SRGGGGDGRG 198 Score = 32.3 bits (70), Expect = 0.82 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G GG G GG G GG GGG G G Sbjct: 161 GWGGRGGNGGGRG--GGEGGGGRGRGTGGGSRGGGGDGRGRG 200 Score = 30.3 bits (65), Expect = 3.3 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRG 257 GG GG R + GGG G GGG GG+ G RG G RG Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRG---GGEGGGGRGRGTGGGSRG 191 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 47.2 bits (107), Expect = 3e-05 Identities = 23/54 (42%), Positives = 24/54 (44%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP + P P PPP PP PP PP P PP P P P P P Sbjct: 61 APAAPPPPAAA--PAAP--PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 40.3 bits (90), Expect = 0.003 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXX---PLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXP 1226 A PP + PP P PPP PPP P PP PP P P P P P Sbjct: 63 AAPPPPAAAPAAPPPPAAPPAAPPP-PPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP P PPP P PP PP P P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAP----PAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Query: 992 P 994 P Sbjct: 110 P 110 Score = 37.9 bits (84), Expect = 0.017 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP------XPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PP P P PP PP PP P P P P P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 37.1 bits (82), Expect = 0.029 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P PP PPPP P PP P PPP P P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 795 AXXXAXRPPPXTXPPAPXPXPVXPXXPPPP 884 A A PPP P AP P P P PPPP Sbjct: 69 AAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 795 AXXXAXRPPPXTXPPAPXPXPVXPXXPPPP 884 A A PPP P AP P P PPPP Sbjct: 59 AAAPAAPPPPAAAPAAPPPPAAPPAAPPPP 88 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PAP P P P PPP Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPP 107 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 47.2 bits (107), Expect = 3e-05 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P PP P PPP PPP P PP P P PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 44.0 bits (99), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PP P PPP PPP P P PP P P P P Sbjct: 683 PPP-----PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 43.6 bits (98), Expect = 3e-04 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 P + PPP PPP P PP PP P P P P P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 42.3 bits (95), Expect = 8e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP P PP PP P PP P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPPP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPP 709 Score = 34.7 bits (76), Expect = 0.15 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP+ PPPP P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 34.3 bits (75), Expect = 0.20 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 + P P P PP PP P PP P P P P Sbjct: 673 ILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 33.9 bits (74), Expect = 0.27 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P P+ P P PP PP P PP P P P P P Sbjct: 664 SVNPSIPIQILPIPIQTMVPPPPP-PPPPPPPPPPPPPPQPSTP 706 Score = 33.9 bits (74), Expect = 0.27 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P PPP PP P P P Sbjct: 691 PPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 33.5 bits (73), Expect = 0.36 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PP P PPPP P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 32.7 bits (71), Expect = 0.62 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P PPP P PPPP P+ PP PPP P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQ------------PSTPPPPPPSTPPVQQSGAP 722 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P P PPP P PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 30.3 bits (65), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P P P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 29.5 bits (63), Expect = 5.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXR-GXXGGXEXXXGGG 1091 G GG G GG GG GG G GG GG Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 610 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXR-GXXGGXEXXXGGG 1091 G GG G GG GG GG G GG GG Sbjct: 598 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -3 Query: 1204 GXXGGXGXGGX-GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG GG GG GG G GG G Sbjct: 606 GNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 47.2 bits (107), Expect = 3e-05 Identities = 21/38 (55%), Positives = 21/38 (55%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GG G GGG GGG G GG GGG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 46.0 bits (104), Expect = 6e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G GGG G G G GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 41.9 bits (94), Expect = 0.001 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GGG GG GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG-----GGFGGGGGGG 126 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXG 1118 G G G G GG G GG GG G G GG GGG G G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 33.9 bits (74), Expect = 0.27 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGGG GG G GGGG G GGG G G G GG Sbjct: 86 GFGGGGGFGGGGG-------------GGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFG 110 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGG 118 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 105 GGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 107 GGFGGGGGGGGGFGGGGGGGFG 128 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GGRG G GG G GGGG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFG 102 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 46.0 bits (104), Expect = 6e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG GG G GG GGG Sbjct: 165 GRGGGGYGGGGYGG-GGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GG GG GGG Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G G GG GGG G GG G G Sbjct: 160 GYRGRGRGGGGYGG-GGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYG 209 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GG G GG GG Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 39.1 bits (87), Expect = 0.007 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G G G GGG G G GGG Sbjct: 179 GGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G G GGG GG GG Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 37.5 bits (83), Expect = 0.022 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG GG G RG GGGG G GG G G G G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Query: 813 G 811 G Sbjct: 190 G 190 Score = 37.5 bits (83), Expect = 0.022 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G G GGG G G GGG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 37.1 bits (82), Expect = 0.029 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G G GGG RG G GGG Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 36.3 bits (80), Expect = 0.051 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG----GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G G GG GGG G G GGG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 35.9 bits (79), Expect = 0.067 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 GG G GGGG GG G G GGGG G R GG G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 35.5 bits (78), Expect = 0.089 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG G RG G GGG Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGG 179 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GG GGG G G GGG Sbjct: 141 GYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 33.5 bits (73), Expect = 0.36 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGG--XGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GGG GGG RG GG GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRG--GGGYRGGGGG 160 Score = 32.7 bits (71), Expect = 0.62 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGG-GXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGX 817 GG G GGGG G GG G G GGG G G G G G G Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Query: 816 G 814 G Sbjct: 218 G 218 Score = 32.3 bits (70), Expect = 0.82 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGX-GGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGX 817 GG G GGG GG G GGGG G GG G G G Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGG 193 Query: 816 GG 811 GG Sbjct: 194 GG 195 Score = 31.9 bits (69), Expect = 1.1 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXG-XXRGGGXGRGXXCXGX 817 GG G GGGG G G G GGGG G GGG G G Sbjct: 140 GGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Query: 816 GG 811 GG Sbjct: 200 GG 201 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 194 GGYGGGGGGYGGSGYGGGGGYG 215 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 182 GGGGHGGGGYGGGGYGGGGG 201 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 880 GGGXXGXTGXGXGAGGXVXGGG 815 GGG G G G G GG GGG Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGG 218 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GG G G GGGG G Sbjct: 199 GGGGYGGSGYGGGGGYGGGGYG 220 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 45.6 bits (103), Expect = 8e-05 Identities = 20/35 (57%), Positives = 20/35 (57%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G GG GG G GGG GGG G GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 G G G GG G GG GG G GGG GGG G G E G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG G GG GG G GGG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G GG GG G GGG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G GG GG G GGG GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 42.7 bits (96), Expect = 6e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G GG GG G GGG GGG G GG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGG 153 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGG 154 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGG 155 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGG 156 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGG 157 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGG 158 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGG 159 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGG 160 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGG 161 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGG 162 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGG 164 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGG 165 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 147 GGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S P P P P PP P PP PP P P P P P P P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHP 227 Score = 43.2 bits (97), Expect = 4e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P PP P P PP P P PP P P P P Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIP 230 Score = 38.3 bits (85), Expect = 0.013 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 1092 PPPXXXSXPP------XXPLXPPPXPP---PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S PP P PP PP P PP PP P P P P P P P Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 37.9 bits (84), Expect = 0.017 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P L P PP PP PP P P P P P P P Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Score = 37.5 bits (83), Expect = 0.022 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P PP PP P PP P P P P P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIP 221 Score = 37.1 bits (82), Expect = 0.029 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +3 Query: 1080 AXXXPPPXXXSXPP--XXPLXPPPXPPP--XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P PP P P P PP P P PP P P P P P Sbjct: 241 ATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP-NPSIPLAPPNPYIP 297 Score = 36.7 bits (81), Expect = 0.038 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP P P PP P P P P P P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAP 300 Score = 36.3 bits (80), Expect = 0.051 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P+ PP PP P P P P P P P P P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 36.3 bits (80), Expect = 0.051 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXP 1232 P PP P P PP P PP PP P P P P P P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 Score = 35.9 bits (79), Expect = 0.067 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP PP P PP P P P P P P P Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNP 348 Score = 35.5 bits (78), Expect = 0.089 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-----PPXPX-PPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP + PP P PP P PP PP P P P P P P Sbjct: 266 PNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNP 321 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P + P P P P PP P P P P P P P Sbjct: 257 PNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIP 306 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP + PP P P PP P P P P P P P P Sbjct: 292 PNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP 342 Score = 35.1 bits (77), Expect = 0.12 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP + P P P P PP P P P P P P P P Sbjct: 307 SAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP 351 Score = 34.7 bits (76), Expect = 0.15 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P P PP P P P P P P P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIP 360 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P+ P PP P P PP P P P P P Sbjct: 234 PNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP 283 Score = 33.5 bits (73), Expect = 0.36 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXP--PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S P P P P PP P P PP P P P P P P P Sbjct: 272 PAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIP 324 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P + PP + P PP P P PP P P P P P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXP------LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P P P PP P P P P P P P Sbjct: 222 PAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPX-PPXXP--XXPXXXPXPXXP 1241 P S PP P P PP P PP P PP P P P P P Sbjct: 263 PASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIP 315 Score = 31.1 bits (67), Expect = 1.9 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP--PPXPP--------PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PL P PP PP P P P P P P P P P P Sbjct: 214 PPGSPHIPPA-PLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIP 271 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX-------PPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP P+ P PP P P PP P P P P P Sbjct: 195 PSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETP 251 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S P P P P P P P P P P P P P Sbjct: 231 PAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIP 280 Score = 30.3 bits (65), Expect = 3.3 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXX 985 PP P P PP P PP P PP P P PP P Sbjct: 233 PPNPSKAIATPNPPMPETPLPP---ATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPL 289 Query: 986 XPP 994 PP Sbjct: 290 APP 292 Score = 30.3 bits (65), Expect = 3.3 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXX-PRPXPPPRXXPXPPPPXXX---PRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P + P P P P PP P P PP P PP P Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPN 356 Query: 980 XXXPP 994 PP Sbjct: 357 LFIPP 361 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P PP P PP PP P P P P Sbjct: 202 APPTPPMPETPLPPGSPHIPPAPLHPH-IPPAPPNPSKAIATPNPPMPETPLPP 254 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P P P P P P P P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAP 309 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GG GGG GGG G GG GGG Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 37.9 bits (84), Expect = 0.017 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG GG GGG GGG G GG GGG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGG--GGYGGGRGGG 136 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G GG G GGG GGG G G GG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGG 132 Score = 35.9 bits (79), Expect = 0.067 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG GGGG GG G G GGGG G RGGG G G G G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGY-GGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 963 GGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GG GG G GGGG G RGGG G G GG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GGG GG RG GG G G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYG 121 Score = 30.3 bits (65), Expect = 3.3 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 430 GXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRG 257 G GGG R GG GG GGGG GG G R G K G Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG GGG GGG R GG GGG Sbjct: 201 GYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGS--KGGG 245 Score = 42.7 bits (96), Expect = 6e-04 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G GGG GGG G G GGG Sbjct: 182 GSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 42.7 bits (96), Expect = 6e-04 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G GGG GGG G GG GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG--GYGGGGRHDYGGG 240 Score = 37.5 bits (83), Expect = 0.022 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G GG GGG G GG G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 36.3 bits (80), Expect = 0.051 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGG-GXGRGXXCXGXGG 811 GGGG GG G GGGG G RGG G G G G GG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 29.5 bits (63), Expect = 5.8 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG GGGG GG G G GGGG G GGG G G Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGY--GGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 813 G 811 G Sbjct: 239 G 239 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 883 GGGGXXGXTGX-GXGAGGXVXGGGR 812 GGGG G G G G+GG GGGR Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGR 215 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 GG G GGG GG G G GGGG GG G G Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G G GG G GGGG G Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYG 221 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG GGG GG G GG GGG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGG 1809 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GGG G GG E G Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX--GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG GGG G G G GG GGG Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Score = 39.9 bits (89), Expect = 0.004 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXG-GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GG G G GG G GG GGG Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 39.1 bits (87), Expect = 0.007 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX-GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G G GGG GG GGG Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 39.1 bits (87), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G G G GGG G G GGG Sbjct: 1781 GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGG 1830 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GG G GG GGG Sbjct: 1772 GMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 37.9 bits (84), Expect = 0.017 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GGG G G GGG Sbjct: 1790 GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 37.5 bits (83), Expect = 0.022 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX-GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GGG GGG G GG Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Score = 37.1 bits (82), Expect = 0.029 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G GG GG G GGG GG G GG GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G GG G G GG GG GGG G GG Sbjct: 1806 GGGGMGGGGGGMGG-GGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 35.5 bits (78), Expect = 0.089 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G GG G G GGGG GGG G G G Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAA 1827 Query: 813 G 811 G Sbjct: 1828 G 1828 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GGG GG G GG GGG Sbjct: 1756 GGFGGGG-GGGGMGGGGGMAGGGGGMGGGG 1784 Score = 31.5 bits (68), Expect = 1.4 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXR-GGGXGRGXXCXGX 817 GG G G GG G G GGGG G GGG G G G Sbjct: 1781 GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGA 1840 Query: 816 GG 811 GG Sbjct: 1841 GG 1842 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG + GGG A Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAA 1787 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GG GGG Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGG 1790 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXG-XXRGGGXGRG 835 G GGGG GG G G GGG G GGG G G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 44.0 bits (99), Expect = 3e-04 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P PPP P PPPP P P PPPPP P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 42.3 bits (95), Expect = 8e-04 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P PPP P PPPP P P PPPPP P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 39.5 bits (88), Expect = 0.005 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 P + PP PPP PPP P PP PP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 38.3 bits (85), Expect = 0.013 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPP 1196 PP PPP P PP PP P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 37.5 bits (83), Expect = 0.022 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P P PPP P PP PP P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 36.7 bits (81), Expect = 0.038 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +3 Query: 1128 PLXPPPX--PPPXPXPPXPPXPXPPXXP 1205 P PP PPP P PP PP P PP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 35.9 bits (79), Expect = 0.067 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 15/60 (25%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXP---------------XPPXPPXPXPPXXPXXP 1214 A PP PP P PPP PPP P P PP P PP P P Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Score = 33.1 bits (72), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PP PP P P P P PPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P PPP P PPP P PP PPP P P Sbjct: 136 PAPPP--PPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMP 177 Score = 32.7 bits (71), Expect = 0.62 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 15/57 (26%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPP---------------PXPXPPXPPXPXPPXXP 1205 A PPP PP P PPP PP P P PP PP P P P Sbjct: 98 ACCAPPPPPPPPPPPPP--PPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 32.7 bits (71), Expect = 0.62 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXPLXXXXXXXXXXXXXXXXXXXPPPXLP 1240 PP PP PP PPP P+ PPP P Sbjct: 105 PPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P PP P PP P PP P P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A P PP P P P P PPPP Sbjct: 94 ACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P P PP Sbjct: 102 PPPPPPPPPPPPPPP---PPPP 120 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GGG GG + GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 32.7 bits (71), Expect = 0.62 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G C GG Sbjct: 86 GGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGG 101 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGG 103 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGG 102 Score = 30.3 bits (65), Expect = 3.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 85 GGGGGGGGGVGGGGGGGGGG 104 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 43.6 bits (98), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PPP P PP P P PP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 41.1 bits (92), Expect = 0.002 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PPP PP P PP PP P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 41.1 bits (92), Expect = 0.002 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P PPP PPP P P PP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P PPP P P PP PP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 40.3 bits (90), Expect = 0.003 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PPP P PP P P PP P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 39.9 bits (89), Expect = 0.004 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P PPP PPP P PP P PP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 39.9 bits (89), Expect = 0.004 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 PPP PP P PPP PPP P PP P Sbjct: 1159 PPPPPPPPPPSSP-SPPPPPPPPPPPPTP 1186 Score = 39.5 bits (88), Expect = 0.005 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PPP P PP PP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 38.7 bits (86), Expect = 0.009 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PP PP P P P PPP P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP-PPPPPPPTP 1186 Score = 37.1 bits (82), Expect = 0.029 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP PP P P P P P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 36.7 bits (81), Expect = 0.038 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP PP PP PPP P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P +P P P P PPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 33.1 bits (72), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 33.1 bits (72), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 33.1 bits (72), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 32.3 bits (70), Expect = 0.82 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P PPP P PPPP PP PPPPP P Sbjct: 1157 PPPP----PPPPPPPPSSPSPPPP--------------------PPPPPPPPTP 1186 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP + PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPP 1174 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 1159 PPPPPPPPPPSSPSPPP 1175 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 A PPP S PP PP PPP P PP P PP P Sbjct: 952 APPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP + PP P P PP PP PP P PP P Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP + PP P PP P P PP P PP P P P P Sbjct: 941 APSQPPPPGGNAPPPPP--PPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP----XXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P PPP PPPP P PP PPPPP P Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 36.7 bits (81), Expect = 0.038 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P PPP PPP P PP PPPPP P Sbjct: 945 PPPPGGNAPPPPPPP-GGSAPPPGGGAP---PLPPPPGGSAPPPPPPPPPPPPP 994 Score = 35.9 bits (79), Expect = 0.067 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPP---XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P PPP PPP P PP PP P P P P P Sbjct: 911 SASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 35.9 bits (79), Expect = 0.067 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P PP P PP P PP P P P Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Score = 35.1 bits (77), Expect = 0.12 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP--RXXPXPPPP--XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P P P PPP PPPP P PP PPPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 980 XXXPP 994 PP Sbjct: 983 PPPPP 987 Score = 34.7 bits (76), Expect = 0.15 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P P PPP P P P PP P P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 34.3 bits (75), Expect = 0.20 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXP----PXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP S P P PPP P P P P PP P P P P Sbjct: 930 APLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P P P PP P PP P P P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Score = 32.7 bits (71), Expect = 0.62 Identities = 23/75 (30%), Positives = 25/75 (33%), Gaps = 1/75 (1%) Frame = +2 Query: 191 EPPXLIXGGN-SPFKEILKXGXGTPFXPXXXXSPLXXLFPPXXXXXPXPPXXQXXXXPPX 367 E P GG+ SP P P +PL P PP PP Sbjct: 898 ESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Query: 368 PPXXFXPXTGGXAPP 412 PP P GG APP Sbjct: 958 PPGGSAPPPGGGAPP 972 Score = 32.7 bits (71), Expect = 0.62 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 4/57 (7%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP----XPPPPPXPXXXXXPP 994 P PP P PPPP PP PPPPP P PP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/51 (27%), Positives = 15/51 (29%) Frame = +1 Query: 1090 PPPPXXXXXXXXXXXXXXXXXXXXXXXPXPPPPXPPXXPXXPXXXPXPPXL 1242 PPPP P PPPP P P P PP + Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPM 995 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P PPP PPP PP PP P PP P P P P Sbjct: 294 PPPADGSAPA-----PPPPPPPGGAPP-PPPPPPPPPPGDGGAPPPPPPP 337 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P PPP P PP P PP P P P P Sbjct: 292 PPP-----PPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A PPP P P PPP P P PP P P PP P P P Sbjct: 289 APVPPPPPADGSAPAPPPPPPPGGAPPPPPP--PPPPPPGDGGAPPPPPPP 337 Score = 35.5 bits (78), Expect = 0.089 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P PPP P PP P PP PPPPP P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPP----------PGGAPPPPPPPPPPPPGDGGAPP 332 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P PPP PPPP P PP PPPP Sbjct: 292 PPPPPADGSAPAPPP-----PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 33.5 bits (73), Expect = 0.36 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 1137 PPPXPPPXP-XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PPP P PP P PP P P P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP + PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPP 883 G PP P P P PPP PPPP Sbjct: 312 GAPPPP---PPPPPPPPGDGGAPPPP 334 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSXPP-XXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP S PP P+ PP P P P P PP P P P P P P Sbjct: 1038 AQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP-PRQPPPPSTSQPVPPPRQP 1091 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP--PXPPP--XPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S P PL PP P PPP P PP PP P P P P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 38.3 bits (85), Expect = 0.013 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP---PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP P PPP P P P PP P P P Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 37.1 bits (82), Expect = 0.029 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXP-PXXPXXPXXXPXPXXP 1241 A PPP S PP P PP PP P PP P P P P P P P P P Sbjct: 1053 AVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP-PRQPDPIPTNPAHP-TEPPPRQP 1109 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXS-XPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP P P P P PP P P P P P Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPR-QPDPIPTNP 1098 Score = 36.3 bits (80), Expect = 0.051 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP---PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P PPP P P P P P P P Sbjct: 1064 PPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 33.1 bits (72), Expect = 0.47 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPP---XXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP P+ PP P P P P P PP P P P P Sbjct: 1069 PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP-KPTPAPRP 1117 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXP--RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P +P PPP P PPP P PP PPPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSP---------PPSEPAPPPRQPPPPSTSQPV 1085 Query: 986 XPP 994 PP Sbjct: 1086 PPP 1088 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP P P PP P P P P P P P Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLP-PPRKPSPPPSAVPIPPPRKPSP 1064 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 42.7 bits (96), Expect = 6e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P + PP P PPP PP P P PP P P P P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP + PP P PP PPP PP PP PP P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPP-TEPPTPPPTDPPTQP 1059 Score = 37.9 bits (84), Expect = 0.017 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P + PP P PP PPP P PP P P P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 35.1 bits (77), Expect = 0.12 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + P P PP PP P P PP PP P P P P Sbjct: 1009 PGTTTNVPDPLPTDPPTEPPTDP--PTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP PP P PP P PP P P P P Sbjct: 1020 PTDPPTEPPTDPPTP-PPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G GG G GG G GG GG GG + GGG Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAGSTVHGGLDMDGGGG 845 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP--PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + P P P P PP P PP P P P P P P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP--PXXXPR 898 PP P P P PPP P PPP P PR Sbjct: 1031 PPTPPPTEP-PTPPPTEPPTPPPTDPPTQPR 1060 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 42.3 bits (95), Expect = 8e-04 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXP 1193 PPP PP P PPP PP P PP PP P P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP P P PP PP P P P P P P P Sbjct: 1238 PPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXP-LXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P + P PP PP P PP P PP P P P Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 35.9 bits (79), Expect = 0.067 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P PP PP P PP P P P P P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 32.3 bits (70), Expect = 0.82 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P PPP P PP P P PP PP PP P Sbjct: 1243 PDGPPKFMGLPPPPPGMRPMPPQPPFMP-------PPPRMQPPGPPGPPGPPGP 1289 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 8/62 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP--------XPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP H P PPP P PPPP PP PP PP Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Query: 968 XP 973 P Sbjct: 1285 GP 1286 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 292 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 250 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 257 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 285 GGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG 334 Score = 42.3 bits (95), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 306 GGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGG 355 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G G GG G G GGG G GG GG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 39.1 bits (87), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GGG G GG GG Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 39.1 bits (87), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GGG G GG GG Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 39.1 bits (87), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GGG G GG GG Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 39.1 bits (87), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GGG G GG GG Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Score = 39.1 bits (87), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GGG G GG GG Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG 322 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G G GGG Sbjct: 271 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGG 320 Score = 38.7 bits (86), Expect = 0.009 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG G G GG GGG Sbjct: 278 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGG 327 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GG G GG GGG Sbjct: 292 GGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGG 341 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GGG GG G GG GG Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 35.9 bits (79), Expect = 0.067 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GGG GG GGG Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 279 Score = 35.5 bits (78), Expect = 0.089 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G GGG G GG GG Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G GG GG G G GGG G G G G Sbjct: 327 GVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 34.7 bits (76), Expect = 0.15 Identities = 32/119 (26%), Positives = 32/119 (26%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG G GG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGGXP 805 G GGG GG G GGGG GG G G G GG P Sbjct: 308 GATGVGGGATGGGGGATGGGV--------GATGGGGGATGGGGGVTGGGGGATGGGGGP 358 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG--GXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GG GGG GG GGG Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Score = 33.5 bits (73), Expect = 0.36 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGGG GG G G GGGG GG G G G GG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 293 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGA 267 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGA 274 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGA 281 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGA 288 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGA 295 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGA 302 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGA 309 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGA 323 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GG GGG Sbjct: 305 GGGGATGVGGGATGGGGGATGGG 327 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G GG G GG GGG G GG + GGG Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGG 234 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G GG G G GGG Sbjct: 204 GRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGG 248 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GGRG GGGG G GGGG G Sbjct: 203 GGRGRGGGGRG--GYGGGGGYG 222 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 41.9 bits (94), Expect = 0.001 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXP 1187 PP P PPP PPP P PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPP 1196 P PPP PPP P PP PP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 37.1 bits (82), Expect = 0.029 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P PP PP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 35.1 bits (77), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPP 1196 P PP PPP P PP PP P PP Sbjct: 1307 PPESPPPPPP-PPPPPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXP 1214 PP P PP PP P PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 P PPP P PP PP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.82 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPP 1172 S PP P PPP PPP P P Sbjct: 1310 SPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.1 bits (67), Expect = 1.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 1109 LRPPXXPPXPPXSPPPXP 1162 ++PP PP PP PPP P Sbjct: 1305 IQPPESPPPPPPPPPPPP 1322 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP + PP P P P P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 1312 PPPPPPPPPPPPPPLPP 1328 Score = 26.6 bits (56), Expect(2) = 1.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 PP PPPPP P P Sbjct: 1315 PPPPPPPPPPPLPPTP 1330 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXP 895 PP P PPPP P Sbjct: 1307 PPESPPPPPPPPPPPP 1322 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP PL P P P P PP PP PP P Sbjct: 556 PPPPGVDIPP--PLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP + PP P P PP PP P P P Sbjct: 554 PPPP----PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 33.5 bits (73), Expect = 0.36 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXP--XPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 P P P PP PPP PP PP P PP P P P P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP--XPPPP 883 PP P P+P PPP P PPPP Sbjct: 565 PPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PP PPPP P Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXP-PPRXXPXPPPPXXXP 895 PP P P P PP P PPPP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP PP PP P P P P P Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 39.9 bits (89), Expect = 0.004 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXX-PRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P PP R PPPP P PP PPPPP Sbjct: 318 PPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 377 Query: 989 PP 994 PP Sbjct: 378 PP 379 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP + PPP PPP P PP PP P PP P P P Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Score = 35.9 bits (79), Expect = 0.067 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP P PPPP R PPPPP P P Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGN-----------PPPPPPPGRGAPP 404 Query: 992 P 994 P Sbjct: 405 P 405 Score = 35.5 bits (78), Expect = 0.089 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 11/74 (14%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXX---PXPPPP---XXXPRXXXXXXXXXXXXXXXPP-----X 952 G PP P P PPP P PPPP P PP Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAA 362 Query: 953 PPPPPXPXXXXXPP 994 PPPPP P PP Sbjct: 363 PPPPPPPPVGGPPP 376 Score = 35.5 bits (78), Expect = 0.089 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP----PPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P P PP PPP P P PP P P P P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.12 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PP R PPPP PP PP P P Sbjct: 297 PPPPSRGAP-PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAP 355 Query: 992 P 994 P Sbjct: 356 P 356 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSX-PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP S PP PP P PP PP P P P P P Sbjct: 325 APPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P PPP P P PP P Sbjct: 307 PPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Score = 32.7 bits (71), Expect = 0.62 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP-----PPXPX 976 PP P P PP R P PPP R PP PP PP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPP----SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPS 342 Query: 977 XXXXPP 994 PP Sbjct: 343 RGAPPP 348 Score = 32.3 bits (70), Expect = 0.82 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-----XPXPPXXPXXPXXXPXP 1232 PPP + PP PP PP P PP PP P P P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 32.3 bits (70), Expect = 0.82 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP GPPPPP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPP 378 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P PP PP P P P P Sbjct: 287 PPP-----PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP P P P P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPX--TXPPAPXPXPVXPXXPPPP 884 PPP PP P P PV PPPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 308 PPSRGSAPPPPPARMGTAPPPPP 330 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +2 Query: 839 RPXPPPRXXPXPPPP--XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 +P PPP PPPP P PPPPP PP Sbjct: 286 QPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP 339 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 + PPP P PP P PP P P P Sbjct: 285 IQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPP 318 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 41.1 bits (92), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP PP P P P P P P P P Sbjct: 30 PPPPPYEAPP-----PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 39.1 bits (87), Expect = 0.007 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 1116 PPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P PP PP P P P P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPPGECGP 748 Score = 39.1 bits (87), Expect = 0.007 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +3 Query: 1116 PPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P PP PP P P P P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP + PP P P P P PP P P P P P P P Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGP-PGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 36.3 bits (80), Expect = 0.051 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP + PP P P P P PP P P P P P P P Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGP-PGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 35.9 bits (79), Expect = 0.067 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 1116 PPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P PP P PP PP P P P P P P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 35.1 bits (77), Expect = 0.12 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 1116 PPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P PP PP P P P P P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGP 918 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P + PP + PP P P P P PP P P P P P P Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGP-PGPASPPSPPGPPGPPGPKGPPGP 906 Score = 33.9 bits (74), Expect = 0.27 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PPP PP PP P P P P P P Sbjct: 29 PPPPPPYEAPPPPPG---PPGPDGPPGFPGPQGP 59 Score = 33.1 bits (72), Expect = 0.47 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP + P P P P P PP P P P P P P P Sbjct: 604 PGPPGVNGPPGEIGEIGPAGLPGP-PGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 32.7 bits (71), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PP PP P P PP P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PP PP P P PP P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGP 742 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP----PPPXPXX 979 PP P + P PPP P P P P PP PP PP P Sbjct: 30 PPPPPYEAP---PPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAG 86 Query: 980 XXXPP 994 PP Sbjct: 87 AIGPP 91 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PL PP PP PP P P P P P P P Sbjct: 181 PNGPLGPP-GPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGP 220 Score = 31.1 bits (67), Expect = 1.9 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PP--PXXXSXPPXXP----LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P + PP PP PP P P P P P P P Sbjct: 80 PPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGP 135 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP PP PP P P P P P P P Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGP 305 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P PP P P P P P P P P Sbjct: 273 PGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 323 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P PP P P P P P P P P Sbjct: 358 PGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGP 408 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP P P PP PP P P P P P Sbjct: 29 PPPPPPYEAP-PPPPGPPGPDGPPGFPGPQGPNGPKGP 65 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P + PP P PP PP PP P P P P Sbjct: 625 PGPPGPASPPSPP--GPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P + PP P PP PP PP P P P P Sbjct: 795 PGPPGPASPPSPP--GPPGPPGPKGPPGPNGPLGPPGECGP 833 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P P P P P P P P P PP P Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGP-PGLPGPPGPP 75 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXX-PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P + PP PP PP P P PP P P P P Sbjct: 94 PGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPP--PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P + PP P PP PP PP P P P P Sbjct: 264 PGPNGILGPPGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGP 317 Score = 29.9 bits (64), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P PP P P P P P P P P Sbjct: 443 PGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGP 493 Score = 29.9 bits (64), Expect = 4.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P PP P P P P P P P P Sbjct: 528 PGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGP 578 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P + PP P PP PP PP P P P P Sbjct: 710 PGPPGPASPPSPP--GPPGPPGPNGPPGPNGPLGPPGECGP 748 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 41.1 bits (92), Expect = 0.002 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P PPP PPP P PP PP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.5 bits (83), Expect = 0.022 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P PPP P PP PP P PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 36.3 bits (80), Expect = 0.051 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P PPP PPP P PP P P P Sbjct: 867 PPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 34.7 bits (76), Expect = 0.15 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 RP P PP P P P P PPPP Sbjct: 861 RPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 32.7 bits (71), Expect = 0.62 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 RP P PR P PPPP P PP PPPPP Sbjct: 859 RPRPRPRRPPPPPPPPPPP----------------PPPPPPPP 885 Score = 32.3 bits (70), Expect = 0.82 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPP 883 P P P P PPP P PPPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1155 PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P PP P PP P P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXP 895 P P P P PPP P PPPP P Sbjct: 862 PRPRRPPPPPPPPP---PPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPP PP P P P PP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 867 PPPPPPPPPPPPPPPPP 883 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 868 PPPPPPPPPPPPPPPPP 884 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 869 PPPPPPPPPPPPPPPPP 885 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP--PPXPXPPXPPXPXPPXXPXXP 1214 PPP + PP P+ PPP P PP P P PP P P P Sbjct: 123 PPPPTGTLPPP-PVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP L PPP PP P P PP P P P P P P Sbjct: 122 PPP-----PPTGTLPPPPVTPP-PGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 32.3 bits (70), Expect = 0.82 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PP T PP P P P PPPP Sbjct: 125 PPTGTLPPPPVTPPPGPETPPPP 147 Score = 29.9 bits (64), Expect = 4.4 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 215 GNSPFKEILKXGXG--TPFXPXXXXSPLXXLFPPXXXXXPXPPXXQXXXXPPXPPXXFXP 388 GN P +K G P P P + PP P PP PP P Sbjct: 105 GNYPLMNAVKKYLGGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Query: 389 XTGG 400 TGG Sbjct: 165 PTGG 168 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG GG G GGG GGG RG GG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 GG G GG GG G GGG GGG G GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 34.7 bits (76), Expect = 0.15 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G GGG GGG G GG GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 GG G G GGG GGG G GG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GGG GGG G GG GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 31.9 bits (69), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGG 358 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGGXGRG 835 RG GGGG G GGG GRG Sbjct: 341 RGGGGGGGGGGGGGGGGGGRG 361 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GG G G G G G GG GGGR Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGR 360 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 RG GGG G GGG G G G GG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 345 GGGGGGGGGGGGGGGRGGGG 364 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 346 GGGGGGGGGGGGGGRGGGGG 365 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G GGG GGG G G GGG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 39.1 bits (87), Expect = 0.007 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 1231 GXGXXXGXX-GXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G GG G G GG G GGG GGG R GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G GG G GG G G GG GGG R G Sbjct: 106 GGYGGSSRGGYGGGRGGGGYGG--GRGGGGSYGGGRRDYGG 144 Score = 33.9 bits (74), Expect = 0.27 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGGG 1091 G G G GG GG G GGG G GG RG GG GGG Sbjct: 314 GRGGGYRSGGGGGYGG-GRGGGRGYGGGRG--GGGRRDYGGG 352 Score = 32.7 bits (71), Expect = 0.62 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GGG GGG G G GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 32.3 bits (70), Expect = 0.82 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGG GG G GGGG G RGGG G GG Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GGGG G G G G GG GGGR Sbjct: 323 GGGGYGGGRGGGRGYGGGRGGGGR 346 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GGG GG G G GG Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 40.3 bits (90), Expect = 0.003 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG-GXGGGXR-GXXGGXEXXXGGG 1091 G G G G G GG G G G G GG G GGG G GG GGG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 40.3 bits (90), Expect = 0.003 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G G G G GG G G G GG GGG G GG GG A Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGA 90 Score = 37.1 bits (82), Expect = 0.029 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G G G G GG GG GGG GG GG A Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAA 91 Score = 35.5 bits (78), Expect = 0.089 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G G G G GG GGG G GG Sbjct: 71 GGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 35.1 bits (77), Expect = 0.12 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXG-GXEXXXGGG 1091 G G G GG G GG G G G GG GG G G G GGG Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Score = 34.3 bits (75), Expect = 0.20 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G GG G G GG G G G GG G A Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGG-GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGA 93 Score = 33.9 bits (74), Expect = 0.27 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG GG G GG G G Sbjct: 56 GGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G G G GG G G Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GAGG GGG Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGGG 63 Score = 32.7 bits (71), Expect = 0.62 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GG GG GG G GGG G GGG G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAG----GCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 32.7 bits (71), Expect = 0.62 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G G G G G GG G G G G G G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Query: 813 G 811 G Sbjct: 97 G 97 Score = 32.3 bits (70), Expect = 0.82 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-GGGXGGGXRGXXG 1118 G G G G G G G G G G GGG GG G G Sbjct: 71 GGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G G G GG G GGG G G G G G A Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNG-GGGAGNGGGGGGAGNGGAAGAAGAGA 95 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G GG G G G GG G G GG Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAA-GAGAGGNVGGGGSGGVGGNGG 112 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G G GG G G GG G G Sbjct: 80 GGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 30.3 bits (65), Expect = 3.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GAG V GG Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGG 57 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 883 GGGGXXGXTGX-GXGAGGXVXGGG 815 GG G G G G GAGG V GGG Sbjct: 80 GGAGNGGAAGAAGAGAGGNVGGGG 103 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 40.3 bits (90), Expect = 0.003 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P P P P P PPP PP PP P P P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.1 bits (82), Expect = 0.029 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P L P P PP P PP PP PP P P Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 34.7 bits (76), Expect = 0.15 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P + P P PP P PPPP P PP PPPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAP-PPPPAAAP----------------PPPPPPPP 249 Score = 34.3 bits (75), Expect = 0.20 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P P P PPP P PP P PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P+ PP P PP P P PP P P P P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P P P P PPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPP 247 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P P P P PPPP Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPP 248 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P PP P P P P P P P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P PPP P P PP P PP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P P P P P P PP P P P Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P P P PP P PP P P PP Sbjct: 95 PPPPATPPPPTMP--PTPPPPQTPAPPGPDTPAPP 127 Score = 38.3 bits (85), Expect = 0.013 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PPP PP P PP P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 35.5 bits (78), Expect = 0.089 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PPP P P PPP P P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.27 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PPP PP PP P P P P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 33.5 bits (73), Expect = 0.36 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 1143 PXPPPXPXPP-XPPXPXPPXXPXXP-XXXPXPXXP 1241 P PP P PP PP P PP P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +3 Query: 816 PPPXTXPPAPXP----XPVXPXXPPPP 884 PPP T PP P P P P P PP Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPP 127 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 39.9 bits (89), Expect = 0.004 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXX----PLXPPPXPPPXPX---PPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P+ PPP PPP PP PP P P P P P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP P PPPP PP PPPPP P Sbjct: 700 PPPPLLSGTLPMPPP---PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPP 756 Query: 992 P 994 P Sbjct: 757 P 757 Score = 38.7 bits (86), Expect = 0.009 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP P L PPP PPP PP P P P P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 37.5 bits (83), Expect = 0.022 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX------PPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PPP PPP P P PP P PP P P P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 37.5 bits (83), Expect = 0.022 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP PPP P P P P P PP P P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 36.3 bits (80), Expect = 0.051 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P P P PP PP P P P P P Sbjct: 718 PPPGCAGLPPPPP-SPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 31.1 bits (67), Expect = 1.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 8/42 (19%) Frame = +3 Query: 1140 PPXPPPXPX--------PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PPP P PP PP P PP P P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPP 718 Score = 29.9 bits (64), Expect = 4.4 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PP P PPP P PPP P P P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLP 740 Query: 992 P 994 P Sbjct: 741 P 741 Score = 29.5 bits (63), Expect = 5.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P PPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPP 716 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 39.9 bits (89), Expect = 0.004 Identities = 19/35 (54%), Positives = 20/35 (57%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G GG GG G GGG GGG G + G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNG 354 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 39.9 bits (89), Expect = 0.004 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G G GG G G GGG G GG GG Sbjct: 55 GATGGGATGGGGGATGGGG-GATGGHGGATGGGGGATGDGGGATGGGGG 102 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GG G GG GGG Sbjct: 72 GGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGG 121 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G G GG G G GGG G GG GG Sbjct: 65 GGGATGGGGGATGGHG-GATGGGGGATGDGGGATGGGGGATGGGGG 109 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G G GG G G GGG G GG GG Sbjct: 121 GVGATGGHGGATGGHG-GATGGHGGATGGGGGATGGGGGATGGGGG 165 Score = 37.9 bits (84), Expect = 0.017 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G GGG GG G GG GGG Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG 86 Score = 37.9 bits (84), Expect = 0.017 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 3/52 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGG 1094 G G G G GG GG G G GGG GGG G GG GG Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG 116 Score = 35.9 bits (79), Expect = 0.067 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G GG G G GGG G GG GG Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 34.7 bits (76), Expect = 0.15 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGX--GGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G GG GGG GG GGG Sbjct: 116 GATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 33.5 bits (73), Expect = 0.36 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG GG G GG GGG G GGG Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 32.7 bits (71), Expect = 0.62 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-GGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG GG G G GG GGG G GG GG Sbjct: 86 GGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV-GATGGHGGATGG 134 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 3/52 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-GGGXG--GGXRGXXGGXEXXXGG 1094 G G G G GG GG G G GG G GG G GG GG Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGG 151 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGG-XGRGXXCXGX 817 GG G GGG G G GGGG GGG G G G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGG 106 Query: 816 GG 811 GG Sbjct: 107 GG 108 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGG-XGGGXRGXXGG 1115 G G G GG GG G G GGG GGG G GG Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGG-GATGG 169 Score = 31.1 bits (67), Expect = 1.9 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGX--GXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GG GG GG GGG Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G G G GG GGG A Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGA 110 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 39.9 bits (89), Expect = 0.004 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G G G GG G G G G GGG GGG G GG + Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGGD 485 Score = 39.1 bits (87), Expect = 0.007 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GGG G GG + GGG Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGD---GGG 484 Score = 37.5 bits (83), Expect = 0.022 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG GGG GG G GG GGG Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGG 472 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GGG GGG G GG + GG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGG--GGDGGGDGIDGG 464 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 39.5 bits (88), Expect = 0.005 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXP--PPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 A PPP P P PP P PP P P PP P P P P P P Sbjct: 773 ALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 1090 PPPPXXXXXXXXXXXXXXXXXXXXXXXPXPPPPXPPXXPXXPXXXPXPPXL 1242 PPPP P PPPP P P P P PP + Sbjct: 779 PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPPGI 829 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 39.5 bits (88), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP--XPPXXPXXPXXXP 1226 PP S P P PPP P P P PP P PP P P P Sbjct: 517 PPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 32.7 bits (71), Expect = 0.62 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP---PPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP PP P P P P P PP P P P Sbjct: 208 PPTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPTQPSHPPTAP 254 Score = 32.3 bits (70), Expect = 0.82 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S PP P PP P P P P P P P P P Sbjct: 171 SYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTP 211 Score = 31.9 bits (69), Expect = 1.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 7/53 (13%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP--PPXP--XPPXP---PXPXPPXXPXXPXXXPXP 1232 PP S PP P PP P PP P PP P P P P P P Sbjct: 187 PPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAPSYPPTP 239 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXP 1214 S PP P PP P P PP P PP P P Sbjct: 508 SYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYP 544 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 173 PPTQPFYPPTQPFYPPTPSSYPPTQPSYP-PTAPSYPPTPSSYP 215 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 39.5 bits (88), Expect = 0.005 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G GG GG G GGG GGG G GG + G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDG 336 Score = 37.9 bits (84), Expect = 0.017 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G GG G GG GG G GGG GGG G + G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDG 344 Score = 37.1 bits (82), Expect = 0.029 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G GGG GGG G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GGG GGG G GG G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGG-GDGGGDGDGDGDG 338 Score = 35.1 bits (77), Expect = 0.12 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G GGG GGG G G + G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGG 330 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P P PPP P PP P PP P P P P Sbjct: 445 AATLPPLPSDEPPPLPPDEEKPPPPP--APALPPLPLPPELPGSPGDSPPATSP 496 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP----XPPXPPXPXPPXXPXXPXXXPXP 1232 P P + P P PPP P PP PP P P P P P Sbjct: 437 PLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSP 487 Score = 30.7 bits (66), Expect = 2.5 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP--PPPXPXXXX 985 PP P P P PP P PPP P P P PP P Sbjct: 449 PPLPSDEPP-PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSN 507 Query: 986 XPP 994 PP Sbjct: 508 GPP 510 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP PL P P PP PP P P P Sbjct: 467 PPPPAPALPPL-PLPPELPGSPGDSPPATSPKQPPLPPKHSNGPPLRQTP 515 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 39.5 bits (88), Expect = 0.005 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG G GGG GGG G G GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 39.5 bits (88), Expect = 0.005 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGG--GXRGXXGGXEXXXGGG 1091 G G G G G GG GG GG GGG GG G G GG GGG Sbjct: 186 GSQGGGYRSGGGGY-GGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGG GG G GGGG G RGGG G G GG Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 39.1 bits (87), Expect = 0.007 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PPP P PP PP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 36.7 bits (81), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PPP P PP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 36.3 bits (80), Expect = 0.051 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXP 1193 P PPP PPP P PP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P PPP PPP P PP P P Sbjct: 54 PPPPP--PPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P PP PP P PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 827 HXXPRPXPPPRXXPXPPPP 883 H P P PPP P PPPP Sbjct: 52 HDPPPPPPPPPPPPPPPPP 70 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXP 895 P P PPP P PPPP P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P P P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 5.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 1167 PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect(2) = 0.026 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 834 PPAPXPXPVXPXXPPPP 884 PP P P P P PPPP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 27.1 bits (57), Expect(2) = 0.026 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXPL 1165 PP PP PP S P PL Sbjct: 63 PPPPPPPPPSSSPSRPL 79 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 39.1 bits (87), Expect = 0.007 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G G G G G G G G GG G G GGG GGG GG + Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGND 114 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G G GGG G G G GG GGG Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 1240 GXXGXGXXXGXX---GXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G G GG G GG GG G GGG GGG G Sbjct: 74 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 37.5 bits (83), Expect = 0.022 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G G G GGG G GG GGG Sbjct: 67 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 37.1 bits (82), Expect = 0.029 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GGG G GG GGG Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 99 Score = 33.9 bits (74), Expect = 0.27 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGG G G G G GGGG G GGG G G GG Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 39.1 bits (87), Expect = 0.007 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G G G G G G G G GG G G GGG GGG GG + Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGND 129 Score = 38.7 bits (86), Expect = 0.009 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G G GGG G G G GG GGG Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -3 Query: 1240 GXXGXGXXXGXX---GXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G G GG G GG GG G GGG GGG G Sbjct: 89 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 37.5 bits (83), Expect = 0.022 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G G G GGG G GG GGG Sbjct: 82 GNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 37.1 bits (82), Expect = 0.029 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GGG G GG GGG Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGG 114 Score = 33.9 bits (74), Expect = 0.27 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGG G G G G GGGG G GGG G G GG Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 38.7 bits (86), Expect = 0.009 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP---PXP---XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP P P PP PP PP P P P Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXP---XPPXXPXXPXXXPXPXXP 1241 PPP PP PP PP P PP P PP P P P P Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 33.5 bits (73), Expect = 0.36 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP--PPPXPXXXX 985 PP P P PPP PPPP R PP PP PP Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPP-PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 356 Query: 986 XPP 994 PP Sbjct: 357 PPP 359 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 PPP PP + PPP PPP P Sbjct: 372 PPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 32.3 bits (70), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PPP P PP P P P P Sbjct: 2 PPPPPPPGP-PPPPSAPSGPVKP 23 Score = 32.3 bits (70), Expect = 0.82 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPP 1196 P PPP PPP P P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G PP P P + PPPP P PPPPP Sbjct: 145 GAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGS 204 Query: 986 XPP 994 PP Sbjct: 205 APP 207 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P L PPP P P PP P P Sbjct: 216 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 G PP P PPP PPPP R P P PPP Sbjct: 193 GPPPPPHSRHGSAPPPPERSSGPPPPPPG-RGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 31.1 bits (67), Expect = 1.9 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 16/70 (22%) Frame = +3 Query: 1080 AXXXPPPXXXSXPP------XXPLXPP-------PXPPPXPXPP---XPPXPXPPXXPXX 1211 A PPP + PP PL PP P PPP PP P PP Sbjct: 307 APAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQ 366 Query: 1212 PXXXPXPXXP 1241 P P P P Sbjct: 367 PLGGPPPPPP 376 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXP 1214 PPP P P PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKP 23 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP PP P P P PPP Sbjct: 4 PPPPPGPPPPPSAPSGPVKPPP 25 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 P + PP P P PPP P PP P P P P P Sbjct: 224 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 272 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P PL P PPP P P P P P P Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 8/43 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--------PPPXPXPPXPPXPXPP 1196 PPP S PP PPP P PP PP PP Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPP 175 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP PP PPP P PP P P P Sbjct: 196 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 5/68 (7%) Frame = +2 Query: 806 GXPPXPXHXXPRPX---PPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPX 970 G PP P P PPP P P PP R PP PPP Sbjct: 214 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Query: 971 PXXXXXPP 994 PP Sbjct: 274 KRGSSNPP 281 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PP PPP PP PP PP P P Sbjct: 257 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 301 Score = 29.1 bits (62), Expect = 7.7 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 G PP P + P PP R P PPP P PPPP Sbjct: 261 GEPPPPKNAPP---PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNAT 317 Query: 980 XXXPP 994 PP Sbjct: 318 PPPPP 322 Score = 29.1 bits (62), Expect = 7.7 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPX-------PPPPXXXPRXXXXXXXXXXXXXXXPPX----PP 958 PP P P PPP P PPPP P+ PP PP Sbjct: 331 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR--PPSGKINPP 388 Query: 959 PPPXP 973 PPP P Sbjct: 389 PPPPP 393 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPX---PXPPXPPXPXPPXXPXXP 1214 PPP P P PPP PP P PP PP P P Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 404 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 38.7 bits (86), Expect = 0.009 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP---PXP---XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP P P PP PP PP P P P Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXP---XPPXXPXXPXXXPXPXXP 1241 PPP PP PP PP P PP P PP P P P P Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 33.5 bits (73), Expect = 0.36 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP--PPPXPXXXX 985 PP P P PPP PPPP R PP PP PP Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPP-PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSA 268 Query: 986 XPP 994 PP Sbjct: 269 PPP 271 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 PPP PP + PPP PPP P Sbjct: 284 PPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 31.9 bits (69), Expect = 1.1 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G PP P P + PPPP P PPPPP Sbjct: 57 GAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGS 116 Query: 986 XPP 994 PP Sbjct: 117 APP 119 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P L PPP P P PP P P Sbjct: 128 PPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 G PP P PPP PPPP R P P PPP Sbjct: 105 GPPPPPHSRHGSAPPPPERSSGPPPPPPG-RGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 31.1 bits (67), Expect = 1.9 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 16/70 (22%) Frame = +3 Query: 1080 AXXXPPPXXXSXPP------XXPLXPP-------PXPPPXPXPP---XPPXPXPPXXPXX 1211 A PPP + PP PL PP P PPP PP P PP Sbjct: 219 APAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQ 278 Query: 1212 PXXXPXPXXP 1241 P P P P Sbjct: 279 PLGGPPPPPP 288 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 P + PP P P PPP P PP P P P P P Sbjct: 136 PSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 184 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P PL P PPP P P P P P P Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 8/43 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--------PPPXPXPPXPPXPXPP 1196 PPP S PP PPP P PP PP PP Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPP 87 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP PP PPP P PP P P P Sbjct: 108 PPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 5/68 (7%) Frame = +2 Query: 806 GXPPXPXHXXPRPX---PPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPX 970 G PP P P PPP P P PP R PP PPP Sbjct: 126 GPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Query: 971 PXXXXXPP 994 PP Sbjct: 186 KRGSSNPP 193 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PP PPP PP PP PP P P Sbjct: 169 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP 213 Score = 29.1 bits (62), Expect = 7.7 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 G PP P + P PP R P PPP P PPPP Sbjct: 173 GEPPPPKNAPP---PPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNAT 229 Query: 980 XXXPP 994 PP Sbjct: 230 PPPPP 234 Score = 29.1 bits (62), Expect = 7.7 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPX-------PPPPXXXPRXXXXXXXXXXXXXXXPPX----PP 958 PP P P PPP P PPPP P+ PP PP Sbjct: 243 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR--PPSGKINPP 300 Query: 959 PPPXP 973 PPP P Sbjct: 301 PPPPP 305 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 5/46 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPX---PXPPXPPXPXPPXXPXXP 1214 PPP P P PPP PP P PP PP P P Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 316 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 38.7 bits (86), Expect = 0.009 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + P P PPP P P P PP PP P PP P P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPP-PPPPIQTTRPTVPTTP 940 Score = 38.3 bits (85), Expect = 0.013 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P+ PPP P PP PP P P P P P Sbjct: 951 PPPPTSALPP--PIPATQVPPP-PLPPLPPPPPPVQTTTAPTLPPASCMP 997 Score = 37.1 bits (82), Expect = 0.029 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP-----PPPXPX 976 PP P P P PP P PPPP R P PP PPP P Sbjct: 908 PPPPLPLAPEPPPP---LPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPA 964 Query: 977 XXXXPP 994 PP Sbjct: 965 TQVPPP 970 Score = 36.3 bits (80), Expect = 0.051 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXP 1214 P + PP P P P P P P P P P PP P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP--PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + PP PL P P PP P P P P P P P P Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPP 952 Score = 34.7 bits (76), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 1128 PLXPPPX---PPPXPXPPXPPXPXPPXXPXXP 1214 P PPP PPP P PP P PP P P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP + P PL PPP P P P P P P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 1119 PXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P P P P PP P P P P P P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPL-PLAPEPPPPLPPPPPP 928 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLX------PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + P P P P P PP PP P P P P P P Sbjct: 926 PPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 38.3 bits (85), Expect = 0.013 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 GG G GG GG G GGG GGG G G + Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDD 81 Score = 38.3 bits (85), Expect = 0.013 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G GG G GG GG G GGG GGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 G G GG GG G GGG GGG G G + G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G GGG GGG G GG + G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 37.1 bits (82), Expect = 0.029 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGG 1136 G GG G GG GG G GGG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGG 74 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGG 75 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGG 77 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGDG 79 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGG 76 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 882 GGGGXGXXRGGGXGRGXXCXGXGG 811 GGGG G GGG G G G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 882 GGGGXGXXRGGGXGRGXXCXGXGG 811 GGGG G GGG G G G GG Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGG 77 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.3 bits (85), Expect = 0.013 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPX--PPXPPXPXPPXXPXXPXXXP 1226 PP + P P PP PPP PP PP PP P P P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 35.9 bits (79), Expect = 0.067 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P P PP P P P P P P P P P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 34.3 bits (75), Expect = 0.20 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PP P P PP PP P P P P P P Sbjct: 155 PSIASQPPQPPA-PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP 202 Score = 34.3 bits (75), Expect = 0.20 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A P P P PP PPP P PP P P P P P Sbjct: 158 ASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 1080 AXXXPPPXX-XSXPPXXPL-XPPPXPPPXPXPP 1172 A PPP + PP P PP PPP P PP Sbjct: 177 APPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P P PPPP P PPPPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGP------PSAPPPPPAP 208 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXP---XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P P P PP P PP P PP P P P P Sbjct: 153 SGPSIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPP 199 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 807 AXRPP-PXTXPPAPXPXPVXPXXPPPP 884 A +PP P P AP P P PPPP Sbjct: 158 ASQPPQPPAPPAAPFMAPAAPPAPPPP 184 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 38.3 bits (85), Expect = 0.013 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG G GGG GGG R GG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGG---GGGGG 129 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG GG G G GGG G GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXG----GGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G G GG GGG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 37.9 bits (84), Expect = 0.017 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPP 1196 PPP PPP P PP PP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 PPP PP PL PPP PPP P P Sbjct: 424 PPPP----PPPAPLPPPPPPPPQPTTALP 448 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P P P PPP P PP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALP 448 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P P P PPP P P P P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PP P P PP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXP 895 P P PPP P PPPP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 30.3 bits (65), Expect = 3.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 834 PPAPXPXPVXPXXPPPP 884 PP P P P+ P PPPP Sbjct: 425 PPPPPPAPLPPPPPPPP 441 Score = 29.5 bits (63), Expect(2) = 0.035 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPR 898 +P PPP P PPPP P+ Sbjct: 423 QPPPPPPPAPLPPPPPPPPQ 442 Score = 26.6 bits (56), Expect(2) = 2.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 947 PXPPPPPXPXXXXXPP 994 P PPPPP P PP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 26.2 bits (55), Expect(2) = 0.035 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P P Sbjct: 434 PPPPPPPPQPTTALPDP 450 Score = 22.6 bits (46), Expect(2) = 2.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 1109 LRPPXXPPXPPXSPPPXPL 1165 L PP PP P + P PL Sbjct: 433 LPPPPPPPPQPTTALPDPL 451 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.9 bits (84), Expect = 0.017 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 A PPP PP P PPP PPP PP P Sbjct: 184 AAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 37.5 bits (83), Expect = 0.022 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXP---PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P PL PPP PP PP P PP P P P Sbjct: 167 PPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 37.1 bits (82), Expect = 0.029 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP P P PPP P P PP P P P P Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 33.9 bits (74), Expect = 0.27 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP S P PPP P PP PP P P P P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPP-PPPPIAPATGGPPPPPP 169 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P P PPP P P PP P P P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 33.1 bits (72), Expect = 0.47 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP P PPP P P P P P P P P P Sbjct: 147 ATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPP 200 Score = 33.1 bits (72), Expect = 0.47 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 5/68 (7%) Frame = +2 Query: 806 GXPPXPXHXXPR---PXPPPRXXPXP--PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPX 970 G PP P P P PPP P P P PP PPPPP Sbjct: 149 GGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Query: 971 PXXXXXPP 994 P P Sbjct: 209 PILELAAP 216 Score = 33.1 bits (72), Expect = 0.47 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 17/64 (26%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXP---------------PPXPPPXPXPPXPPXPXPPXXPXXPXX 1220 PP P PP P+ P PP P P PP PP P PP P Sbjct: 155 PPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELA 214 Query: 1221 XPXP 1232 P P Sbjct: 215 APPP 218 Score = 32.7 bits (71), Expect = 0.62 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 260 PFXPXXXXSPLXXLFPPXXXXXPXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 P P SP P P PP P PP P TGG PP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP PP P P P P PPPP Sbjct: 186 ASPPPPSGGPPPPPPPP--PPPPPPP 209 Score = 31.9 bits (69), Expect = 1.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P+ PPP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPP 218 Score = 31.5 bits (68), Expect = 1.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 PPP + P PPP P PP PP P P P P P Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPP 191 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PPPP GPPPPP Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 31.5 bits (68), Expect = 1.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPP 881 A PPP + P P P P P PPP Sbjct: 185 AASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P PPP P P P P PP P P P P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPP 883 G PP P P P PP PPPP Sbjct: 194 GPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 A PPP P PPP P P PP P P Sbjct: 134 ATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 29.5 bits (63), Expect = 5.8 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPX----PPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 G PP P P P P PPPP P PP PPPPP Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP----------PPPPPPPPPPPPPPIL 211 Query: 974 XXXXXPP 994 PP Sbjct: 212 ELAAPPP 218 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P PPP P P P PP P P P Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P +P P P PPPP G PPPP Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.5 bits (83), Expect = 0.022 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GG G GGG G G GGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGG 78 Score = 32.3 bits (70), Expect = 0.82 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 GG G GGG GGG G GG G G A Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANA 71 Score = 31.1 bits (67), Expect = 1.9 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-------GGGXGGGXRGXXGG 1115 G G G G G GG G G G G GGG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 G G GGGG G GGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDG 61 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 37.5 bits (83), Expect = 0.022 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP--XXPXXXPXPXXP 1241 P + PP P+ PP PP P PP PP P P P P P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 37.1 bits (82), Expect = 0.029 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP P PP P PP P P P P P Sbjct: 168 PPPIFPIDPPRTQ--PPPIPPIDPPRTQPP-PIPPIDP--PRTQPPPIPP 212 Score = 37.1 bits (82), Expect = 0.029 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP P P P P PP P P P P P Sbjct: 181 PPPIPPIDPPR--TQPPPIPPIDP-PRTQPPPIPPIDP--PRTQPPPIFP 225 Score = 33.9 bits (74), Expect = 0.27 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PPR P P PP PR PP P PP P P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPP-PIPPIDPPRTQPP 221 Query: 992 P 994 P Sbjct: 222 P 222 Score = 30.3 bits (65), Expect = 3.3 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +2 Query: 815 PXPXHXXP-RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P P PPR P P P PR PP P PP P P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPP-PIPPIDPPRTQPP 208 Query: 992 P 994 P Sbjct: 209 P 209 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 812 PPXPXHXXPRPXPP---PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P P P P PP PR P P PP PR PP P P Sbjct: 173 PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-PXXP 1205 PPP PP PPP PP P PP P P P Sbjct: 194 PPPIPPIDPPRTQ--PPPIPPIDPPRTQPPPIFPQPTTP 230 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 37.5 bits (83), Expect = 0.022 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXP----LXPPPXPPPXPXPPXPPXPXPP 1196 P P PP P PPP PPP P PP P PP Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P F P FPP PPPP GPP PP Sbjct: 647 PFFGGIPPPPPGGGMFPPP----PPPPPGGGVPGPPKPP 681 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.5 bits (83), Expect = 0.022 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG-GXEXXXGG 1094 G G G GG GG GG GGG GGG RG G G GG Sbjct: 750 GYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGG 796 Score = 34.7 bits (76), Expect = 0.15 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G G GG GGG RG G GGG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGG 786 Score = 32.7 bits (71), Expect = 0.62 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG G G GGG G G GGG Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 37.1 bits (82), Expect = 0.029 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX---GXGGGXGGGXRGXXGG 1115 G G G G G G GG G G GGG GGG RG GG Sbjct: 395 GRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGG 436 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.029 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PPP P PP P P P P P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGP 1696 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 P P+ P PPP P P P PP P P P P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGP 1693 Score = 31.1 bits (67), Expect = 1.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PP P P P P P P P P P Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 29.9 bits (64), Expect = 4.4 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Frame = +3 Query: 1080 AXXXPPPXXXSXP-PXXPL-XPPPXPPPXP-XPPXPP-XPXPPXXPXXPXXXPXP 1232 A PPP P P P+ P P P P PP PP P P P P P Sbjct: 1661 APPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P P PPP P PP P PP PP P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDG---PMGLPGPQGPDGPKGPPGPPGLPGP 1702 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 37.1 bits (82), Expect = 0.029 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGG 1115 GG GG G GGG GGG RG GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 37.1 bits (82), Expect = 0.029 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P+ P PP P PP P P P P P P P P Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPP-PGLPMQPEAPVQPPPLPPPGGP 2651 Score = 35.5 bits (78), Expect = 0.089 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PP PL PP P P PP PP P P Sbjct: 2614 PPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 1116 PPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P PPP PP PP P PP P P P Sbjct: 2596 PFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLP 2633 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 36.7 bits (81), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PPP P PP PP P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 Score = 34.7 bits (76), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP P P PP PP P PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 34.3 bits (75), Expect = 0.20 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PP + PP P PPP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 A PPP PP P PPP PP P P Sbjct: 69 AAATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP PP P P P P PPPP Sbjct: 70 AATPPPLCAPPPPPPPP--PPPPPPP 93 Score = 26.6 bits (56), Expect(2) = 0.24 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 PP PPPPP P P Sbjct: 83 PPPPPPPPPPPGAKKP 98 Score = 26.2 bits (55), Expect(2) = 0.24 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXP 895 PPP P PPPP P Sbjct: 73 PPPLCAPPPPPPPPPP 88 Score = 25.8 bits (54), Expect(3) = 0.33 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 79 PPPPPPPPPP 88 Score = 24.2 bits (50), Expect(3) = 0.33 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP P PP Sbjct: 80 PPPPPPPPPPPPPP 93 Score = 20.6 bits (41), Expect(3) = 0.33 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXPL 1165 PP PP P P P+ Sbjct: 86 PPPPPPPPGAKKPDDPV 102 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 36.7 bits (81), Expect = 0.038 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PPP P PP PP P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 Score = 34.7 bits (76), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP P P PP PP P PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 34.3 bits (75), Expect = 0.20 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PP + PP P PPP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.5 bits (73), Expect = 0.36 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 A PPP PP P PPP PP P P Sbjct: 270 AAATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP PP P P P P PPPP Sbjct: 271 AATPPPLCAPPPPPPPP--PPPPPPP 294 Score = 26.6 bits (56), Expect(2) = 0.23 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 PP PPPPP P P Sbjct: 284 PPPPPPPPPPPGAKKP 299 Score = 26.2 bits (55), Expect(2) = 0.23 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXP 895 PPP P PPPP P Sbjct: 274 PPPLCAPPPPPPPPPP 289 Score = 25.8 bits (54), Expect(3) = 0.31 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 280 PPPPPPPPPP 289 Score = 24.2 bits (50), Expect(3) = 0.31 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP P PP Sbjct: 281 PPPPPPPPPPPPPP 294 Score = 20.6 bits (41), Expect(3) = 0.31 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXPL 1165 PP PP P P P+ Sbjct: 287 PPPPPPPPGAKKPDDPV 303 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 36.7 bits (81), Expect = 0.038 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G GG G GG G GGG GGG G GG Sbjct: 620 GFGGQGGMFGTPGGQQSGFHGGIG-GGGMGGGFSGQGGG 657 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 36.7 bits (81), Expect = 0.038 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GGG GGG RG GG + GGG Sbjct: 41 GAGRGGGRGGPRGGGRGGG-RGGGGGFKSPRGGG 73 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGX-----GGGXGGGXRGXXG 1118 G G G G GG GG GG G GGG GGG G G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 36.7 bits (81), Expect = 0.038 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP---XPPXPPXPXPPXXPXXPXXXP 1226 PPP PP PPP PP P PP P PP P P Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGP 516 Score = 35.9 bits (79), Expect = 0.067 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +2 Query: 806 GXP-PXPXHXXPRPXPPPRXXP-XPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 G P P P H P+ PP+ P PPPP PP P PP P Sbjct: 435 GPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFY 494 Query: 980 XXXPP 994 PP Sbjct: 495 RGPPP 499 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P+ P P P PP P P P P P P Sbjct: 460 PPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 30.7 bits (66), Expect = 2.5 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 10/71 (14%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP---XPP--PPXXXPRXXXXXXXXXXXXXXXPP---XPPPP- 964 PP P H P PP P PP PP P PP PPPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 965 -PXPXXXXXPP 994 P P PP Sbjct: 488 GPPPPFYRGPP 498 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP------XPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PP PPP P PP P P P P P P Sbjct: 441 PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 36.3 bits (80), Expect = 0.051 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 A P P PP P PP P P PP PP PP Sbjct: 184 AANKPSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 34.7 bits (76), Expect = 0.15 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP PP P PP PPP P PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P+ P PPP P PP P PP P P P P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPP-PPPPPFGAPPP 223 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 1177 PPPPXPPXXPXXPXXXPXPP 1236 PPPP PP P P P PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPP 214 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 1155 PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P PP P P P P P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P PP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPP 217 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 36.3 bits (80), Expect = 0.051 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G G G G G G G G GGG RG GG GGG Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 33.9 bits (74), Expect = 0.27 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXGRG 835 GG G G G G GG G G G GGG G +GGG GRG Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 59 Score = 33.9 bits (74), Expect = 0.27 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXGRGXXCXGX 817 GG G G G G GG G G GGG G +GGG GRG G Sbjct: 22 GGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPG-GGL 80 Query: 816 GGXP 805 G P Sbjct: 81 GRGP 84 Score = 30.3 bits (65), Expect = 3.3 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXGRG 835 GG G G G G GG G G G GGG G + GG GRG Sbjct: 46 GGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRG 99 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 35.9 bits (79), Expect = 0.067 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP P PPP PPP P PP PP Sbjct: 64 PPTLP--PPPPPPPPPLPPPPP 83 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P+ PP PPP P PP PP P PP Sbjct: 59 PTVPI-PPTLPPP-PPPPPPPLPPPP 82 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P PP PP P PP P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 P P T PP P P P P PPPP Sbjct: 62 PIPPTLPPPPPPPP-PPLPPPPP 83 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXP 1163 P + PP P PPP PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 35.9 bits (79), Expect = 0.067 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP P PPP PPP P PP PP Sbjct: 288 PPTLP--PPPPPPPPPLPPPPP 307 Score = 35.1 bits (77), Expect = 0.12 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P+ PP PPP P PP PP P PP Sbjct: 283 PTVPI-PPTLPPP-PPPPPPPLPPPP 306 Score = 31.9 bits (69), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P PP PP P PP P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 P P T PP P P P P PPPP Sbjct: 286 PIPPTLPPPPPPPP-PPLPPPPP 307 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXP 1163 P + PP P PPP PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 35.9 bits (79), Expect = 0.067 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 1195 GGXGXG-GXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 GG G G G GG GGG GGG G GG E G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G GG G GG G GGG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G G GGG G GG GGG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 33.9 bits (74), Expect = 0.27 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 1195 GGXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGG 1094 GG G GG G G G GG GGG G GG + G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSG 60 Score = 33.1 bits (72), Expect = 0.47 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G GG GG GG G GG GGG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGG--GGGGGGDEDDSG 60 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGG G GGGG G Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGG 52 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 35.9 bits (79), Expect = 0.067 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG GG G GG GG G GGG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 35.9 bits (79), Expect = 0.067 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 P P S P P PPP PPP P PP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPP-PPPPAP 390 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPP--PXPXPPXPPXPXPPXXP 1205 P P PL P P P P PP PP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPX-PPXPXPPXXPXXPXXXP 1226 PP P P P P PP P PP P P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GG GG G GG GG Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGG 826 Score = 33.5 bits (73), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G GG G GG G GG GG G GG GG A Sbjct: 778 GASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGA 823 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G G GG G GG GG Sbjct: 766 GHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGG 815 Score = 33.1 bits (72), Expect = 0.47 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG GG G GG GG G GG GG A Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGA 838 Score = 33.1 bits (72), Expect = 0.47 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GG GG G G GG Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGG 837 Score = 30.3 bits (65), Expect = 3.3 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG GG G GG G G GG GG A Sbjct: 764 GDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGA 816 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GG G G GG Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G G GG G G GG Sbjct: 784 GGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGG 833 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G GG GG GG GG Sbjct: 800 GASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 29.9 bits (64), Expect = 4.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G GG GG G GG G A Sbjct: 785 GSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGA 834 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 35.5 bits (78), Expect = 0.089 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PL PP P P P P P P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAP 71 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 1128 PLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PL P PP P P PP P P P P P P P Sbjct: 43 PLPPLREPPTPAPTPP-PALPSTPTLPLAPRPRPTASQP 80 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 1131 LXPPPXPP-PXPXPPX--PPXPXPPXXPXXPXXXPXPXXP 1241 L PP P P P PP PP P P P P P P Sbjct: 32 LAVPPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAP 71 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 35.5 bits (78), Expect = 0.089 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PPP P P PP PP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 34.3 bits (75), Expect = 0.20 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P PPP PPP PP P P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.5 bits (68), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P PP P P P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.1 bits (67), Expect = 1.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP T PP P P + P PPP Sbjct: 434 PPPTPPPTPPPTTLPPTTQPPP 455 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PP PP P PP PP P Sbjct: 430 PPPTP--PPTPPPTPPPTTLPPTTQPPPQP 457 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 35.5 bits (78), Expect = 0.089 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S P P+ PP PPP PP P PP P P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSP 291 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 35.5 bits (78), Expect = 0.089 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 806 GXPPX-PXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 G PP P RP PP P PPP PP PPPP Sbjct: 865 GAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 Score = 33.1 bits (72), Expect = 0.47 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPP-PXPXPP-XPPXPXPPXXPXXPXXXPXPXXP 1241 P + P P PPP PP P PP PP P P P P P Sbjct: 843 PTTKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 32.7 bits (71), Expect = 0.62 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-----PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P PR P P PPP P PPPPP P Sbjct: 860 PPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P P PP P P PP P PP P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 35.5 bits (78), Expect = 0.089 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP PPP PPP P PP P PP Sbjct: 301 PPP-----PPPTDFAPPP-PPPEPTSELPPPPPPP 329 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXP---PPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 A PPP S P PP PPP P PP P P P P Sbjct: 278 ATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP-PXPPPPPXPXXX 982 G PP P PPP PPPP P PPPPP P Sbjct: 267 GHPPIPSASQNATPPPP-----PPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSE 321 Query: 983 XXPP 994 PP Sbjct: 322 LPPP 325 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPXTX--PPAPXPXPVXPXXPPPP 884 PPP T PP P P P PPPP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + P PPP P PP P P P P P Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 327 PPPPXHNXFXGPPPPP 374 PPPP F PPPPP Sbjct: 301 PPPPPPTDFAPPPPPP 316 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P P PP PPPP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPP 326 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP PPPPP F Sbjct: 305 PPTDFAPPPPPPEPTSELPPPPPPPF 330 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 35.1 bits (77), Expect = 0.12 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGX-GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G G GGG GGG G G GG Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG 503 Score = 33.1 bits (72), Expect = 0.47 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G GG G GGG G G G GGG Sbjct: 469 GFGGGGGPNGAGGGGGGGGGYSG--GASGSRSNSCGGG 504 Score = 31.1 bits (67), Expect = 1.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G GG G G GG G GGG GG G GGG A Sbjct: 456 GAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSN-SCGGGGGSYNA 510 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G GGG GG G GGG Sbjct: 214 GVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 29.5 bits (63), Expect = 5.8 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G GGG G G G GG G G Sbjct: 201 GPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GG GGG Sbjct: 229 GGGGGVWGNGGGGGGGGGYSGGG 251 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 35.1 bits (77), Expect = 0.12 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G GG G G G G G GG + GG Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G GGG G G GG GGG Sbjct: 145 GDGDGDGD-GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGG 190 Score = 33.1 bits (72), Expect = 0.47 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG GG GGG G G GG Sbjct: 162 GDDDDGDGGGSNGSGGGDD-GGDGGDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 29.5 bits (63), Expect = 5.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGG--XGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GG GG GGG Sbjct: 131 GDGDGDGD-GDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGG 178 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G G G GGG GG + GG Sbjct: 127 GDGDGDGD-GDGDGDGDGDGDGDGDGDGDGGG--SDDGGDDDDGDGG 170 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXP 1193 PPP PPP P PP PP P Sbjct: 32 PPPSPPPSPPPPSPPLDCP 50 Score = 35.1 bits (77), Expect = 0.12 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXP 1193 PPP PPP P PP PP P Sbjct: 155 PPPSPPPSPPPPSPPLDCP 173 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPP 1196 PPP PP PP P PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPP 1196 PPP PP PP P PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G GG G GG GGG G G GG Sbjct: 188 GRGGRGGRGGGRGAPRGRG-GPRGGGGGSGGYGGGSYGGYGNYGGYSQGG 236 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GGG RG G GGG Sbjct: 185 GAGGRGGRGGRGGG-RGAPRGRGGPRGGG 212 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G GG GG GGG GGG G GG E GGG Sbjct: 152 GMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 33.1 bits (72), Expect = 0.47 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 9/59 (15%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX------GXGGXGGXGXGGGXGG--GXRG-XXGGXEXXXGGG 1091 G G G G G GG G G GG GGG GG G G GG E GGG Sbjct: 180 GGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 31.9 bits (69), Expect = 1.1 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG GG GGG GG GG Sbjct: 136 GGMSMGGGMGGGMSMGGMG-GGMGGMMGGGSMGGGMMSMAGGGMGGGMGG 184 Score = 30.7 bits (66), Expect = 2.5 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXR--GXXGGXEXXXGGG 1091 GG G G GG GGG GGG G GG GGG Sbjct: 129 GGEGGMG-GGMSMGGGMGGGMSMGGMGGGMGGMMGGG 164 Score = 29.5 bits (63), Expect = 5.8 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXX-GGGGXGXXRGGGXGRGXXCXGX 817 GG G GGG GG G GGG G GGG G G G Sbjct: 136 GGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGME-GGM 194 Query: 816 GG 811 GG Sbjct: 195 GG 196 Score = 29.1 bits (62), Expect = 7.7 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXG 820 GG G G GGG GG G G G G GGG G G G Sbjct: 168 GGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNG 225 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.1 bits (77), Expect = 0.12 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGX-----GGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GGG GGG G GG + GGG Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 35.1 bits (77), Expect = 0.12 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +3 Query: 1098 PXXXSXPPXXP--LXPPPXPPPX-PXPPXPPXPXPPXXPXXP 1214 P + PP P L PPP PP P PP PP P P P Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP 1187 PP + PP P + PPP PP P PP P Sbjct: 183 PPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P P PPP P PP P PP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPP-PAPPGALIPPPPAPP 215 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 1131 LXPPPXPPPX-PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 L PPP PP PP PP PP P P P Sbjct: 177 LAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 30.3 bits (65), Expect(2) = 0.14 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P P PPP P PPPP Sbjct: 169 PNPSPPPSGAPPPPPP 184 Score = 23.4 bits (48), Expect(2) = 0.14 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 944 PPXPPPPP 967 PP PPPPP Sbjct: 179 PPPPPPPP 186 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 34.7 bits (76), Expect = 0.15 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXG 1118 GG GG G GGG GGG RG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGG 1115 GG GG G GGG GGG G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGG 1115 GG G GGG GGG G GG Sbjct: 514 GGGGGGGGGGGGGGGGRGG 532 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 1164 RGXGGGEXGGXGGXXGGR 1111 RG GGG GG GG GGR Sbjct: 513 RGGGGGGGGGGGGGGGGR 530 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPP-PRXX-PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P PP P P PPPP P PP PPPP Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 Score = 33.9 bits (74), Expect = 0.27 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP----PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P PPP P PP P P P P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 33.5 bits (73), Expect = 0.36 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXPPXXPXXPXXXP 1226 P + PP PPP PP P PP PP P PP P P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPP-PPPPLPPAMPAMDDLLP 329 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP PP P P P P P Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFY-SMPSSLPMPSPP 358 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 34.7 bits (76), Expect = 0.15 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP-PXPPPPPXPXXXXX 988 PP P P+P PP P PPP P PPPPP Sbjct: 594 PPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPPPAGYPGYG 653 Query: 989 PP 994 PP Sbjct: 654 PP 655 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 34.3 bits (75), Expect = 0.20 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPX--PPXPXPPXXPXXPXXXPXPXXP 1241 P + PP + PP PPP PP PP P P P P P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 33.9 bits (74), Expect = 0.27 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP P P+ P PPP PP PP PP P P Sbjct: 253 PPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 31.1 bits (67), Expect = 1.9 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G PP P H P P PP P PP P PP PP P Sbjct: 239 GAPPPP-HSMPPPGMPP---PGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQ 294 Query: 986 XPP 994 PP Sbjct: 295 PPP 297 Score = 30.3 bits (65), Expect = 3.3 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 11/61 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXP---LXPPPXPPPX--------PXPPXPPXPXPPXXPXXPXXXPXPXX 1238 PPP PP P + PPP PP P P PP P PP P P Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPP-PMPPGGMPPNMEQPPPPP 299 Query: 1239 P 1241 P Sbjct: 300 P 300 Score = 29.5 bits (63), Expect = 5.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A P S PP P PP PP PP PP P P P P Sbjct: 212 ADAPPIQTSTSLPPMIPPVGMLGHPPMGAPP-PPHSMPPPGMPPPGMMPPPGFP 264 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP PP PP PP P P P Sbjct: 228 PPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMP 280 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 34.3 bits (75), Expect = 0.20 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PP PPP PP P P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 30.3 bits (65), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P P PP P P PP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP P PP P PP P P P P Sbjct: 660 PPPP----PPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 A PPP PPP PPP P PP P PP P P Sbjct: 658 AGPPPPPPPPPGGQAGGAPPPP-PPPLPGGAAPP-PPPPIGGGAPPPPP 704 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 PXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 P PP Q PP PP P GG APP Sbjct: 665 PPPPGGQAGGAPPPPP---PPLPGGAAPP 690 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P PP PP PP P P P PP P P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P PP P P P PP P P PP P P P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNP-PVPPTNPPAPPTNP 256 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P PP P PP P P P P P P Sbjct: 209 PGNGVVPTQAPRPPTTQTPPTKAPTDPPVP-PTNPPVPPTNPPAP 252 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 34.3 bits (75), Expect = 0.20 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P PPP P P P P PP P Sbjct: 284 PPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 32.3 bits (70), Expect = 0.82 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PL PPP P P PP P P P P Sbjct: 281 PPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPP--PRXXPXPPPPXXXP 895 PP H P PP P P PPPP P Sbjct: 293 PPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 34.3 bits (75), Expect = 0.20 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PPP S PP P PPP P P P P Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.20 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 1204 GXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G G G G GGG GGG G G GG Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGG 40 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 34.3 bits (75), Expect = 0.20 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G G + GGG Sbjct: 420 GAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGG 460 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG----GGXGGGXR 1130 G G G G GG G GG G G GG GGG R Sbjct: 424 GSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGSR 464 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G GG GG G GG G G Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFG 452 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 33.9 bits (74), Expect = 0.27 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG---GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G G GGG GG GGG Sbjct: 273 GRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGG 322 Score = 31.5 bits (68), Expect = 1.4 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG-----GGGXGXXRGGGXGRG 835 G G GGG G G RG G GGG G +GGG GRG Sbjct: 253 GRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 303 Score = 30.7 bits (66), Expect = 2.5 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G G GGG G G RG GGG G +GGG GRG Sbjct: 316 GRGPGGGWGRMQGGGMGRGPGGGLGRGP---GGGWGRMQGGGMGRG 358 Score = 29.9 bits (64), Expect = 4.4 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -1 Query: 990 GXXXXXGXGGGGGXG---GXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXGRGXXCX 823 G G G GGG G G G G GGG G +GGG GRG Sbjct: 279 GPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPG-G 337 Query: 822 GXGGXP 805 G G P Sbjct: 338 GLGRGP 343 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 33.9 bits (74), Expect = 0.27 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GGG GG G G GGG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGG 144 Score = 31.5 bits (68), Expect = 1.4 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGG-XGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG GG G G GGG Sbjct: 123 GGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGG 173 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GGG G G G G Sbjct: 236 GDGDGDGD-GDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDG 281 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G G G GGG GGG G G + G Sbjct: 307 GDGDGDGD-GDGDGDGDGDGDGDG-GGGDGGGDDGGDGDGDGDGDG 350 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 33.9 bits (74), Expect = 0.27 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 P P + P P PP PPP P P PP Sbjct: 343 PQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 31.5 bits (68), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P P PP P PP PP P P Sbjct: 348 PTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 31.1 bits (67), Expect = 1.9 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 1080 AXXXPPPXXXSXP-PXXPLXPPPXPP---PXPXPPXPPXPXPPXXP 1205 A PP S P P P P P P PP PP P PP P Sbjct: 326 ATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.9 bits (74), Expect = 0.27 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GGG GGG G + GGG Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 Score = 32.3 bits (70), Expect = 0.82 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GGG GGG G GGG Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 Score = 29.5 bits (63), Expect = 5.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GGG G GGG Sbjct: 348 GDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGG 398 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G GGG G G GG GGG Sbjct: 343 GYNGGPSPGAVGGFG-GGGGGSEDNGASGGGGGYSGGG 379 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGG--XGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G G G GGG GG G GG Sbjct: 347 GPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGG 392 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 33.5 bits (73), Expect = 0.36 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G GGG G G GG GGG Sbjct: 213 GYNGGPAPGAVGGFGGGGG-GSEDNGASGGGGGYSGGG 249 Score = 33.5 bits (73), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGG--XGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G G G GGG GG G G GG Sbjct: 217 GPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXG-GKKXGXRG 284 GG GGP P GGGGG GGGG G G G G Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAG 258 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.5 bits (73), Expect = 0.36 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPP 1181 PPP PPP P PP PP Sbjct: 162 PPPQPPPPPLPPPPP 176 Score = 30.7 bits (66), Expect = 2.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXPL 1165 PP PP PP PPP P+ Sbjct: 162 PPPQPPPPPLPPPPPPI 178 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P P PPP P PPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPP 1196 PPP P PP P P PP Sbjct: 162 PPPQPPPPPLPPPPPP 177 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.36 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 10/64 (15%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP-----PPXXXPRXXXXXXXXXXXXXXXPPXP-----PP 961 PP P P+P PP+ P PP PP PP P PP Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPP 810 Query: 962 PPXP 973 PP P Sbjct: 811 PPPP 814 Score = 33.1 bits (72), Expect = 0.47 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP PP P+ PP P P PP P P P P P P P Sbjct: 764 PPQFAPVPPPCAPI--PPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPP 812 Score = 32.3 bits (70), Expect = 0.82 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP PL PP P P PP PP P P P P Sbjct: 740 PSEVTTKSPPAPPL-PPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP 788 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP P P P P P P P PP P P P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP 790 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP + PP P P P P P PP P P P Sbjct: 646 PPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP + P + PP P P P PP P P P Sbjct: 620 PPQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSP 664 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 33.1 bits (72), Expect = 0.47 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GGG G G G GGG Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G G G G GGG GG G GG Sbjct: 432 GGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG--GSTGG 468 Score = 29.5 bits (63), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXG----GXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 G G G G G G G G G G GG GGG G G G Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 33.1 bits (72), Expect = 0.47 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGGXP 805 G G GG GG G G GG G G G G G G GG P Sbjct: 222 GAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGGIP 277 Score = 33.1 bits (72), Expect = 0.47 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG-------GXGGGXRGXXG 1118 G G G G G G G GG GG G GG G GGG G G Sbjct: 228 GLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAGAGIGGGVIGTGG 275 >SB_28604| Best HMM Match : FerB (HMM E-Value=5.19994e-41) Length = 687 Score = 33.1 bits (72), Expect = 0.47 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXP 1187 P P PP PPP P P PP P Sbjct: 7 PLVPKAPPEQPPPAPKEPKPPKP 29 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.1 bits (72), Expect = 0.47 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX-------GXGGGXGGG-XRGXXGG 1115 G G G G G GG GG GG G GGG GGG G GG Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGG 319 Score = 30.7 bits (66), Expect = 2.5 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG GG GGG G G GGG Sbjct: 261 GKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGG 311 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 33.1 bits (72), Expect = 0.47 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PL PP PP PP PP P P Sbjct: 1259 PPLPPLPPPDAQPPS-LPPQPPQPPQP 1284 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.5 bits (68), Expect = 1.4 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 827 HXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 H P P PP P PP P PP PP PP P Sbjct: 1420 HMAPAPPPPMAFPPMPPAPGQV--ITHLQHIVHHKILPPPPPPPAPPCP 1466 Score = 26.6 bits (56), Expect(2) = 0.59 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXP 1187 P PPP PP PP P Sbjct: 1423 PAPPPPMAFPPMPPAP 1438 Score = 24.6 bits (51), Expect(2) = 0.59 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 1167 PPXPPXPXPPXXP 1205 PP PP P PP P Sbjct: 1455 PPPPPPPAPPCPP 1467 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXPXXP 1214 P PPP PP P P PP P P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 30.3 bits (65), Expect = 3.3 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPP-XPXPP 1196 PPP PP P P PP P PP Sbjct: 305 PPPQTPPPPQTPAPPQTPAPP 325 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 32.7 bits (71), Expect = 0.62 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PPP P PP P P P Sbjct: 84 PPPPPPPASNVPAPPPPPPVMPP 106 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +3 Query: 1119 PXXPLXPPPXPPP----XPXPPXPPXPXPP 1196 P + PPP PPP P PP PP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 32.7 bits (71), Expect = 0.62 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 1116 PPXXPLXPPPXPPP---XPXPPXPPXPXP 1193 PP P PPP PPP P P PP P Sbjct: 180 PPLNPYQPPPFPPPHLMYPQPTAPPAAIP 208 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 32.7 bits (71), Expect = 0.62 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP L P P P P P P PP P P P P Sbjct: 43 SPPPATALCPTPCYGPVPHPLLRPCVPPPATALVPHPLPRPCAP 86 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 32.7 bits (71), Expect = 0.62 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GGG GGG G G GG Sbjct: 142 GGGGYRG--GYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGG 186 Score = 30.3 bits (65), Expect = 3.3 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GGGGG G G RG GGGG G G G G G G G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEG---GYGMGGGDYSGGCG 188 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.62 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + PP P+ P PPP P P P P P P P P Sbjct: 54 PPNIPIPGNPPPNTPI--PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP 103 Score = 32.3 bits (70), Expect = 0.82 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P+ P PPP P P P P P P P P Sbjct: 44 PPNTPIPGDPPPNIPI--PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNP 93 Score = 31.9 bits (69), Expect = 1.1 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P+ P PPP P P P P P P P P Sbjct: 64 PPNTPIPGDPPPNTPI--PGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDP 113 Score = 30.3 bits (65), Expect = 3.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXX--SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP P P PP P P P P P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPP-PNIPIPGNPPPNTPIPGDP 73 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P+ P PPP P P P P P P P Sbjct: 74 PPNTPIPGDPPPNTPI--PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDP 123 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 32.7 bits (71), Expect = 0.62 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP-XXPXXXPXP 1232 PP PP P P P P PP P P PP P P P P Sbjct: 328 PPLPSRYPPSPPRYPSSHPRYPPSPPRYP-PSPPRYPSSHPRYPPSP 373 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP--PXPXPPXPPXP--XPPXXPXXPXXXP 1226 PP PP P PP PP P P PP P PP P P P Sbjct: 321 PPSPIRYPP-LPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHP 367 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP PP P P PP P P P Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYP-PSPPRYPPSPPRYP 307 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP P P PP P P P P P Sbjct: 335 PPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSP 380 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P P PP PP P P PP P P P Sbjct: 261 PPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PP P PP PP P P PP Sbjct: 289 PPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPP 322 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 32.3 bits (70), Expect = 0.82 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPP 1196 P PPP P P PP P PP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXP 1187 PP PP P PP PP P Sbjct: 463 PPPPPMSPPPPTPPPP 478 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 32.3 bits (70), Expect = 0.82 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1168 GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GGG GGG G GG GGG Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGG 393 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.3 bits (70), Expect = 0.82 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGG-GGPXXXLXXGGGGXXXXXGGKKXGXRG 284 GG GGGPP GG GGP G G GG G RG Sbjct: 486 GGYDDYYGGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRG 536 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 32.3 bits (70), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 263 GGGGACGCNGGGAGGGGGYSGGG 285 Score = 30.3 bits (65), Expect = 3.3 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX--GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G GGG G G GG GGG Sbjct: 234 GSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSGGG 285 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 32.3 bits (70), Expect = 0.82 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-XPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP P P PPP PP PP PP PP P P Sbjct: 33 PPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP---XPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PP + PP + PP PPP PP PP PP P P Sbjct: 27 PPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXP-XPPXXPXXPXXXPXPXXP 1241 P + P P P P PPP P PP P PP P P P Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQP 64 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 32.3 bits (70), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GGG GGG Sbjct: 154 GGGGRGGGRGHGRGGGSGGG 173 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGGXGRGXXC 826 RG GGG G RGGG G G C Sbjct: 153 RGGGGRGGGRGHGRGGGSGGGGNC 176 >SB_51557| Best HMM Match : Collagen (HMM E-Value=0.56) Length = 697 Score = 31.9 bits (69), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G GG GGG G G GG Sbjct: 473 GMGGGANGMAGGMNGMGGGMDDMAGGMGGGMNGMGAGMNAMGGG 516 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.5 bits (68), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXP 1193 PPP PPP P PP P P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 1149 PPPXPXPPXPPXP-XPPXXP 1205 PPP P PP PP P PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 29.1 bits (62), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXP 1187 PP PPP P PP P P Sbjct: 142 PPPPPPPPSPPPPCHP 157 >SB_53480| Best HMM Match : Sigma70_r1_1 (HMM E-Value=5.7) Length = 402 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G G G G G G G G G G GGG GGG G G E Sbjct: 62 GDDGDGDGDGD-GDGDGDGDGDGDGDGDGGGGGGGD-GDGDGDE 103 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 31.5 bits (68), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P PP P P P P P P PP P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P P PP P PP P P P P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 31.1 bits (67), Expect = 1.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PP P PP PPP PP P P P Sbjct: 1579 PPPTP-SPPQTPPPVNTPPRPETPEP 1603 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 1143 PXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P PP PP P P P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRP-PTPRPRPPTPRPGPPTP 1385 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXP-PXPPXPXP-PXXP 1205 P P PP PP P P P PP P P P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 S P P PP P P P PP P P PP Sbjct: 1356 STPRPRPPTPPRPPTPRPRPP-TPRPGPP 1383 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 P+ P P P P PP PP P P P P P P Sbjct: 1353 PIPSTPRPRP-PTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPP 881 RPP PP P P P P PP Sbjct: 1361 RPPTPPRPPTPRPRPPTPRPGPP 1383 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP S P PPP P P P PP P P Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPP 351 Score = 31.5 bits (68), Expect = 1.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXP--XPPXXPXXPXXXPXPXXP 1241 PPP P PPP PP PP P PP P P P P P Sbjct: 386 PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 +P P + PPPP F PPPPP Sbjct: 411 APSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 318 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 361 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 325 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 368 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 382 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 346 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 353 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP---PPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P P P PP P P PP P P P Sbjct: 367 PPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEP 413 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.5 bits (68), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 1128 PLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXP 1226 P PP PP P P P PP P P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 Score = 30.3 bits (65), Expect = 3.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP 880 PP P P+P PPPR P P Sbjct: 526 PPSPPAPPPKPAPPPRSPPAAAP 548 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXP 1193 P S P P PP PP P P P PP P Sbjct: 515 PSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAP 548 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 84 PPHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 127 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 91 PPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 134 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 148 Score = 31.5 bits (68), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 112 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP P P P P P P P P Sbjct: 119 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 3/47 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP---PPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P P P PP P P PP P P P Sbjct: 133 PPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPHEP 179 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 1095 PPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P P PL P PPP P PP PP Sbjct: 1336 PPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPP 1370 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PL P P P P P PP PP P P P Sbjct: 1324 PANYVPPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPP 1371 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXX-PLXPP--PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP PL P P PP PP P PP P P P Sbjct: 1329 PPWELPLPPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIPLP 1377 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP P PP P P P PP PP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 Score = 29.5 bits (63), Expect = 5.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP 1157 PP PP PL PP PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPP 49 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 31.1 bits (67), Expect = 1.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G GGG G G G + GGG Sbjct: 557 GGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGG 594 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPP 1172 P PP P PPP PPP PP Sbjct: 122 PSGPRAPPGGPGAPPPPPPPAVVPP 146 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 31.1 bits (67), Expect = 1.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP PP P P P PP P P P Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAP 818 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPP 1196 PPP PP PP P PP P P PP Sbjct: 784 PPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 31.1 bits (67), Expect = 1.9 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGG 1136 G GG GG G GGG GGG Sbjct: 84 GDGGGGGDGGGGGDGGG 100 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.1 bits (67), Expect = 1.9 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXP-XPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXX 985 P P PR PP P PPP PR P P PPP P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRV 501 Query: 986 XPP 994 PP Sbjct: 502 PPP 504 Score = 31.1 bits (67), Expect = 1.9 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXP-XPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXX 985 P P PR PP P PPP PR P P PPP P Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKV 601 Query: 986 XPP 994 PP Sbjct: 602 PPP 604 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVP 512 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 542 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 552 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVP 582 Score = 30.7 bits (66), Expect = 2.5 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P P P Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVP 602 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P P PPP P P P P P P P P Sbjct: 423 PPGAPHPRVPPPGAP--HPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 472 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P P PPP P P P P P P P P Sbjct: 433 PPGAPHPRFPPPGAP--HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 482 Score = 29.5 bits (63), Expect = 5.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP--PXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PP P P P P P P P P P P Sbjct: 412 PPPGASHQRVRPPGAPHPRVPP-PGAPHPRFPPPGAPHPRVPPPGAPHPRVP 462 Score = 29.1 bits (62), Expect = 7.7 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP---XPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPX 976 P P P P PP P PPP PR P P PPP P Sbjct: 429 PRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 488 Query: 977 XXXXPP 994 PP Sbjct: 489 PRVPPP 494 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P PPP P P P P P P P P Sbjct: 543 PPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVP 592 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.1 bits (67), Expect = 1.9 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P P P P P P P P P P P P P P Sbjct: 254 PEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP-EPVHVPEP 300 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P P P P P P P P P P P P Sbjct: 246 PPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEP-EPEPEPEP 290 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.1 bits (67), Expect = 1.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG GG GG GGG G GG G Sbjct: 7 GDGDGEG-GGDGGDSGGGSDGGGDGGDGGGGSDGGDG 42 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 30.7 bits (66), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPP 1196 PP PPP P PP P P P Sbjct: 147 PPRTPPPEPTPPPTPPPLRP 166 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +3 Query: 1137 PPPXPPPXPXPPX---PPXPXPPXXP 1205 PPP PPP P PP P PP P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNP 30 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P+ PP P PP P P P Sbjct: 5 PPPP----PPPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PP + PP P PP PP P PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PP PP P PP P P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GGG G G GGG Sbjct: 513 GDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXG 308 GG GGPPP G GGG GGGG G Sbjct: 257 GGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGG 298 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGX--GGXGXGGGXGGGXRG 1127 G G G GG G G G G GGG GG G Sbjct: 266 GPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSG 300 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP P P P P PP P P P Sbjct: 451 PPRVEHVPFPIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYPVPVP 496 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S P P+ PP P P P P P PP P P P Sbjct: 393 PVEGFSPPDMVPMPGPPRPVPIPFP--VPVNHPPRVEHVPFPVPVEGPP 439 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP-XPPXPXPPXXP 1205 P P PP P P P P P PP P P P P Sbjct: 458 PFPIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYPVPVP 496 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.7 bits (66), Expect = 2.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGG 1139 GG G GG GG G GG GG Sbjct: 20 GGGGLGGSGGSGGSGGSGG 38 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.7 bits (66), Expect = 2.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-XPPPXPXPP--XPPXPXPPXXP 1205 PPP P+ PP PPP PP PP PP P Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGP 2214 >SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27) Length = 527 Score = 30.7 bits (66), Expect = 2.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPP 1196 PP PP PL PP PP P P P PP Sbjct: 226 PPNSSRLSPPLSPLNGPPSPPLTEPSSPLPTSLTPP 261 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 30.7 bits (66), Expect = 2.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P PPP PP P P PP P P Sbjct: 124 PRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 29.9 bits (64), Expect = 4.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +2 Query: 815 PXPXHXXPRPXPPP----RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 P P PRP P R P PPPP P+ PP P PP Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPPPTP-PQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP P P PPP P P PP Sbjct: 138 PPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 1137 PPPXPPPXPXPPXP 1178 PPP PPP P PP P Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 1140 PPXPPPXPXPPXPP 1181 PP PPP P PP PP Sbjct: 211 PPPPPPPPPPPPPP 224 >SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 30.7 bits (66), Expect = 2.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P + P P P P P P P P P PP P Sbjct: 252 PSNPTATQPQNPAIPQPQNPAIPQLPNPAIPQPPNPP 288 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GG + GGG Sbjct: 4 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGG 54 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GG + GGG Sbjct: 44 GDDGGGGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGGNDDDDGGG 94 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 30.3 bits (65), Expect = 3.3 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-----PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P PP P P PP PP P PP P P P Sbjct: 604 PPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTP-PPRQSTPPPLLLIPLLP 657 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 3.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P+P PPP P PPPP Sbjct: 75 PQPTPPPPRPPTPPPP 90 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPP 1196 P P P PP PP P PP Sbjct: 75 PQPTPPPPRPPTPPPP 90 Score = 29.5 bits (63), Expect = 5.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXP 1187 PP PP P PP PP P Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 30.3 bits (65), Expect = 3.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRG--XXGGXEXXXGGG 1091 G G GG G G GG GGG G GG GG Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGG 159 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.3 bits (65), Expect = 3.3 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXP---PXPPXPXPPXXPXXP 1214 PPP PP P + P PPP P P PP PP P Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPP 407 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPP 1196 PP P PL PPP PPP PP PP Sbjct: 384 PPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPP 421 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 30.3 bits (65), Expect = 3.3 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 1119 PXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P+ PP P PP PP PP P P P P Sbjct: 405 PPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 26.2 bits (55), Expect(2) = 4.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P + P PP PPP PR PP P P Sbjct: 149 PPPPTYLHPSQYPPS------PPPWELPRVPSANATLPPHLQYGPPPPTSP 193 Score = 22.2 bits (45), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPP P P Sbjct: 219 PPGPPPGPPP 228 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GG GGG Sbjct: 154 GGGGRGGGRGHGRGGSGGGG 173 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PL PPP P P P P P PP P P P P Sbjct: 682 PLTPPP-PLPTPIASSEPLPLPP--PPPPTGIDIPHSP 716 Score = 29.5 bits (63), Expect = 5.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPP----XPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP P PPP P P P P P PP P P P P P Sbjct: 679 SKPPLTP--PPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPP 725 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 G G G G G GGG GGG G GG + G Sbjct: 336 GDGSGDRGFLGGGGG-GGGSSGGGGGRDDESG 366 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGGXGR 838 RG GGGG G GGG GR Sbjct: 342 RGFLGGGGGGGGSSGGGGGR 361 >SB_30560| Best HMM Match : Herpes_UL73 (HMM E-Value=4.5) Length = 87 Score = 29.9 bits (64), Expect = 4.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXP 1187 PP P P P PP PP P Sbjct: 43 PPSPSPSPSPPSPPTP 58 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PPP PP P+ P PPP P P P Sbjct: 218 PPPPTTGAPPPTPVTNKP-PPPRPATTQAPPP 248 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXP 1214 P PP PPP PPP P PP P P P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 A PPP + PP PP P P PP P Sbjct: 215 AAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GG GGG Sbjct: 71 GGGGRGGGRGHGRGGSGGGG 90 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GG GGG Sbjct: 324 GGGGRGGGRGRGRGGSGGGG 343 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 +G G GG G RGGG GRG G GG Sbjct: 317 QGPVRGRGGGG--RGGGRGRGRGGSGGGG 343 >SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) Length = 229 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GG GGG Sbjct: 124 GGGGRGGGRGYGRGGSGGGG 143 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 S PP P PP PP P P PP P Sbjct: 430 SHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 29.9 bits (64), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP P P P P P PP PP Sbjct: 432 PPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 806 GXPPX---PXHXXPRPXPPPRXXPXPPPP 883 G PP P H P P PPP P P P Sbjct: 421 GGPPGGGVPSHPPPLPQPPPSIIPPPTTP 449 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 29.9 bits (64), Expect = 4.4 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GGG GGG G GG GGG Sbjct: 1097 GGGQGMMMGNAMGGGMGGG-MGMQGGGMGMQGGG 1129 >SB_25894| Best HMM Match : Coatomer_WDAD (HMM E-Value=0) Length = 1066 Score = 29.9 bits (64), Expect = 4.4 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP + P P P P P P P P PP P Sbjct: 771 PPTTVINPPQAKPAEPEPLAPRPSSPQTQPAPAPPEPAAAP 811 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 29.9 bits (64), Expect = 4.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXG-GXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG G G G GGG Sbjct: 40 GGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGG 86 Score = 29.9 bits (64), Expect = 4.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXG-GXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG G G G GGG Sbjct: 120 GEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 Score = 29.5 bits (63), Expect = 5.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXG-GXGXGGXGGXGXGGGX-GGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG G G G GGG Sbjct: 60 GEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGG 106 >SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) Length = 851 Score = 29.9 bits (64), Expect = 4.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPP-XPXPPXPPXPXPP 1196 A PPP + PL PP PPP P P PP Sbjct: 246 ASRIPPPLLTTMSLDTPLAEPPAPPPTTPTSAGAPLSSPP 285 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 29.9 bits (64), Expect = 4.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 190 PPPMYPAFPPSFPFSPPPEYPGLP 213 >SB_738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P+ PP P PP P PP P Sbjct: 3 PPTNPIMSPPTNPIMSPP-TNPIMSPPTSPIMSPPTNP 39 Score = 29.9 bits (64), Expect = 4.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P+ PP P PP P PP P Sbjct: 11 PPTNPIMSPPTNPIMSPP-TSPIMSPPTNPIMSPPTNP 47 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 25.4 bits (53), Expect(2) = 4.5 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXP 895 P P P P P PPPP P Sbjct: 1904 PQPLDVNTNSCPTPPREPTPPPPPPTP 1930 Score = 22.6 bits (46), Expect(2) = 4.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPP P P Sbjct: 1923 PPPPPPTPLP 1932 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S P L PPP P P PP P P P P Sbjct: 149 SSTPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPPPSSSP 189 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 252 GXPLFXPXXXSPLXPXFFPPXXXXXPPPPXHN-XFXGPPPP 371 G P P P FPP PPP ++ F G PPP Sbjct: 283 GPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPP 323 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PL PP P P PP P P P P P P Sbjct: 95 PHRPLEPPRPQEPH-RPQEPPRPQEPHRPQEPHRPLEPPRP 134 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.5 bits (63), Expect = 5.8 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +3 Query: 1116 PPXXP--LXPPPX--PPPXPXPPX--PPX--PXPPXXPXXP 1214 PP P L PPP PPP PP PP P PP P P Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPP 248 Score = 29.1 bits (62), Expect = 7.7 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPX-PXPPXPPXPXPP 1196 PPP PP + P PP P PP P P PP Sbjct: 217 PPPGML--PPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 1204 GXXGGXGXGGX-GGXGXGGGXGGG 1136 G G G GG GG G GGG GGG Sbjct: 148 GPMRGRGGGGRRGGRGRGGGGGGG 171 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRG 1127 G G GG GG GG G GG GGG G Sbjct: 281 GSLVSLIGSAGGISASGGAGGSGGAGGVGGGGGG 314 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 29.5 bits (63), Expect = 5.8 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P + P P P+ P P P P P P P P P P P Sbjct: 63 PRPHRPTAPRPHDPIAPRPRSPHGPVAPRPHRPISP-RPHRPTTPP 107 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P PPP PPP P P P P P P Sbjct: 381 PPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVP 433 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P PPP PPP P P P P P P Sbjct: 439 PPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVP 491 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP + PPP P P P PP P P Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTP 377 >SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) Length = 172 Score = 29.5 bits (63), Expect = 5.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP S P PP P P PP P P P P Sbjct: 136 PPPVDNSD--FDPRRPPAPPKPGGAPPIPGRPPIPSRP 171 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 29.5 bits (63), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PPP P P P PPP P P P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.5 bits (63), Expect = 5.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 963 GGGGXGGXXXXXXXXXXXXGXXRGXXXGGG-GXGXXRGGGXGRG 835 GGGG G RG G G G G RG G GRG Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRG 61 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 29.5 bits (63), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXP 1205 PP PPP P PP P PP P Sbjct: 1166 PPQPPPVPSVQAPPAP-PPAPP 1186 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 29.5 bits (63), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 1116 PPXXPLXPPPX---PPPXPXPPXPPXPXPPXXP 1205 P P PPP PPP P PP PP P Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 29.1 bits (62), Expect = 7.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP-XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P PPR PPPP P P PPP P Sbjct: 3132 PPVPVSTEVEPMRPPRKMRAPPPPSTRIPDVRYRSSSQDSRDSDELPDILPPPKPPIKPK 3191 Query: 989 P 991 P Sbjct: 3192 P 3192 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GGG G G G + GGG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGG 143 >SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 P + P P+ P PPP P PP P Sbjct: 140 PSQTLATTPTAPMVTTPAPPPPPPPPLIP 168 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 29.1 bits (62), Expect = 7.7 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXG-GXGGXGXGGGXGGG 1136 G G G G G G G G G G G GGG GGG Sbjct: 242 GGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G GGG GGG GG Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRGG 829 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.1 bits (62), Expect = 7.7 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXX-PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P + PR P R P PPPP P PPPPP Sbjct: 33 PFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PPP P P PP P P P Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 190 PPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 29.1 bits (62), Expect = 7.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P PP P PPP P PP PP Sbjct: 150 PSITQPPPRHSPPQTPVPPPPPLPPFAQVSLPP 182 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 100 PPPMYPAFPPSFPSSPPPEYPGLP 123 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 153 PPPMYPAFPPSFPSSPPPEYPGLP 176 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 190 PPPMYPAFPPIFPSSPPPEYPGLP 213 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 29.1 bits (62), Expect = 7.7 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G GG G G G GG GGG G G + G Sbjct: 741 GEYNYHGGDDDGDGDGDGDGGSNGGGDGGGDGDGDGDGDG 780 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.1 bits (62), Expect = 7.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P P P P P P P PP PP P Sbjct: 160 PQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 29.1 bits (62), Expect = 7.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP + PP P PPP P P Sbjct: 190 PPPMYPAFPPSFPSSPPPEYPGLP 213 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,666,647 Number of Sequences: 59808 Number of extensions: 470473 Number of successful extensions: 18465 Number of sequences better than 10.0: 214 Number of HSP's better than 10.0 without gapping: 1244 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8669 length of database: 16,821,457 effective HSP length: 84 effective length of database: 11,797,585 effective search space used: 3881405465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -