BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J11 (1242 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 55 1e-07 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 54 1e-07 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 54 2e-07 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 50 4e-06 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 49 6e-06 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 49 7e-06 At3g51290.1 68416.m05614 proline-rich family protein 48 1e-05 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 47 3e-05 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 46 4e-05 At5g46730.1 68418.m05757 glycine-rich protein 46 5e-05 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 46 7e-05 At4g01985.1 68417.m00265 expressed protein 46 7e-05 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 46 7e-05 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 45 9e-05 At2g30560.1 68415.m03722 glycine-rich protein 45 1e-04 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 44 2e-04 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 44 2e-04 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 44 2e-04 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 44 3e-04 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 44 3e-04 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 44 3e-04 At2g05440.2 68415.m00575 glycine-rich protein 44 3e-04 At1g75550.1 68414.m08780 glycine-rich protein 44 3e-04 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 44 3e-04 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 43 4e-04 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 43 4e-04 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 43 5e-04 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 43 5e-04 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 43 5e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 43 5e-04 At1g61080.1 68414.m06877 proline-rich family protein 43 5e-04 At1g26150.1 68414.m03192 protein kinase family protein similar t... 43 5e-04 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 42 6e-04 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 42 6e-04 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 42 6e-04 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 42 6e-04 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 42 6e-04 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 42 8e-04 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 42 8e-04 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 42 8e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 8e-04 At1g29380.1 68414.m03592 hypothetical protein 42 8e-04 At1g27710.1 68414.m03387 glycine-rich protein 42 8e-04 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 42 0.001 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 41 0.001 At4g30460.1 68417.m04325 glycine-rich protein 41 0.001 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 41 0.001 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 41 0.002 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 41 0.002 At3g24550.1 68416.m03083 protein kinase family protein contains ... 41 0.002 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 41 0.002 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 41 0.002 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 40 0.003 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 40 0.003 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 40 0.003 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 40 0.003 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 40 0.003 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 40 0.003 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 40 0.003 At1g62240.1 68414.m07021 expressed protein 40 0.003 At1g10620.1 68414.m01204 protein kinase family protein contains ... 40 0.003 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 40 0.003 At5g38560.1 68418.m04662 protein kinase family protein contains ... 40 0.003 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.003 At2g05440.1 68415.m00574 glycine-rich protein 40 0.003 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 40 0.003 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 40 0.003 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 40 0.003 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 40 0.004 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 40 0.004 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 40 0.004 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 40 0.004 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 39 0.006 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 39 0.006 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 39 0.006 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 39 0.006 At1g11850.2 68414.m01364 expressed protein 39 0.006 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 39 0.006 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 39 0.008 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 39 0.008 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 39 0.008 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 39 0.008 At3g50180.1 68416.m05486 hypothetical protein 39 0.008 At2g05510.1 68415.m00583 glycine-rich protein 39 0.008 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 38 0.010 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 38 0.010 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 38 0.010 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 38 0.010 At2g11005.1 68415.m01177 glycine-rich protein 38 0.010 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.014 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 38 0.014 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 38 0.014 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.014 At1g70990.1 68414.m08190 proline-rich family protein 38 0.014 At1g15840.1 68414.m01901 expressed protein 38 0.014 At1g04660.1 68414.m00463 glycine-rich protein 38 0.014 At1g02710.1 68414.m00222 glycine-rich protein 38 0.014 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 38 0.018 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 38 0.018 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 38 0.018 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 38 0.018 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 37 0.024 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 37 0.024 At1g53625.1 68414.m06096 expressed protein 37 0.024 At1g04800.1 68414.m00476 glycine-rich protein 37 0.024 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 37 0.032 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.032 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 37 0.032 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 37 0.032 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 37 0.032 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 37 0.032 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 36 0.042 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 36 0.042 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 36 0.055 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 36 0.055 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 36 0.055 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 36 0.055 At1g77030.1 68414.m08970 glycine-rich protein 36 0.055 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 36 0.055 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 36 0.055 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 36 0.055 At4g16240.1 68417.m02464 hypothetical protein 35 0.096 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 35 0.096 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 35 0.096 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 35 0.096 At2g05530.1 68415.m00585 glycine-rich protein 35 0.096 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 35 0.096 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 35 0.096 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 35 0.13 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 35 0.13 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 35 0.13 At4g08230.1 68417.m01358 glycine-rich protein 35 0.13 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 35 0.13 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 35 0.13 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 35 0.13 At1g11850.1 68414.m01363 expressed protein 35 0.13 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 35 0.13 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 34 0.17 At4g33660.1 68417.m04781 expressed protein 34 0.17 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 34 0.17 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 34 0.17 At3g43583.1 68416.m04636 hypothetical protein 34 0.17 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 34 0.17 At2g05540.1 68415.m00586 glycine-rich protein 34 0.17 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 34 0.22 At4g37900.1 68417.m05360 glycine-rich protein 34 0.22 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 34 0.22 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 34 0.22 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 0.23 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 33 0.29 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 33 0.29 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 33 0.29 At4g34440.1 68417.m04894 protein kinase family protein contains ... 33 0.29 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 33 0.29 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 33 0.29 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 33 0.29 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 33 0.29 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 33 0.29 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 33 0.29 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 33 0.29 At1g35617.1 68414.m04424 hypothetical protein 33 0.29 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 33 0.29 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 33 0.29 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 33 0.29 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 33 0.29 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 27 0.31 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 33 0.39 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 33 0.39 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 33 0.39 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 33 0.39 At1g47660.1 68414.m05295 hypothetical protein 33 0.39 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.39 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 33 0.39 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 33 0.39 At4g21720.1 68417.m03145 expressed protein 32 0.46 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 33 0.51 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 33 0.51 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.51 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.51 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 33 0.51 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 33 0.51 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 33 0.51 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 33 0.51 At3g08630.1 68416.m01002 expressed protein 33 0.51 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.51 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 33 0.51 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.51 At1g23540.1 68414.m02960 protein kinase family protein contains ... 33 0.51 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 33 0.51 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 0.54 At5g61660.1 68418.m07736 glycine-rich protein 32 0.68 At5g56140.1 68418.m07003 KH domain-containing protein 32 0.68 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 32 0.68 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 32 0.68 At3g08640.1 68416.m01003 alphavirus core protein family contains... 32 0.68 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 32 0.68 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 32 0.68 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 32 0.68 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 32 0.68 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 32 0.68 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 0.68 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 0.86 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 32 0.90 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 32 0.90 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 32 0.90 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.90 At4g32340.1 68417.m04603 expressed protein 32 0.90 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 32 0.90 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 32 0.90 At3g44950.1 68416.m04843 glycine-rich protein 32 0.90 At3g18810.1 68416.m02389 protein kinase family protein contains ... 32 0.90 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 32 0.90 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 32 0.90 At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family... 32 0.90 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 32 0.90 At1g65440.1 68414.m07424 glycine-rich protein 32 0.90 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 32 0.90 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 32 0.90 At2g30505.1 68415.m03716 Expressed protein 29 0.92 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 30 1.1 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 31 1.2 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 31 1.2 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 31 1.2 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 31 1.2 At4g15460.1 68417.m02363 glycine-rich protein 31 1.2 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 31 1.2 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 31 1.2 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 1.2 At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein ... 31 1.2 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 1.2 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 1.2 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 31 1.6 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 31 1.6 At3g47400.1 68416.m05154 pectinesterase family protein similar t... 31 1.6 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 31 1.6 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 31 1.6 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 31 1.6 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 31 1.6 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 31 1.6 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 31 1.6 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 31 1.6 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 31 1.6 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 31 1.6 At5g11550.1 68418.m01347 expressed protein 29 2.0 At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-proly... 26 2.1 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 31 2.1 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 31 2.1 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 31 2.1 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 31 2.1 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 31 2.1 At1g53620.1 68414.m06094 glycine-rich protein 31 2.1 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 31 2.1 At5g62440.1 68418.m07837 expressed protein 30 2.7 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.7 At5g21160.1 68418.m02528 La domain-containing protein / proline-... 30 2.7 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 30 2.7 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 30 2.7 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 30 2.7 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 30 2.7 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 30 2.7 At4g21620.1 68417.m03134 glycine-rich protein 30 2.7 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 30 2.7 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 30 2.7 At1g15830.1 68414.m01900 expressed protein 30 2.7 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 26 3.5 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 26 3.5 At5g60980.2 68418.m07650 nuclear transport factor 2 (NTF2) famil... 30 3.6 At5g60980.1 68418.m07649 nuclear transport factor 2 (NTF2) famil... 30 3.6 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 3.6 At5g25420.1 68418.m03016 xanthine/uracil permease family protein... 30 3.6 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 30 3.6 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 30 3.6 At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat... 30 3.6 At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putat... 30 3.6 At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putat... 30 3.6 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 30 3.6 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 3.6 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 30 3.6 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 30 3.6 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 30 3.6 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 30 3.6 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 30 3.6 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 30 3.6 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 30 3.6 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 30 3.6 At1g07135.1 68414.m00759 glycine-rich protein 30 3.6 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 4.8 At5g55070.1 68418.m06864 2-oxoacid dehydrogenase family protein ... 29 4.8 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 4.8 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 4.8 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 4.8 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 29 4.8 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 4.8 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 4.8 At2g37860.2 68415.m04648 expressed protein 29 4.8 At2g37860.1 68415.m04647 expressed protein 29 4.8 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 29 4.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 29 4.8 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 4.8 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 4.8 At1g70180.2 68414.m08076 sterile alpha motif (SAM) domain-contai... 29 4.8 At1g70180.1 68414.m08075 sterile alpha motif (SAM) domain-contai... 29 4.8 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 29 4.8 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 29 4.8 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 24 5.4 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 29 6.3 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 29 6.3 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 29 6.3 At4g26480.1 68417.m03810 KH domain-containing protein qkI-7, Mus... 29 6.3 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 6.3 At4g15150.1 68417.m02326 glycine-rich protein 29 6.3 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 29 6.3 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 29 6.3 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 29 6.3 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 29 6.3 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 6.3 At3g10720.2 68416.m01291 pectinesterase, putative contains simil... 29 6.3 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 29 6.3 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 29 6.3 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 29 6.3 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 29 6.3 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 6.3 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 29 6.3 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 24 7.5 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 24 7.7 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 29 8.4 At5g58540.1 68418.m07330 protein kinase family protein contains ... 29 8.4 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 29 8.4 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 29 8.4 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 8.4 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 29 8.4 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 8.4 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 29 8.4 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 29 8.4 At3g06780.1 68416.m00805 glycine-rich protein 29 8.4 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 29 8.4 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 29 8.4 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 29 8.4 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 29 8.4 At1g73840.1 68414.m08549 hydroxyproline-rich glycoprotein family... 29 8.4 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 8.4 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 29 8.4 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 8.4 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 24 8.7 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 25 8.7 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 25 8.9 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 54.8 bits (126), Expect = 1e-07 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP P P PP PP P PP P P P P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 52.8 bits (121), Expect = 4e-07 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P PP P PP P P P P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 52.4 bits (120), Expect = 6e-07 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP PPP PP PP P PP P P P P Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 51.6 bits (118), Expect = 1e-06 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP PPP P PP PP P PP P P P P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 51.6 bits (118), Expect = 1e-06 Identities = 32/115 (27%), Positives = 32/115 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPP P PP PPPPP P P Sbjct: 443 PPPPPVYSPPPPPPP---PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Query: 992 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPP 1156 P PP PP P SPPP Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPP 554 Score = 51.6 bits (118), Expect = 1e-06 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP PP P PP P P P P Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 51.6 bits (118), Expect = 1e-06 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP P PP PP P PP P P P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P PP PP P PP P P P P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P P P PP P PP P P P P Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 51.2 bits (117), Expect = 1e-06 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PPP P P P P PP P P P P Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP--XPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP PP P PP PP P PP P P P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP PPP P PP P PP P P P P Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 48.8 bits (111), Expect = 7e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP PPP P PP PP P P P P P Sbjct: 475 PPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 48.0 bits (109), Expect = 1e-05 Identities = 36/144 (25%), Positives = 37/144 (25%), Gaps = 2/144 (1%) Frame = +3 Query: 816 PPPXTXPPAPXP-XPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 PPP + PP P P P PPPP P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPP 541 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXP-LXPPPXPPPXPXP 1169 P PPP PP P L PPP P P P Sbjct: 542 PHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSP 601 Query: 1170 PXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P P P Sbjct: 602 PPTPVYSPP--PPPPCIEPPPPPP 623 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + P P PPP PPPP P PP PPPPP P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPP------PPPPVYSPPPPPPPPPPPPPVYSPPP 484 Query: 992 P 994 P Sbjct: 485 P 485 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP PP PP P PP P P P Sbjct: 474 PPPPPVYSPP--PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 10/60 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--------PPPXPPPXP--XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PPP PP P PP PP P PP P P P P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP----PXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP PP P PP P P P PP P P P P P Sbjct: 420 PPTLTSPPPPSP-PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 44.8 bits (101), Expect = 1e-04 Identities = 36/146 (24%), Positives = 36/146 (24%), Gaps = 4/146 (2%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PPP PP P P P PPPP P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPP- 1172 PPP S PP P PPP PP P P Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSP--PPPHSPPPPIYPY 588 Query: 1173 --XPPXPXP-PXXPXXPXXXPXPXXP 1241 PP P P P P P P P Sbjct: 589 LSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP----XPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP PPP PP PP PP P P P Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP 643 Score = 43.6 bits (98), Expect = 3e-04 Identities = 36/143 (25%), Positives = 37/143 (25%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PPP P PPPP P PP PPPPP P P Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPP-----------VYSPPPPPPPPPPPPVYSPPP 468 Query: 992 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPPXPLXX 1171 P PP PP P SPPP P+ Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP---------PPPPPPPPVYSPPPPPVYS 519 Query: 1172 XXXXXXXXXXXXXXXXXPPPXLP 1240 PPP P Sbjct: 520 SPPPPPSPAPTPVYCTRPPPPPP 542 Score = 42.7 bits (96), Expect = 5e-04 Identities = 36/149 (24%), Positives = 37/149 (24%), Gaps = 6/149 (4%) Frame = +2 Query: 812 PPXPXHXXP--RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P P PPP P PPPP P PP PPPPP Sbjct: 412 PPAPIFSTPPTLTSPPP---PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP 468 Query: 986 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXP----PXPPXSPP 1153 PP PP P P PP SP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPA 528 Query: 1154 PXPLXXXXXXXXXXXXXXXXXXXPPPXLP 1240 P P+ PPP P Sbjct: 529 PTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP----PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P PPP P PP P PP P PP P P P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 40.3 bits (90), Expect = 0.003 Identities = 30/121 (24%), Positives = 30/121 (24%), Gaps = 4/121 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP--XPPPPPXPXXXX 985 PP P P PPP PPPP P PP PPPP P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYS 561 Query: 986 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPP--XSPPPX 1159 PP P PP PP PPP Sbjct: 562 SPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Query: 1160 P 1162 P Sbjct: 622 P 622 Score = 39.1 bits (87), Expect = 0.006 Identities = 29/112 (25%), Positives = 30/112 (26%), Gaps = 4/112 (3%) Frame = +2 Query: 842 PXPPPRXXPXPPPP----XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPPXXXXX 1009 P PPP P PPPP P PP PPPPP P PP Sbjct: 401 PLPPPSL-PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Query: 1010 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPPXPL 1165 P PP PP PPP P+ Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP--PVYSPPPPPPPPPPPPV 509 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP P PP PP P PP P P P P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPP 447 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPP-----PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P + PPP PP P P PP PP P P P Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PPP PP P PP P P P P Sbjct: 643 PPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPPP 374 P++ P P P + PP PPPP ++ PPPPP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP-PXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P + P PPP PPP P P PPPPP Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSS 640 Query: 989 PP 994 PP Sbjct: 641 PP 642 Score = 35.1 bits (77), Expect = 0.096 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 6/67 (8%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP------PPPXP 973 PP P P P P P PPPP P PP PP PPP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEP-----PPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Query: 974 XXXXXPP 994 PP Sbjct: 646 VYYSSPP 652 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 Query: 261 LFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 L P SP P + PP PPPP ++ PPPPP Sbjct: 423 LTSPPPPSPPPPVYSPPPPP-PPPPPVYSPPPPPPPPP 459 Score = 34.3 bits (75), Expect = 0.17 Identities = 33/148 (22%), Positives = 37/148 (25%), Gaps = 9/148 (6%) Frame = +3 Query: 816 PPPXTXPPA-PXPXPVXPXX-PPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 989 PPP + PP P P+ P PPPP Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSP 629 Query: 990 PPXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLX---PPPXP--- 1151 PP + PPP S PP + PPP P Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHY 689 Query: 1152 -PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P PP P P P Sbjct: 690 SSPPPPPSAPCEESPPPAPVVHHSPPPP 717 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPXPXXX 982 PP P + P PPP PPPP P P PPP P Sbjct: 652 PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVH 711 Query: 983 XXPP 994 PP Sbjct: 712 HSPP 715 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 258 PLFX--PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P+F P SP P PP PPPP PPPPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 33.9 bits (74), Expect = 0.22 Identities = 35/147 (23%), Positives = 36/147 (24%), Gaps = 8/147 (5%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVX-PXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 PPP PP+P P PV PPPP P Sbjct: 521 PPP---PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPL--XPPPXPPP--- 1157 P PPP PP P PP PPP Sbjct: 578 PHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVH 637 Query: 1158 XPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PP PP PP P P P Sbjct: 638 YSSPPPPPVYYSSPPPPPVYYSSPPPP 664 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PPP PPP P P PPPP P P Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSP 629 Query: 992 P 994 P Sbjct: 630 P 630 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P + PP PPPP PPPPP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 32.3 bits (70), Expect = 0.68 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPP 491 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP-----PPPPXPX 976 PP P P PPP PPPP P PP P PPP P Sbjct: 631 PPPPVVHYSSPPPPPVYYSSPPPP---PVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPV 687 Query: 977 XXXXPP 994 PP Sbjct: 688 HYSSPP 693 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P P P + PP PPPP PPPPP + Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPP---VYSPPPPPVY 518 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = +3 Query: 258 PLFXPXXXSP-LXPXFFPPXXXXXPPPPXHNX-FXGPPPPPXFF 383 P++ P P + P PP PPPP + PPPPP ++ Sbjct: 605 PVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYY 648 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX----PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ PPP P PP PP P P P P Sbjct: 622 PPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPP 675 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXP---XPPXXPXXPXXXPXP 1232 S P P+ P PP P PP PP P PP P P P Sbjct: 391 SVSPRPPVVTPLPPPSLPSPP-PPAPIFSTPPTLTSPPPPSPPP 433 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P++ P P P PP PPPP ++ PPPPP Sbjct: 493 PVYSPPPPPPPPP---PPPVYSPPPPPVYS---SPPPPP 525 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P P PP PPPP + PPPP Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPP 566 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P + P PPPP PPPPP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P + PP PPPP PP PP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P + P PPPP + PPP P Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 29.9 bits (64), Expect = 3.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPP + PPPPP ++ Sbjct: 633 PPVVHYSSPPPPPVYYSSPPPPPVYY 658 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 258 PLFXPXXXSPLXPX-FF--PPXXXXXPPPPXHNXFXGPPPPP 374 PL P SP P F PP PPP PPPPP Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP 442 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 286 PSXXXFSPPXPXXXXPPXXTTXSXAPXPPP 375 P +SPP P PP + P PPP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPP 460 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP PPPPP + Sbjct: 644 PPVYYSSPPPPPVYYSSPPPPPPVHY 669 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL--XPPPXPPPXP-XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P+ PP PP P PP P P P P P Sbjct: 674 PPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVHHSPPPPMVHHSPPPP 726 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PPP PPP P PP PP P PP P P P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 53.2 bits (122), Expect = 3e-07 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PPP PPP P PP PP P PP P P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 52.4 bits (120), Expect = 6e-07 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP P PP P P P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 52.4 bits (120), Expect = 6e-07 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP P P PP P P P P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 52.0 bits (119), Expect = 8e-07 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PP P PPP PPP P PP PP P P P P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 51.6 bits (118), Expect = 1e-06 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P P PPP PPP P PP PP P PP P P P P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 51.6 bits (118), Expect = 1e-06 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP P PPP PPP P PP PP P PP P P P Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P PPP PPP P PP PP P P P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 49.2 bits (112), Expect = 6e-06 Identities = 24/55 (43%), Positives = 24/55 (43%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP--XPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP PP PP P P P P P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPPP P PP PPP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPP-------PPPPYVYPSPPPPPPSPPPYVYPPP 428 Query: 992 P 994 P Sbjct: 429 P 429 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP PPP P PP P PP P P P Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP + PPP PP PP PP P P P P Sbjct: 420 PPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXX---PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP PPP PP PP P P P P P Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP 447 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP P P P P PP P P P Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + P P PPP P PPP P P PPP P P P Sbjct: 403 PPPPPYVYPSPPPPP---PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Query: 992 P 994 P Sbjct: 460 P 460 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXP-XXPXXXPXP 1232 PPP S PP + PPP PP P PP PP PP P P P P Sbjct: 413 PPPPPPSPPPY--VYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSP 459 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP + PPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P V P PP P Sbjct: 429 PPPYVYPPPPSPPYVYPPPPPSP 451 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX---PPPXPPP--XPXPPXPPXPXP 1193 PPP PP P PPP P P P PP P P Sbjct: 429 PPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTP 467 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 SP P PP PPPP PPPPP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P P PP PPPP PPPPP + Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P SP + PP PPP + PPPPP Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP + PP P P P PPP Sbjct: 415 PPPPSPPPYVYPPPPPPYVYPPP 437 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP + P PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P P P +P PPPP + PPPPP + Sbjct: 399 PPPPPPPPPYVYPSPP---PPPPSPPPYVYPPPPPPY 432 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFF 383 SP P PP PPPP + + PP PP + Sbjct: 412 SPPPPPPSPPPYVYPPPPPPY-VYPPPPSPPYVY 444 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 54.0 bits (124), Expect = 2e-07 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P PPP PPP PP PP P PP P P P P P Sbjct: 54 PEPEPADCPPPPP--PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 51.6 bits (118), Expect = 1e-06 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP PP PP P P P P Sbjct: 62 PPP-----PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PP PPP P PP P P P P P P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 50.0 bits (114), Expect = 3e-06 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P P PP P P PP P P P P Sbjct: 65 PPPPPCPPPPSPPPCPPP-PSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 50.0 bits (114), Expect = 3e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP PPP P PP P P P P P P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 49.2 bits (112), Expect = 6e-06 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP PP P PPP PPP PP PP P P P P P P Sbjct: 59 ADCPPPPPPPPCPP--PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S PP P PP PP P P PP PP P P P P Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P P PPPP P PP PPPP P P Sbjct: 47 PPSPS---PEPEPEPADCPPPPPPPPCP--PPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Query: 992 P 994 P Sbjct: 102 P 102 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P P PPP P PPP P PP PPP P PP Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPP--PSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP-PXPPPPPXP 973 PP P P P PPP P PPP P P P PP P P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP+P P P P PPPP Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPP 98 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP+P P P P PP P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSP 89 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPP 87 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXX--XPXPPXL 1242 P PPPP PP P P P PP L Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQL 94 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 49.6 bits (113), Expect = 4e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PPP PPP P PP PP P PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PP S PP P PPP PPP P PP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PPP PPP P PP PP P P P P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 42.7 bits (96), Expect = 5e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PP PP P PPP PPP P PP PP P Sbjct: 35 PPLFPQSPPPPP-PPPPPPPPPPPPPPPPPP 64 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP----XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP PP P P P P P P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 Score = 38.3 bits (85), Expect = 0.010 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP--------XPPPPP 967 PP P P PPP P PPPP P PP PPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Query: 968 XPXXXXXPP 994 P PP Sbjct: 95 QPPPRSQPP 103 Score = 36.3 bits (80), Expect = 0.042 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P P PP PP P PP P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 36.3 bits (80), Expect = 0.042 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 34.7 bits (76), Expect = 0.13 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 19/69 (27%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP----------PXPXPPX---------PPXPXPPXXPXXP 1214 PPP PP P PPP PP P P PP PP P PP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP 103 Query: 1215 XXXPXPXXP 1241 P P Sbjct: 104 PKPPQKNLP 112 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PL P PPP P P P P PP P P P Sbjct: 75 PPPPPPVTDMIKPLSSP--PPPQPPPRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP P PP P P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 1155 PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P PP P P P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPP 883 P P P PPPR P P PP Sbjct: 87 PLSSPPPPQPPPRSQPPPKPP 107 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 294 PXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P FP PPPP PPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 PL P PP PPPP PPPP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +3 Query: 792 HAXXXAXRPPPXTXPPAPXPXPVXPXXPPPP 884 H P P +P P P P PPPP Sbjct: 25 HCFLLVQSQDPPLFPQSPPPPPPPPPPPPPP 55 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 287 PLXXLFPPXXXXXPXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 PL PP P PP PP PP G PP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPP 77 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 49.2 bits (112), Expect = 6e-06 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PP PP PP PP PP P P P P P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPP--PPPPVYSPPPPPP 541 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP----XPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP PPP PP PP P P P P P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP--XPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP PPP P PP P P P P P P Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 568 Score = 45.6 bits (103), Expect = 7e-05 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P+ PP PPP PP PP P P P P Sbjct: 502 PPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 45.2 bits (102), Expect = 9e-05 Identities = 35/141 (24%), Positives = 36/141 (25%), Gaps = 2/141 (1%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PPP P P P PV PPPP PP Sbjct: 511 PPPPVYSPPPPP-PVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPX 1175 PPP S PP P+ PP PPP PP Sbjct: 570 VHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP--PVYSPPPPPPVHSPPP 627 Query: 1176 P--PXPXPPXXPXXPXXXPXP 1232 P P P P P P P Sbjct: 628 PVFSPPPPVHSPPPPVYSPPP 648 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPX--PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P H P P PPP PPPP P P PPPP P Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSP 625 Query: 986 XPP 994 PP Sbjct: 626 PPP 628 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP P P PP P P P P P P Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655 Score = 41.5 bits (93), Expect = 0.001 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 4/121 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP--PPPXPXXXX 985 PP P H P PPP P PPPP P P PP PP P Sbjct: 503 PPSPIHSPP---PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Query: 986 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPP--XXPPXPPXSPPPX 1159 PP PP PP P SPPP Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Query: 1160 P 1162 P Sbjct: 620 P 620 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP P P PP P P P P P P P Sbjct: 573 PPPPVHSPPPPV-YSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXP 1205 PPP S PP PPP PPP PP PP PP P Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P+ PP P P PP PP PP P P P P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPP--PPPPVYSPPPPPP 532 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP S PP P+ PP PPP PP PP PP P Sbjct: 639 PPPPVYSPPP--PVYSPP-PPPVKSPPPPPVYSPPLLP 673 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPX---PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 PP P H P P PPP PPPP P P PPPP Sbjct: 602 PPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSP 661 Query: 983 XXPP 994 PP Sbjct: 662 PPPP 665 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP---PPXPXXX 982 PP P H P P P P PPP P PP PPP PP P Sbjct: 494 PPPPVHSPP--PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHS 551 Query: 983 XXPP 994 PP Sbjct: 552 PPPP 555 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PP P P PP P P P P P P Sbjct: 580 PPPPVYSPPPP-PVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXP---PXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP PPP PP P P P P P P P P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLP 673 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P PP PP P P P Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PP P P PP P PP P P P Sbjct: 632 PPPPVHSPPP--PVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSP 679 Score = 37.1 bits (82), Expect = 0.024 Identities = 30/142 (21%), Positives = 31/142 (21%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PPP PP P P P PPP PP Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPX 1175 PP PP P+ PP PPP PP Sbjct: 613 VYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPP-PPPVYSPPL 671 Query: 1176 PPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P Sbjct: 672 LPPKMSSPPTQTPVNSPPPRTP 693 Score = 36.7 bits (81), Expect = 0.032 Identities = 32/143 (22%), Positives = 33/143 (23%), Gaps = 4/143 (2%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXX-PPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 PPP PP P P P PPPP P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPP-XPPPXPXP 1169 P PPP PP P+ PP PP P Sbjct: 620 PPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSP 679 Query: 1170 P--XPPXPXPPXXPXXPXXXPXP 1232 P P PP P P P Sbjct: 680 PTQTPVNSPPPRTPSQTVEAPPP 702 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRP--XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P H P P PPP PPP P PP PP P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMS 677 Query: 986 XPP 994 PP Sbjct: 678 SPP 680 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP-XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PP P P PP PP P P P Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP 596 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPP 374 P SP P F PP PPPP ++ PPPPP Sbjct: 620 PPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPP 374 P SP P PP PPPP H+ PPPPP Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P SP P + PP PPPP PPPPP + Sbjct: 634 PPVHSPPPPVYSPPPPVYSPPPP---PVKSPPPPPVY 667 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P+ P SP+ PP PPPP ++ PPPPP + Sbjct: 497 PVHSPPPPSPIHSPPPPPVYSPPPPPPVYSP---PPPPPVY 534 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P SP P PP PPPP ++ PPPPP Sbjct: 590 PPVHSPPPPVHSPPPPVHSPPPPVYSP---PPPPP 621 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPP 374 P P P PP PPPP H+ PPPPP Sbjct: 583 PVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP H+ PPPP Sbjct: 540 PPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 569 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP H+ PPPP Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 576 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PP P P P P P P P Sbjct: 447 PPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDP 481 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P++ P P P PP PPPP H+ PPPP Sbjct: 532 PVYSPP---PPPPVHSPPPPVHSPPPPVHS----PPPP 562 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXX-XPPPPXHNXFXGPPPP 371 P SP P + PP PPPP H+ PPPP Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPPVHS----PPPP 605 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P++ P P P PP PPPP H+ PPPP Sbjct: 612 PVYSPP---PPPPVHSPPPPVFSPPPPVHS----PPPP 642 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP PPPP Sbjct: 597 PPVHSPPPPVHSPPPPVYSPPPPP--PVHSPPPP 628 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 48.8 bits (111), Expect = 7e-06 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PL P PPP P PP P PP P P P P P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PPP P P P PP P P P P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 7/56 (12%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPP---PXPPPX----PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP P PPP P PP P P PP P P P P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P P PPP PP PP P PP Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP--PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PP P PP P P P P P P P Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 41.9 bits (94), Expect = 8e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 A P P S PP PL PPP PPP P PP Sbjct: 1098 ALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXP-PPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P PP P PPP P PP PPPPP P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 P PP PPP PP P PP P P PP P P P P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P P PP P P PP PP P P P Sbjct: 1084 PPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 37.1 bits (82), Expect = 0.024 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPX--PPPPPXPXXXX 985 PP P P P PP P PP P P PP PPPPP Sbjct: 1062 PPLPQESPP-PLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPS 1120 Query: 986 XPP 994 PP Sbjct: 1121 PPP 1123 Score = 35.5 bits (78), Expect = 0.073 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +2 Query: 815 PXPXHXXPRP-XPPPRXXPXPP-PPXXXPRXXXXXXXXXXXXXXXPPXPPPP--PXPXXX 982 P P P P PP P PP PP P PP PPPP P P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPL 1115 Query: 983 XXPP 994 PP Sbjct: 1116 SPPP 1119 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP-PPPPXPXXXXXP 991 P P P P PPP P PP P PP P PPP P P Sbjct: 1069 PPPLPPLP-PSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Query: 992 P 994 P Sbjct: 1128 P 1128 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP 961 PP P P P PP P PPPP P PPP Sbjct: 1104 PPPPSQPPPPPLSPPPSPPPPPPPPSQSLTTQLSIASHHQIPFQPGFPPP 1153 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPPP Sbjct: 1105 PPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PP P PP P PP PP P P P Sbjct: 1070 PPLP----PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Query: 992 P 994 P Sbjct: 1126 P 1126 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 48.4 bits (110), Expect = 1e-05 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +2 Query: 827 HXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 H P P PPP P PPPP P PP PPPPP P Sbjct: 66 HNPPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPP 114 Score = 34.3 bits (75), Expect = 0.17 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXPXXP 1214 PP P PP PP P PP P P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 13/60 (21%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-------------PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PL P PPP P PP PP P P P P Sbjct: 73 PPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFIPPPP 132 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPP 1181 P P P PPP P PP PP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPP 1196 P P PPP P P PP P P Sbjct: 69 PSPSPPPPPPPRPPPPPLSP 88 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPP 1181 P P PPP PP P PP P Sbjct: 68 PPSPSPPPPPPPRPPPPPLSP 88 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXP 1205 PP P P P PP P P PP P Sbjct: 68 PPSPSP-PPPPPPRPPPPPLSP 88 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXP 1187 PP PP P PP PP P Sbjct: 68 PPSPSPPPPPPPRPPPP 84 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 46.8 bits (106), Expect = 3e-05 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXP---XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PPP PPP P PP P P P P P P P P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPP--XXPXXPXXXPXPXXP 1241 PPP PP + PPP P P P PP P P PP P P P P P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP + PPP P P PP P PP P P P P P Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP-PPPTPYTP 138 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PP PPP PP PP P P P P P P Sbjct: 97 PPPPPTVKPPPPPYVKPP-PPPTVKPPPPPTPYTP-PPPTPYTPPPP 141 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP P PP P P P P Sbjct: 115 PPPTVKPPPPPTPYTPPP-PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPX--PPXPPXPXPPXXP-XXPXXXPXPXXP 1241 PPP PP PPP PPP P PP PP PP P P P P P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PP + PPP P P PP PP P PP P P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP--PPKPETCP 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP---PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P PPP PP PP PP P P P Sbjct: 69 PPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P+ PP P P P P PP P P P P P Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPPP-PTPYPPPPKPETCP 182 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXP-LXPP---PXPPP-XPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + PP P + PP P PP P PP P P PP P P P P Sbjct: 41 PPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPP 91 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP P P PP PP PP P P P Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP 113 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PPP P PPPP PP PPP P P Sbjct: 56 PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPP 115 Query: 992 P 994 P Sbjct: 116 P 116 Score = 37.9 bits (84), Expect = 0.014 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP----XPPPPPXPXX 979 PP P + +P PPP P PPP P PP PPP P P Sbjct: 105 PPPPPYV--KPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEA 162 Query: 980 XXXPP 994 PP Sbjct: 163 PCPPP 167 Score = 37.9 bits (84), Expect = 0.014 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-----PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPX 976 PP P P P P P P P PPP P P PPPPP P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172 Query: 977 XXXXPP 994 P Sbjct: 173 PPPPKP 178 Score = 37.5 bits (83), Expect = 0.018 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXP------RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPP 967 PP P + P +P PPP P PPPP P PP P PPP Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKP-PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Query: 968 XPXXXXXPP 994 P PP Sbjct: 148 PPVVTPPPP 156 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P P P P P P P P P P Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 36.7 bits (81), Expect = 0.032 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPPP Sbjct: 147 PPPVVTPPPPTPTPEAPCPPPPP 169 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP P PP P P PP PP P P P Sbjct: 56 PPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP 105 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXP 1232 PP PP PPP P P P P PP P P P P P Sbjct: 84 PPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P PP P PP P PP P P P Sbjct: 61 PKPPTVKPPP--PYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP P PP P PP P P P Sbjct: 84 PPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 33.9 bits (74), Expect = 0.22 Identities = 30/123 (24%), Positives = 32/123 (26%), Gaps = 5/123 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP-PPXXXPRXXXXXXXXXXXXXXXPPXPPPP--PXPXXX 982 PP P P P PP+ PP PP P P PPPP P P Sbjct: 31 PPKPS---PHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTV 87 Query: 983 XXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRP--PXXPPXPPXSPPP 1156 PP P P PP P PPP Sbjct: 88 KPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Query: 1157 XPL 1165 P+ Sbjct: 148 PPV 150 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P PP P P Sbjct: 155 PPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPX--PPX--PXPPXXPXXPXXXPXPXXP 1241 P P+ PP P P PP PP P PP P P P P Sbjct: 34 PSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPP 79 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPX-PPXPPXPXPP-XXPXXPXXXPXP 1232 P P P PP P PP PP PP P P P P Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPP 70 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP T P P P P P P P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTP 135 Score = 29.1 bits (62), Expect = 6.3 Identities = 28/121 (23%), Positives = 30/121 (24%), Gaps = 3/121 (2%) Frame = +2 Query: 812 PPXPXHXXP---RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 PP P P +P PPP P PPP P PP PPP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP-------PPPYVKPPPPPTVKPPPPPTPY 128 Query: 983 XXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPPXP 1162 PP PP P PP P P Sbjct: 129 TPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPP------PPPTPYPPPPKPETCP 182 Query: 1163 L 1165 + Sbjct: 183 I 183 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 286 PSXXXFSPPXPXXXXPPXXTTXSXAPXPPP 375 P PP P PP T AP PPP Sbjct: 138 PPPPTVKPPPPPVVTPPPPTPTPEAPCPPP 167 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXPXXP 1241 PPP PP P P P P P PP P P P P P P P P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 45.2 bits (102), Expect = 9e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP--PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PP P P P P PP P P PP P P P P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP-KPVPCPSPPKP 104 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P P P P P P P P P P P P P P Sbjct: 34 PPPKPQPKPPPAP-SPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP+ P P PP P P PPP P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Query: 992 P 994 P Sbjct: 102 P 102 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP-PXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P+P PPP P PPP P P P PPP P P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPA 128 Query: 989 P 991 P Sbjct: 129 P 129 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP PPP P P P P PP P P P P P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVP-PPACPPTPPKP 75 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 PPP PP P P P P P PP PP P P P P P P P Sbjct: 81 PPPEPKPAPP-----PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXP-PPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 PPP P P P P P P PP PP PP P P P P P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A P P P P PP P P P P PP P P P P P P P Sbjct: 24 APPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P P P P P P PP P P P P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P P PPP+ P PPP P PP PP P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAP 81 Query: 992 P 994 P Sbjct: 82 P 82 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXP 1232 P P P P P P PPP P P P PP P P P P P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP--PXPPPPPXPXXXX 985 P P P+P PPP P PP P P P PP PP P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Query: 986 XPP 994 PP Sbjct: 112 VPP 114 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P+ PP PP P P P PP P P P P P P Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXX-PXXXPXPXXP 1241 PPP P P P P P P P P PP P P P P P P P Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S P P P P PPP P P P P PP P P P P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSP--SPCPSPPPKP-QPKPVPPPACP 69 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-PPPXXXPRXXXXXXXXXXXXXXXP-PXPPPPPXPXXXX 985 P P P+P P P P P PPP P+ P P PPP P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Query: 986 XP 991 P Sbjct: 92 AP 93 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P P P P P P P P P P Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP---PXPXPPXPPXPXP-PXXPXXPXXXPXPXXP 1241 P P P P PP PP P P PP P P P P P P P P Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX-PPXP-PXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P PP P P P PP P P P P Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP-KPAPPPAP 93 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P+ PP P P P P PP P PP P P P Sbjct: 10 PKPVAPPGPSSKPVAPPGPSPCPSP-PPKPQPKPPPAPSPSPCPSPPP 56 Score = 34.7 bits (76), Expect = 0.13 Identities = 25/118 (21%), Positives = 29/118 (24%), Gaps = 1/118 (0%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 P P +P PP P P PPP P+ P P P P P Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPT 71 Query: 989 PPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPPXP 1162 PP + P PP P +P P P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAP 129 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P PP P PP P P P P P P Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P+ P P P P P P P P P P P P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 795 AXXXAXRPPPXT---XPPAPXPXPVXPXXPPP 881 A A +P P PPAP P PV P PPP Sbjct: 88 APPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P P P P P P P P P P PP P P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-GGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GG GGG G GG GGG Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GG G GG E GGG Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGE--GGGG 263 Score = 43.2 bits (97), Expect = 4e-04 Identities = 35/141 (24%), Positives = 35/141 (24%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXAXXXXXX 1061 G G G G G G GG G G GGG GG GG GGG A Sbjct: 42 GGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYA 101 Query: 1060 XXXXXXXXXXXXXXXXXXXGXXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXG 881 G GG G Sbjct: 102 SGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYG 161 Query: 880 GGGXXGXTGXGXGAGGXVXGG 818 GG G G G G GG GG Sbjct: 162 GGAYGGGGGHGGGGGGGSAGG 182 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G GG GG G GG GGG G GG GG Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG--GAHGGGYGSGGG 238 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G GGG GGG G G GGG Sbjct: 212 GGGGGSGGGGAYGGGGAHG-GGYGSGGGEGGGYGGGAAGGYGGGGGG 257 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GGG G G G GG GG Sbjct: 227 GAHGGGYGSGG-GEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GG GGG G GG GGG Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGY-GSGGGEGGGYGGG 246 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G G GGG G GG G G Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAG 207 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG GGG G GG GGG Sbjct: 167 GGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GG G GG GGG Sbjct: 170 GHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGG 220 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G GG GGG G GG GGG Sbjct: 176 GGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGX--GXGGXGGXGXGGGXGG--GXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GG GG G G GG GGG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGG 200 Score = 39.5 bits (88), Expect = 0.004 Identities = 32/117 (27%), Positives = 32/117 (27%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG G GG Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSG 218 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGGG GG G GGGG G GGG G G GG Sbjct: 219 GGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G GG GGG G G G G Sbjct: 190 GGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSG 236 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G GGG GG G G GGG Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GG G G GGG Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGG-GGSGGGGAYGGGGAHGGG 232 Score = 37.1 bits (82), Expect = 0.024 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GG GG G GG GGG Sbjct: 215 GGSGGGGAYGGGGAHGG-GYGSGGGEG-GGYGGGAAGGYGGGGGGGEGGG 262 Score = 36.3 bits (80), Expect = 0.042 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 10/60 (16%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX-------GGGXGGG---XRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GGG G G G GG GGG Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGG 254 Score = 35.9 bits (79), Expect = 0.055 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-G-GXRGXXGGXEXXXGGG 1091 G G G G G G G G GG G GGG G G G G GG GGG Sbjct: 163 GAYGGGGGHGGGGGGGSAG-GAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GGG G G G GG E GG Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGG-YGGGSGEGAGGGYGGAEGYASGG 83 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G GG GGG G GG G G Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG--GSAGGAHGGSGYG 190 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG GG G G GGG G GGG G G G Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG-GGEGGGGSYGGEHGGGSGGGHGGGGGH 283 Query: 813 G 811 G Sbjct: 284 G 284 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG G G GGGG G GG G G G Sbjct: 51 GGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGG 110 Query: 813 G 811 G Sbjct: 111 G 111 Score = 33.5 bits (73), Expect = 0.29 Identities = 34/145 (23%), Positives = 34/145 (23%), Gaps = 3/145 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX--GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXAXXXX 1067 G G G G GG G G GG G GG GG G GG G Sbjct: 83 GGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHA 142 Query: 1066 XXXXXXXXXXXXXXXXXXXXXGXXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXX 887 GG Sbjct: 143 SGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGS 202 Query: 886 XGG-GGXXGXTGXGXGAGGXVXGGG 815 GG GG G G G G GG GGG Sbjct: 203 HGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G GG GG G GG GG Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGG 71 Score = 32.3 bits (70), Expect = 0.68 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGG G GG G G GGG GGG G G GG Sbjct: 122 GGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG GG G G GGG G GGG G G G Sbjct: 152 GGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG-GAGGYG 210 Query: 813 G 811 G Sbjct: 211 G 211 Score = 31.5 bits (68), Expect = 1.2 Identities = 31/110 (28%), Positives = 31/110 (28%), Gaps = 1/110 (0%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXG-GRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGX 985 G GGGE GG GG G G GG Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGA 247 Query: 984 XXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGGGG GG G GG G G GGG G G Sbjct: 248 AGGYGGGGGGGEGGGGSYG-----------GEHGGGSGGGHGGGGGHGGG 286 Score = 30.3 bits (65), Expect = 2.7 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG GG G GG G G GGGG G GG G G G G Sbjct: 74 GGAEGYASGGGSGHGGGGGGAASSGGYASGAGEG---GGGGYGGAAGGHAGGGGGGSGGG 130 Query: 813 G 811 G Sbjct: 131 G 131 Score = 29.9 bits (64), Expect = 3.6 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG--GGGXGXXRGGGXGRGXXCXGX 817 G G G GGG GG G G GG G GG G G G Sbjct: 78 GYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGA 137 Query: 816 GG 811 GG Sbjct: 138 GG 139 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 45.6 bits (103), Expect = 7e-05 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP PPP PPP PP P PP P P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 45.2 bits (102), Expect = 9e-05 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP--PXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP PP P P P P P P P Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 44.4 bits (100), Expect = 2e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP P P PP P P P P P P P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX--PPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P P PP PP P P P P P P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPP 630 Score = 43.2 bits (97), Expect = 4e-04 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P+ PP P P PP P P P P P P P Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP PP P+ PP P P PP PP P P P P P P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PP P PP P P P P P P Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPP 584 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXP 1226 PPP S PP P+ PP P P PP P P PP P P Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSP 634 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PP PPP PP P PP P P P Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 39.9 bits (89), Expect = 0.003 Identities = 32/126 (25%), Positives = 33/126 (26%), Gaps = 8/126 (6%) Frame = +2 Query: 812 PPXPXHXXP----RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P H P P PPP P PPPP PP PPP P Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP-PVH 594 Query: 980 XXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPP----XPPXS 1147 PP PP PP P S Sbjct: 595 SPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQS 654 Query: 1148 PPPXPL 1165 PPP P+ Sbjct: 655 PPPAPV 660 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP PPP PP P P PP P P P Sbjct: 605 PPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXP-XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP P P PP PP P P P P Sbjct: 575 PPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP--PPPPVYSPPP 623 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP----XXPXXPXXXPXPXXP 1241 PP P+ PP P P PP PP PP P P P P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP------PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PPP PP P PP PP PP P P P Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPPXPXXXXXPP 994 R PPP PPPP P PP PP PPP P PP Sbjct: 515 RRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Score = 35.5 bits (78), Expect = 0.073 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP-----XPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPX 976 PP P + P P PP P PPPP P PP P P P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Query: 977 XXXXPP 994 PP Sbjct: 586 VHSPPP 591 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P F PP PPPP H+ PPPP Sbjct: 563 PPVHSPPPPVFSPPPPVYSPPPPVHS----PPPP 592 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P + PP PPPP H+ PPPP Sbjct: 570 PPVFSPPPPVYSPPPPVHSPPPPVHS----PPPP 599 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 9/59 (15%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PP----PXPXPPX---PPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP P P PP PP PP P P P Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P++ P P P PP PPPP + PPPPP Sbjct: 529 PVYSPPPPPP--PVHSPPPPVHSPPPPP--VYSPPPPPP 563 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-----PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P S P P P PPP P PP P P P P P Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPP 545 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPPXF 380 SP P + PP PPPP H+ PPPPP + Sbjct: 525 SPPPPVYSPP----PPPPPVHSPPPPVHSPPPPPVY 556 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPP--PXHN---XFXGPPPPPXFF 383 P SP P PP PPP P H+ PPPPP + Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVY 619 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPP PPPP Sbjct: 538 PPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPP 598 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 45.6 bits (103), Expect = 7e-05 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G GGG GGG G GG GG Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGG 103 Score = 44.4 bits (100), Expect = 2e-04 Identities = 38/142 (26%), Positives = 38/142 (26%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXAXXXXXX 1061 G G G G G GG G GG G GG GGG RG G GG A Sbjct: 348 GGVGGGVGGGVGGAVGGAVGGAVGGGG-GGSVGGGGRGSGGASGGASGGASGGASGGASG 406 Query: 1060 XXXXXXXXXXXXXXXXXXXGXXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXG 881 G GG G Sbjct: 407 GASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 Query: 880 GGGXXGXTGXGXGAGGXVXGGG 815 GG G TG GAGG V GG Sbjct: 467 SGGAGGGTGGSVGAGGGVGVGG 488 Score = 43.2 bits (97), Expect = 4e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG GG G G G G G GG GGG Sbjct: 502 GGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGG 551 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G G GGG GGG G GG GG Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGG 158 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GGG GG G GG GGG Sbjct: 331 GAGGSVGAGGGVGGGVGGGVGG-GVGGGVGGAVGGAVGGAVGGGGGG 376 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG GGG G GG GG Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG GGG G GG GG Sbjct: 251 GGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGG 300 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGGXXXA 1079 G G G G GG G GG G G GGG GGG G G GGG A Sbjct: 473 GTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGA 527 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G GGG GG G G GGG Sbjct: 66 GGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGG 115 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G GG G G GGG G GGG GRG G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Query: 813 G 811 G Sbjct: 172 G 172 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GGG G GG GG Sbjct: 311 GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GG GGG +G G GGG Sbjct: 129 GAGGSVGAGGGIGG-GAGGAIGGGASGGVGGGGKGRGGKSGGGAGGG 174 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G GG G GG GGG RG G GG A Sbjct: 218 GTVGAGGR-GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGA 270 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GGG G GG GG Sbjct: 250 GGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGG 296 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GGG G G G GG G G Sbjct: 223 GGRGSGGASGGVGVGGGAGGSGGGSVG-GGGRGSGGVGASGGAGGNVGAG 271 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GG GG G GG GGG Sbjct: 263 GAGGNVGAGGGLGGGVGGGVGG-GVGGSVGGAVGGAVGGAVGGGGGG 308 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GGG G GG GG Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GGG GGG G GG GG Sbjct: 322 GGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGG 372 Score = 39.1 bits (87), Expect = 0.006 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G GG G G G GG GGG Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGG-GVGGGAGGAIGGG 96 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G GG G G GG GGG G GG GG Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGG 165 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG--GXGXGG-XGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G G GG GG G GGG GG G GG GG Sbjct: 206 GGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGG 257 Score = 39.1 bits (87), Expect = 0.006 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G GG G GG GGG G GG GG A Sbjct: 340 GGVGGGVGGGVGGGVGG-GVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGA 392 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGG 1094 G G G G GG GG GG G G G GGG G GG GG Sbjct: 137 GGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGG 184 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GGG GGG G G GGG Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGG-GIGGSGGVGAGGG 84 Score = 37.9 bits (84), Expect = 0.014 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G G G G GGGG G GGG G G G G Sbjct: 416 GGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTG 475 Query: 813 G 811 G Sbjct: 476 G 476 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG-GXEXXXGGG 1091 G G G G G G G GG G G G GGG G G G GGG Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG G G GG G G GG GGG Sbjct: 239 GAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX---GXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG G GG G GG GGG RG G GG A Sbjct: 276 GGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGA 332 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG-GGXGGGXRGXXG-GXEXXXGGG 1091 G G G GG G G GG G G GG GGG G G G GGG Sbjct: 438 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGG 489 Score = 37.1 bits (82), Expect = 0.024 Identities = 32/118 (27%), Positives = 32/118 (27%), Gaps = 1/118 (0%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG G GG Sbjct: 277 GVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSV 336 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXR-GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGG GG G GGGG G GGG G G G G Sbjct: 337 GAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASG 394 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG G G G GG GG G GG GGG Sbjct: 446 GAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGG 491 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GGG GG RG G GG Sbjct: 494 GGAGGGVGGGVGGGVGGGVRGAVGG-AVGGGVGGAGRGSGGASGGAGAGG 542 Score = 36.3 bits (80), Expect = 0.042 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G GG GG G GG G G G GG GG Sbjct: 45 GSVGVGAGAGG-GASGGIGVGG-GGGGGGGIGGSGGVGAGGGVGGGAGG 91 Score = 36.3 bits (80), Expect = 0.042 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G G GGG G R GG GGG Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASG-GAGGGGKGRGRKGGGGAGGGVGGG 123 Score = 36.3 bits (80), Expect = 0.042 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG GG GG GG GG G GG GG Sbjct: 158 GGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 36.3 bits (80), Expect = 0.042 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG-GGXG-----GGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G G GG G GG G GG GGG Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGG 281 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG GG G GG GG G GG G G Sbjct: 296 GAVGGAVGGGGGGSVGG-GGRGSGGASGGASGGASGGAGGSVGAG 339 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G G G GG G G G GG G GG GG A Sbjct: 485 GVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGA 538 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GG G G GG GGG Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GG G GG G GG GG Sbjct: 204 GAGGRGSG-GASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGG 252 Score = 35.5 bits (78), Expect = 0.073 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG--GXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG GG G G G G GGG G GG GG Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGG 129 Score = 35.5 bits (78), Expect = 0.073 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGG 1094 G G G GG G GG G G G G G GG G GG GG Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGG 146 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G G G GGG G G G G GG Sbjct: 164 GGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGG 212 Score = 35.5 bits (78), Expect = 0.073 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G GG GG G GG GG Sbjct: 305 GGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGG 341 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG--GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G G GG GGG +G GGG Sbjct: 69 GGGGIGGSGGV-GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGG 119 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GGG GG G G G G Sbjct: 113 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKG 162 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG GG G GGGG G GGG G G G Sbjct: 272 GGLGGGVGGGVGGGVGGSVGGAVGGAV------GGAVGGGGGGSVGGGGRGSGGASGGAS 325 Query: 813 G 811 G Sbjct: 326 G 326 Score = 34.7 bits (76), Expect = 0.13 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 6/56 (10%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGG-----XGXGGGXG-GGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG G GG G GG GGG Sbjct: 450 GAVGGGGGGSVGG--GGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGG 503 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G GG G GG GG G GG G G A Sbjct: 271 GGGLGGGVGGGVGG-GVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGA 320 Score = 34.3 bits (75), Expect = 0.17 Identities = 33/143 (23%), Positives = 33/143 (23%), Gaps = 1/143 (0%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXAXXXXX 1064 G G G GG G GG G G GG GG G G GG A Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVG 343 Query: 1063 XXXXXXXXXXXXXXXXXXXXGXXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXX 884 G GG Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGG 403 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GG G G GAGG V GG Sbjct: 404 ASGGASGGVGGAGGAGGSVGAGG 426 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G GG G G G GGG G G GG Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGG 143 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G GG GG GG G G GG G G A Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGG-GGTVGAGGRGSGGASGGGGTVGAGGRGSGGA 230 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG--XXGGXEXXXGGG 1091 G G G G G GG G G GG GG G GG GGG Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGG 246 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG GG G G GGG Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGG 567 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGGGXXXA 1079 G G G G G GG GG G GGG G GG G G GGG A Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGG-GVGGGVGAGGGAGGSVGAGGGIGGGAGGA 147 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G G G GG GG +G GGG G G G G G GG Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 33.1 bits (72), Expect = 0.39 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRG--GGXGRGXXCXG 820 GG G G GG GG G G GGG G G GG GRG G Sbjct: 200 GGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVG 259 Query: 819 XGG 811 G Sbjct: 260 ASG 262 Score = 32.7 bits (71), Expect = 0.51 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGG-GXXXXXGGKKXGXRGXXXXGXKRG 257 GG GGG R R G GGG + GGG G GG G G G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Score = 32.3 bits (70), Expect = 0.68 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG-GXEXXXGGGXXXA 1079 G GG GG G G GGG GGG G G G GGG A Sbjct: 48 GVGAGAGGGASGGIGVGG-GGGGGGGIGGSGGVGAGGGVGGGAGGA 92 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGG--XGGGXRGXXGGXEXXXGG 1094 G G G G GG GG G G GG GG G GG GG Sbjct: 157 GGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG 207 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G GG GG G GG GG Sbjct: 263 GAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGG 312 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G G G GG G GGG Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGG 217 Score = 31.5 bits (68), Expect = 1.2 Identities = 29/116 (25%), Positives = 29/116 (25%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG GG Sbjct: 431 GVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGG 490 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G GGG GG G GGG G RG G G G G Sbjct: 491 GIGGGAGGGVGGGVGGGVGGGVRGAV---GGAVGGGVGGAGRGSGGASGGAGAGGG 543 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G G G G GGG Sbjct: 498 GGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGG 547 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G G G RG GGG G GGG G G G Sbjct: 77 GGVGAGGGVGGGAG-GAIGGGASGGAGGGGKGRGRKGGGGAGGGV-GGGVGAGGGAGGSV 134 Query: 813 G 811 G Sbjct: 135 G 135 Score = 31.1 bits (67), Expect = 1.6 Identities = 27/117 (23%), Positives = 28/117 (23%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG G Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G G GG GG + GGG G G G G G GG Sbjct: 140 I--GGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 880 GGGXXGXTGXGXGAGGXVXGGG 815 GGG G G G GAGG V GG Sbjct: 172 GGGVGGGVGAGGGAGGSVGAGG 193 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 993 GGXXXXXGXG--GGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXG 820 GG G G GGGG G GGGG G GGG G G G Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVG-GG 507 Query: 819 XGG 811 GG Sbjct: 508 VGG 510 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGG 818 G GG G G G GAGG V GG Sbjct: 530 GSGGASGGAGAGGGAGGGVGGG 551 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G GGG G G G GG Sbjct: 169 GGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX------GXGGGXGGGXRGXXG 1118 G G G G GG G G GG G GG GGG G G Sbjct: 530 GSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G +G G GAGG V GG A Sbjct: 68 GGGGGIGGSG-GVGAGGGVGGGAGGA 92 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGX-GGXGXGG---GXGGGXRGXXGGXEXXXGG 1094 G G G GG G GG GG GG G G G G GG GG Sbjct: 526 GAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = -3 Query: 1240 GXXGXGXXX-GXXGXXGGXGXGGX-GGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G G G G G GG GG Sbjct: 196 GSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGG 246 Score = 29.9 bits (64), Expect = 3.6 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -1 Query: 993 GGXXXXXGXGG-GGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 GG G GG GGG G G G GGG G GGG G G Sbjct: 232 GGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Score = 29.5 bits (63), Expect = 4.8 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GG G GG G RG GG G GG G G G G Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGG-RGSGGASGGGGTVGAGGRGSGGASGGVG 235 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXG 269 GG GGG R G GGG + GGG G G G G Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVG 204 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX-GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG GGG G GG Sbjct: 514 GAVGGAVGGGVGG--AGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGG 562 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GGG G G GGG Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGG 71 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G G GG G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVG 80 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = -3 Query: 883 GGGGXXGXTGXGXGA----GGXVXGGGR 812 G GG G G G GA GG V GGGR Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGR 253 Score = 28.7 bits (61), Expect = 8.4 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGX-GGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 GG G G GGG G G G GG G G GGG G G Sbjct: 498 GGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGG 551 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 45.6 bits (103), Expect = 7e-05 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + PP P PPP P P PP PP P P P P P P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 45.2 bits (102), Expect = 9e-05 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP P P PPP PPP PP P PP P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP P PPPP P PP PPPPP P Sbjct: 49 PPPP----PSP-PPPSCTPSPPPPSPPP-----PKKSSCPPSPLPPPPPPPPPNYVFTYP 98 Query: 992 P 994 P Sbjct: 99 P 99 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP---PPXPXPPXPPXPXPP 1196 PPP + P P PPP PP P PP PP P PP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPP-PPPPPPP 91 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP S PP PPP PPP PP P Sbjct: 70 PPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDLYP 104 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP PP+ P P P PPP Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPP 72 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P PPPP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPP 87 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 +PPP PP P P P PPP Sbjct: 48 QPPPPPSPPPPSCTPSPPPPSPPP 71 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 45.2 bits (102), Expect = 9e-05 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP PPP PPP P PP P P PP P P P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPP-PPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 40.3 bits (90), Expect = 0.003 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPP 1196 PPP + PP P PPP P P P P P P PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 PP P+P PPP P PPPP R Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIAR 295 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P PPP P PP PP P Sbjct: 273 PPPQPPPPPPPKP-QPPPPPKIARPPPAPPKGAAP 306 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P L P PP P PP PP P P P P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P PP R P PPP P PP P PPP P PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPP---------PQPPPPPPPKPQPPPPPKIARPPP 298 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +3 Query: 807 AXRPPPXTXPP--APXPXPVXPXXPPPP 884 A PPP PP P P P P PPPP Sbjct: 264 APPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P P PPP P P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 L P PP PP PP PP P P P P P Sbjct: 253 LPPLKLPPGRSAPPPPPAAAPPPQP-PPPPPPKPQPP 288 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P+P PPP+ PP P Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAP 300 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 288 LXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 L P PP PPPP PPPPP Sbjct: 253 LPPLKLPPGRSAPPPPPAAAPPPQPPPPP 281 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G G G GGG GGG +G GG GGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGG 47 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G GG G GG GGG G GG GGG Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GG G GG GG G GG GGG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGG 112 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G G GGG G GG GGG Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG GGG GGG G G GGG Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GG G GGG GG G GG + GGG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRG-GGGGGGAKGGCGGGGKSGGGGG 48 Score = 40.3 bits (90), Expect = 0.003 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG GG G GGG GG G GG GGG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGG-GGGGGAKGGCGG--GGKSGGGGGG 49 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G G G GG GG GG GGG Sbjct: 104 GKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 34.3 bits (75), Expect = 0.17 Identities = 31/120 (25%), Positives = 33/120 (27%), Gaps = 3/120 (2%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG GG Sbjct: 16 GGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKG 75 Query: 981 XXXGXG-GGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGX--GXXRGGGXGRGXXCXGXGG 811 G G GGGG GG G + GGGG G GGG G+G G G Sbjct: 76 GSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 32.3 bits (70), Expect = 0.68 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GG G G GGGG G GGG G G G Sbjct: 85 GGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMVAPG 144 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGG 31 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRG--XXCXGXG 814 G GGGG G RGGG G G C G G Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGG 847 GG GGG G GG G +G GGG G GGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRG 284 GG GG K GGGGG GGGG GGK G G Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG--KGGKSGGGSG 135 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GG G G G G G GG GGGR Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGR 25 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GG G GG G GGGG G +GG G G G GG Sbjct: 3 GKGGSGSGGGGKGGGGGGS-------GGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GG GG G G RG GGG G GGG G G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGG--GGGGG 51 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGG 818 GGGG G G G G GG GG Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGG 128 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G G GG G Sbjct: 117 GGCGGGGGGKGGKSGGGSGGGG 138 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP PL PPP PP PP PP P P P Sbjct: 81 PPPPLPRLPP--PLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP-XPPXPPXPXPPXXPXXPXXXP 1226 PPP P PL PPP PPP P PP P P P P P P Sbjct: 29 PPPLVF---PLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL-----XPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PL PPP PP P P PP PP P P P P P Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPP--PEEPPREPPPPPP 108 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP--PPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P P PPR PP PP PR PP PPPPP Sbjct: 57 PPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP PPP P P P PP P P P P Sbjct: 41 PPPS----PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP PL PPP P P P PP PP P P P P Sbjct: 68 PLPPRFELPP--PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P P P PPP PP P PP P P P P Sbjct: 70 PPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 36.7 bits (81), Expect = 0.032 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPP--XPXPPXXPXXPXXXPXPXXP 1241 PPP S P P P PP P PP PP P PP P P P P Sbjct: 45 PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEP 99 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P P P P P PPP P PP PPPP P Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPP--FPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 32.7 bits (71), Expect = 0.51 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 P P P P PPR P PPPP P Sbjct: 86 PRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P P P P P PPPP Sbjct: 94 PPPEEPPREPPPPPPPPEEPPPP 116 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXP-XXXPXPXXP 1241 PP P P PPP P P P P P PP P P P P P Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFP 81 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P + PP P P P P P P PP P P P P Sbjct: 14 PSLGNLPPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPP 58 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +3 Query: 216 EIPLLKKF*XXVGXPLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 E PL +F + PLF P L P PP PP PPPP Sbjct: 66 EPPLPPRF--ELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP PPP P P P P P P P P P Sbjct: 568 PPPHVYSPPPPVASPPPPSPPP---PVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PPP PPPP P PP PP P P Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Query: 992 P 994 P Sbjct: 635 P 635 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P P PP P P P P P P Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPP--XXPXXPXXXPXP 1232 PPP S PP PPP PPP P PP P PP P P P P Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPP--XPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P PPP P PP PP P P P P P P Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PP P P P P P P P P P Sbjct: 587 PPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSP-PPPSHSPPPPVYSPPP 634 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP--XXPXXPXXXPXPXXP 1241 P P S P P+ PP P P PP P PP P P P P P Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSP 587 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXP---XPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PPP PP P PP P PP P P P P Sbjct: 545 PPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P PPPP P PP P P P P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 Query: 992 P 994 P Sbjct: 627 P 627 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX----PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP PPP P PP P P P P P Sbjct: 538 PPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + PPP P P P P P P P P P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPP 561 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P SP P PP PPPP H+ PPPPP F Sbjct: 570 PHVYSPPPPVASPPPPS--PPPPVHS----PPPPPVF 600 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P+F P SP+ + PP PPPP ++ PPPP F Sbjct: 605 PVFSPPPPSPV---YSPPPPSHSPPPPVYS-----PPPPTF 637 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 SP P + PP PPPP ++ PPPP Sbjct: 544 SPPSPIYSPPPPVHSPPPPVYS---SPPPP 570 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P P P P P P P P P Sbjct: 463 PQPSKPEDSPK-PEQPKPEESPKPEQPQIPEPTKPVSPPNEAQGPTPDDP 511 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P+ P SP P PP PPP F PPP P + Sbjct: 578 PVASPPPPSPPPPVHSPPPPPVFSPPPP--VFSPPPPSPVY 616 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP PP P P PPPP Sbjct: 580 ASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P F PP PPPP H+ PPPP Sbjct: 597 PPVFSPPPPVFSPPPPSPVYSPPPPSHS----PPPP 628 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP--PPPXPXXXX 985 PP P R PP P P PP PP P PP P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP 582 Query: 986 XPP 994 PP Sbjct: 583 PPP 585 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PPP Sbjct: 534 PPPQ--PPMPSPSPPSPIYSPPP 554 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 270 PXXXSPLXPXFF-PPXXXXXPPPPXHNXFXGPPPP 371 P SP P F PP PPPP + PPPP Sbjct: 589 PPVHSPPPPPVFSPPPPVFSPPPP--SPVYSPPPP 621 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 619 PPPSHSPPPPVYSPPPPTFSPPP 641 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PPP S PP P PP PPP P PP PP P Sbjct: 65 PPPPPTSPPPPSP-PPPSPPPPSPPPPSPPPP 95 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP + PP PP PPP P PP PP P PP Sbjct: 64 PPPPPPTSPP-----PPSPPPPSPPPPSPPPPSPP 93 Score = 42.7 bits (96), Expect = 5e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PP PP P PP P P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 42.7 bits (96), Expect = 5e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PPP PP P PP PP P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPP-PPSPPPPSPP 93 Score = 36.7 bits (81), Expect = 0.032 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PP P PP P P P P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.5 bits (78), Expect = 0.073 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T PP P P P P P PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPP 88 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P PP P PP P P P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP+P P P PPPP Sbjct: 73 PPPSPPPPSPPPPSPPPPSPPPP 95 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P P PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P PPP P PPP P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPP---PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PL PP P PPP PP PP PP P P P P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP PP PP P P P PP PP P P P Sbjct: 70 PPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXPXPPXXPXXPXXXP 1226 PPP PP P PP PP P PP P PP P P P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXPXPPXXP 1205 PPP + PP P P PP PP PP PP PP P Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXX---PLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP P PPP P P P P P P P P Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXP-XXPXXXPXP 1232 PP + PP P PPP PP PP PP PP P P P P Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP 126 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXP 1205 PPP + PP PP PP P P P PP PP P Sbjct: 124 PPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXP---PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + PP + PPP P PP PP P PP P P P P Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P PP PP PP PP P P P P Sbjct: 45 PPPQPDPQPPTPPTF-QPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPP 95 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 1080 AXXXPPPXXXSXP--PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP + P P P PP P P PP P PP P P P P Sbjct: 109 AITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP--PLSPPQTTPPPPP 162 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP + P P P PPP P P PP P P P Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPP--XXPXXPXXXPXP 1232 PP PP PPP PP P P PP PP P P P P Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPP 114 Score = 33.9 bits (74), Expect = 0.22 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXP-----RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP---PP 967 PP P P +P PP P PPP P PP PP PP Sbjct: 46 PPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPP 105 Query: 968 XPXXXXXPP 994 P PP Sbjct: 106 PPPAITPPP 114 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P P PP P PP P P P P Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPP--PLSPPQTTPPPPP 108 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP----PPPXPXX 979 P P P P PP+ P PPP P P PP PP P Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPK 145 Query: 980 XXXPP 994 PP Sbjct: 146 PLPPP 150 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P PP P PPP PP PP PP P Sbjct: 254 PGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSP 291 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPP----PPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 P P P+P PP P PP PP P PP P PPP Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPP--PPPQSTSPPPVATTPPALPPKPLPPPLSPPQ 101 Query: 983 XXPP 994 PP Sbjct: 102 TTPP 105 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 P P S P P PP PP P PP P P P P P P Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 1098 PXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P S P P + PPP PP PP P PP P P Sbjct: 248 PQGFSCPGPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSP 291 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXX---SXPPXXPLXPPP---XPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 PPP S PP PPP PP P P PP PP P P P P Sbjct: 114 PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSP 170 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P PPPP P PP P PPP P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITP-----PPPLATTPPALPPKPLPPPLSPPQTTP 158 Query: 992 P 994 P Sbjct: 159 P 159 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP P P P P P P P P Sbjct: 56 PPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTP 104 Score = 30.7 bits (66), Expect = 2.1 Identities = 28/117 (23%), Positives = 31/117 (26%), Gaps = 2/117 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP-RXXPXPP-PPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P P PPP + P PP PP P PP PP P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQP---------------APPANDQPPPPPQST 76 Query: 986 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPP 1156 PP + PP PP P +PPP Sbjct: 77 SPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P P P P PPPP Sbjct: 105 PPPPAITPPPPPAITPPLSPPPP 127 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PP P PL PP PP P PP P Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P P P P PP P P P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP P PPP P P P P P PP P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPP 70 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 P P P P PP+ P PPP P Sbjct: 140 PALPPKPLPPPLSPPQTTPPPPPAITPP 167 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +2 Query: 827 HXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 H R PPP P PPPP P PP PPPPP P PP Sbjct: 113 HHHHRRSPPPPPPPPPPPPTITP-PVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 866 PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P PPPP P PP PPPPP P PP Sbjct: 97 PPPPPP---PPLSAITTTGHHHHRRSPPPPPPPPPPPPTITPP 136 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 13/48 (27%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-------------PXPPPXPXPPXPPXPXPP 1196 PPP PP + PP PPP P PP PP PP Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PPP P PP P P P P Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 12/49 (24%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPP------------XPPXPXPPXXPXXPXXXP 1226 PP P PPP PPP PP P P PP P P P Sbjct: 120 PPPPP--PPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITP 166 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP PP PP P P P P P P P Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP PP PP PP P P P P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP--PPAPIYSPPP 753 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPX--PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXX 979 PP P H P P PPP PPPP P PP P PPP P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVH 772 Query: 980 XXXPP 994 PP Sbjct: 773 SPPPP 777 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PP P P PP P P P P P P P Sbjct: 759 PPPPVHSPPPP-PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P P PP P P P P P P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP P PP PP P P P Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P+ PP P P PP PP PP P P P Sbjct: 727 PPPPVQSPPPP-PVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPP 775 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PP P P P P P P P P P Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP 768 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPP---XPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP PP PP P P P P P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXP 1232 PPP PP P+ PP P P PP P PP P P P P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 40.3 bits (90), Expect = 0.003 Identities = 30/123 (24%), Positives = 31/123 (25%), Gaps = 5/123 (4%) Frame = +2 Query: 812 PPXPXHXXPRPX--PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP---XPX 976 PP P H P P PPP PPPP P P PPPP P Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Query: 977 XXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPP 1156 PP PP P PP PP Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPP 782 Query: 1157 XPL 1165 P+ Sbjct: 783 PPV 785 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP P P PP P P P P P P Sbjct: 677 PPPPVHS-PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 40.3 bits (90), Expect = 0.003 Identities = 32/125 (25%), Positives = 33/125 (26%), Gaps = 7/125 (5%) Frame = +2 Query: 812 PPXPXHXXPRP-XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXX 982 PP P H P P PP PPPP P PP P PPP P Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHS 758 Query: 983 XXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPP----XXPPXPPXSP 1150 PP PP PP P SP Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSP 818 Query: 1151 PPXPL 1165 PP P+ Sbjct: 819 PPKPV 823 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP P P PP P P P P P P Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP P PP PP P P P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PPSPIYSPPP 813 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP P P PP P P P P P P Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAP 837 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP P P PP P P P P P P Sbjct: 685 PPPPVHSPPP--PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PP P P PP P P P P P P Sbjct: 692 PPPPVHSPPP--PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP PPP P PP PP P P P Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P P PP P P P P P P Sbjct: 670 PPPPVYSPPPPVH-SPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP P P P P P P P P P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 7/54 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPPXP---PXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PPP PP P P P P P P P P Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXP-XPPXPPXPXPPXXPXXP 1214 PPP S PP PPP PPP P P PP PP P P Sbjct: 781 PPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P S PP P+ PP P P PP P P P P P P Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPP 686 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P P PP P PP P P P Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPPXF 380 P SP P PP PPPP H+ PPPPP F Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVF 740 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +2 Query: 812 PPXPXHXXPRP--XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P H P P PPP PPP P PP PPP P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPL 826 Query: 986 XP 991 P Sbjct: 827 PP 828 Score = 35.5 bits (78), Expect = 0.073 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP--PXPPPXPXPPXP---PXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP P P P P P P P P Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHN---XFXGPPPPP 374 P SP P F PP PPPP ++ PPPPP Sbjct: 651 PPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXP--PXPXPPXXPXXPXXXPXP 1232 P P+ PP PPP PP P P P P P P P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P+F P +P+ PP PPPP H+ PPPPP Sbjct: 738 PVFSPPPPAPIYSP--PPPPVHSPPPPVHS----PPPPP 770 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP PPP P PP PP P P P Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 P SP P PP PPPP H+ PPP P + Sbjct: 776 PPVHSPPPPVHSPPPPVHSPPPPVHSP---PPPSPIY 809 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP H+ PPPP Sbjct: 687 PPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 716 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP H+ PPPP Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 723 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP H+ PPPP Sbjct: 769 PPVHSPPPPVHSPPPPVHSPPPPVHS----PPPP 798 Score = 31.9 bits (69), Expect = 0.90 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPR---PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPP---PP 964 PP P + P PP P PPPP P P P PP PP Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 965 PXPXXXXXPP 994 P P PP Sbjct: 686 PPPVHSPPPP 695 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P PP PP P PP P P P P P P Sbjct: 627 PSPSTEETKTTSPQSPPVHSPP-PPPPVHSPPPPVFSPPPPMHSPPP 672 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P P P PP PPPP H+ PPPP Sbjct: 680 PVHSPPPPPVHSPPPPVHSPPPPVHS----PPPP 709 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P P P PP PPPP H+ PPPP Sbjct: 762 PVHSPPPPPVHSPPPPVHSPPPPVHS----PPPP 791 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPPP + PPPP Sbjct: 783 PPVHSPPPPVHSPPPPVHSPPPP--SPIYSPPPP 814 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXX-XPPPPXHNXFXGPPPP 371 P SP P + PP PPPP H+ PPPP Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHS----PPPP 695 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P SP P PP PPP + PPPP Sbjct: 722 PPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P P PP PPPP H+ PPPP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHS----PPPP 673 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPP 708 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPP 722 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPP 729 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPP 736 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 768 PPPVHSPPPPVHSPPPPVHSPPP 790 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 775 PPPVHSPPPPVHSPPPPVHSPPP 797 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P PPP Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPPP 804 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P P P P P P P P P P P P P Sbjct: 418 PEPKKEINPPNLEEPSKPKPEESPKPQQPSPKPETPSHEPSNP-KEPKPESP 468 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GG GGG G GG GGG Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G G GGG GG G GG GGG Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG G GG GGG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGG 127 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG GGG G G G GG GGG Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GG GGG GG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 39.1 bits (87), Expect = 0.006 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GG G GG GGG Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGG 113 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX--GGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GG GGG G GG GGG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGG 128 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G G G GG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 37.5 bits (83), Expect = 0.018 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGX-GGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGX 817 GG G GGGGG GG G G GGGG GGG G G G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Query: 816 GG 811 GG Sbjct: 127 GG 128 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G G GGG GG GG GGG Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GGG GG GGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGGGG G G GGGG GGG G G G GG Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 105 GGGGHYGGGGGGHGGGGHYGGGG 127 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 118 GGGGHYGGGGGGYGGGGGHHGGG 140 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRG 284 GG GGG GGGGG GGGG GG G G Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 29.5 bits (63), Expect = 4.8 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -1 Query: 993 GGXXXXXGXGGG--GGXGGXXXXXXXXXXXXGXXRGXXXG-GGGXGXXRGGGXG 841 GG G GGG GG GG G G G GGG G GGG G Sbjct: 90 GGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG G GG GG G GGG GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G GG G GG GG G GGG GGG GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G GGG GGG G GG GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 GG G GG GG G GGG GGG G G GG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G GGG GGG G G GGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/41 (48%), Positives = 21/41 (51%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG GG G G G GGG G G + GGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGG-GGGGWYKWGCGGG 112 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G GGG GGG G GG GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGG-GGGGGWGWGGGGG 100 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G GGG GGG G G GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GGG GGG G GG GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGG--GXGRGXXCXG 820 G G GGGGG GG G G GGGG G + G G G+G G Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Query: 819 XG 814 G Sbjct: 121 RG 122 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGG 91 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGG 92 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWG 94 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGG 101 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 81 GGGGGGGGGGGGWGWGGGGGGG 102 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG G GGG G G G GG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXAXXXAW 791 GGGG G G G G GG G G W Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGGGW 104 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXAXXXAW 791 GGGG G G G G G GGG W Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGGWYKW 107 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 G G GGGG G GGGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGG 88 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PL P PPP PP P P P P P P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP---XPPXXPXXPXXXPXPXXP 1241 PPP S PP P L PPP PP P P PP P PP P P P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAP-PPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 38.7 bits (86), Expect = 0.008 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 6/57 (10%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPP---XPPPXP---XPPXPPXPXPPXXPXXPXXXPXP 1232 A PPP S PP PPP PPP P PP PP PP P P P Sbjct: 43 ADSSPPPALPSLPPAV-FSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP PPP P PP P P P P P P Sbjct: 41 PPADSSPPPALPSLPPAVFSPPPTVSSP-PPPPLDSSPPPPPDLTPPPSSP 90 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP + PP + PP PPP PP P PP P P Sbjct: 110 PPPESTNSPPPPEVFEPP-PPPADEDESPPAPPPPEQLPPPASSP 153 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PPP P PP P P P P P Sbjct: 104 PPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +3 Query: 1080 AXXXPPPXXXSX----PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP S PP PPP PP PP PP P P P Sbjct: 14 ADSAPPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPP 71 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP----XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP + PPP P P PP P PP P P P Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPP 142 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P PPP P P P P P P Sbjct: 128 PPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSAP 177 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP---PPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP P PP PPP P PP P P P Sbjct: 118 PPPPEVFEPPPPPADEDESPPAPPP-PEQLPPPASSPQGGPKKP 160 Score = 29.5 bits (63), Expect = 4.8 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 8/68 (11%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXP-----PPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPX 970 P P P P PP P P PP P PP P PPP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSS 89 Query: 971 PXXXXXPP 994 P PP Sbjct: 90 PPPPDAPP 97 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P PPP P PP PPP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAP--------PPIPIVFPPPIDSPPPESTNSPPP 120 Query: 992 P 994 P Sbjct: 121 P 121 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP P P P P P P P P P Sbjct: 85 PPPSSPPPPD---APPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPP 130 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP + PP P P+ PPP Sbjct: 85 PPPSSPPPPDAPPPIPIVFPPP 106 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 5/39 (12%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPP-----PPXHNXFXGPPPP 371 P P P FPP PP PP F PPPP Sbjct: 92 PPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPP 130 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 43.2 bits (97), Expect = 4e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G GG G GG GGG GG GGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGG 139 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 10/59 (16%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG----------GXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G G GG G GGG RG GG GG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGG 153 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G G GGG G GG GGG Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GGG R GG GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGR--GXXCXG 820 GG G GG G GG G GGGG G GGG R G G Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGG 157 Query: 819 XGG 811 GG Sbjct: 158 DGG 160 Score = 32.3 bits (70), Expect = 0.68 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG GG GG G GGG G G GG E GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSG---GGGGGYERRSGG 131 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGX-GGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGX 817 GG GGGGG GG R G GG G RG G G G Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGY 154 Query: 816 GG 811 GG Sbjct: 155 GG 156 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 43.2 bits (97), Expect = 4e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G GG G GG GG G GGG GGG G G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG 622 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 G G G G G GG G GG GG G GGG GG G GG Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G GGG GGG G GG GG Sbjct: 581 GSGRGGYGGGGG-GYGGGGGYGGGGGYGGGG-GYGGGYGGASSGG 623 Score = 35.5 bits (78), Expect = 0.073 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG GG G GGG GGG G GG GG Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGG--GGYGGGGGYGGG 615 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GGG GG G GG GGG Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGGGYGGGGG 611 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 882 GGGGXGXXRGGGXGRGXXCXGXGG 811 GGGG G GGG G G G GG Sbjct: 588 GGGGGGYGGGGGYGGGGGYGGGGG 611 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXAXXXAW 791 GGGG G G G G GG GG AW Sbjct: 602 GGGGYGGGGGYGGGYGGASSGGYGGEPPSAW 632 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 585 GGYGGGGGGYGGGGGYGGGG 604 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 42.7 bits (96), Expect = 5e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP---XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP PPP P PP P P P P P P P Sbjct: 26 PPPSHIS-PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 PPP S P PPP P P P PP P P P P P P P P Sbjct: 44 PPPPHFSPPHQ----PPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPP 87 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP H P P PPP PPPP P P PPP P P P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSP-----PHHPPPPHFSPPHQPPPSPYPHPHPPP 67 Query: 992 P 994 P Sbjct: 68 P 68 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXP---LXPPPXPPPXPXP---PXPPXPXP-PXXPXXPXXXPXPXXP 1241 PPP S P P PP PPP P P P PP P P P P P P P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPX------PXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP PPP PP P P P PP P P P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 36.3 bits (80), Expect = 0.042 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P H P P PP PPPP P PP P P P P P Sbjct: 25 PPPPSHISP-PPPPFSPPHHPPPPHFSP---PHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Query: 992 P 994 P Sbjct: 81 P 81 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPX-PPPPXXXPRXXXXXXXXXXXXXXXPP----XPPPPPXP 973 PP P P PPP P PPP P PP PPPPP P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP PPP P PP P P P P P P P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P+ PPP P PP P PP P P P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXP-XPPXXPXXPXXXPXPXXP 1241 S P P P PPP PP P PP P P P P Sbjct: 12 SPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPP 56 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P SP P F PP PPPP + PPP P Sbjct: 28 PSHISPPPPPFSPPH---HPPPPHFSPPHQPPPSP 59 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 792 HAXXXAXRPPPXTXPPAPXPXPVXPXXPPPP 884 H + P P PP+P P P P PPPP Sbjct: 53 HQPPPSPYPHPHPPPPSPYPHPHQP--PPPP 81 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPP 371 P PL PP PPPP + PPPP Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPP 47 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP + P PPP PPPP P Sbjct: 66 PPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 42.7 bits (96), Expect = 5e-04 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXR--GXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG GG G GG GGG Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G G GG GG GGG G G GG Sbjct: 350 GSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGG 398 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G GGG GG G G GGG Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGG 279 Score = 38.3 bits (85), Expect = 0.010 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGX-GXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G GG GG GGG GGG G GG GG Sbjct: 229 GGGYGDGYGGGHGG-GYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGG 274 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G GG GGG RG G GGG Sbjct: 340 GPSGSYGGGYGSSGIGGYGG-GMGGAGGGGYRGGGGYDMGGVGGG 383 Score = 36.7 bits (81), Expect = 0.032 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX--GGXGXG--GGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G G GG G G G GG GGG Sbjct: 353 GIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGG 406 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG GG G GG G G GGG GRG G G Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXX-GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG GGG G G G GGG Sbjct: 343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGG 393 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 1213 GXXGXXGGXGXG---GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G G G G GGG GGG GG GGG Sbjct: 294 GYSGRYGGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGG 337 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGG-GXRGXXGGXEXXXGG 1094 G G G GG G G G G GGG GG G G GG GG Sbjct: 336 GGYGGPSGSYGG-GYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGG 379 Score = 31.1 bits (67), Expect = 1.6 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGG-GXGRGXXCXGX 817 GG G GGGG GG R GGGG G RGG G G G Sbjct: 266 GGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGR---YGGGGGGYNRGGYSMGGG---GGY 319 Query: 816 GGXP 805 GG P Sbjct: 320 GGGP 323 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GGG G G GG GGG Sbjct: 322 GPGDMYGGSYGEPGGGYGGPSG-SYGGGYGSSGIGGYGGGMGGAGGG 367 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G G GGG GGG G G + G G Sbjct: 229 GGGYGDGYGGGHGGGYGGPGGPYKSGGGYG 258 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGR 838 GG G GGGG GG GGGG G GGG GR Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGG-----SFYGGGGGRGGYGGGGSGR 417 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 386 GGYGAGGGGNGGGSFYGGGG 405 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG GG G GGG GGG G GG GGG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G GG G G GG G GGG GGG G G GG Sbjct: 89 GSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G GG GG GGG GGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG GG G G GGG GGG RG GG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG G GG GG G GGG GGG Sbjct: 150 GYGGGGGGYGGGGGYGGGG-GGYGGGGRGGGGGGG 183 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G GG G G G GGG G GG GGG Sbjct: 89 GSSGGRGGFG-GGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 35.9 bits (79), Expect = 0.055 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXX---RGXXXGGGGXGXXRGGGXGRGXXCX 823 GG G GGGG GG G GGGG G GGG G G Sbjct: 112 GGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGGGGGY 171 Query: 822 GXGG 811 G GG Sbjct: 172 GGGG 175 Score = 31.9 bits (69), Expect = 0.90 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 16/66 (24%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGX----------------GGGXGGGXRGXXGGXE 1109 G G G G GG G GG GG GGG GGG G GG Sbjct: 104 GRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGG 163 Query: 1108 XXXGGG 1091 GGG Sbjct: 164 YGGGGG 169 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGG 170 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 162 GGYGGGGGGYGGGGRGGGGGGG 183 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGG 181 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXG-GXGXGGGXGG 1139 G G G GG G GG G G GGG GG Sbjct: 99 GGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GGGG G G G GG GGGR Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGR 176 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G GGG GG G G GGGG RGGG G C G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGY-GGRGGGGRGGSDCYKCG 135 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 G GG G G G G+GG GGG Sbjct: 93 GRGGFGGGRGGGRGSGGGYGGGG 115 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P P PP P P P P P P P P P P P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP----PXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P P PP P PP P P P PP P P P P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP----PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P PP P P P PP P P P P Sbjct: 95 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP----PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P PP P P P PP P P P P Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSP 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPP----PXPXPPXP--PXPXPPXXPXXPXXXPXPXXP 1241 PP S P P P+ PPP P P P PP P P P PP P P P P Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P PP P P P P P P P P P P P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P PP P P P P P P P P P P P Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPX-PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P P PP P PP P P PP P P P Sbjct: 177 PPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPP 226 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S P P P P PPP PP P P P P P P P Sbjct: 158 PTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVP 208 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP----PXPXPPXXPXXPXXXPXP 1232 PP P P P P PP P PP P P P PP P P P P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP-VPTDPMPSPPP 179 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP----PXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P P PPP P P P PP P P P P P P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX-PPXPXPPXXPXXPXXXPXPXXP 1241 PP S P + P P P P PP P P P P P P P P Sbjct: 185 PPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 235 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P P+ P P P P PP P P P P P P Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 35.9 bits (79), Expect = 0.055 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P+ P PPP P P P P P P P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXX 985 PP P P P PP PPPP P PP P PPPP P Sbjct: 137 PPTPTPSVPSPTPP----VSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSV 192 Query: 986 XPP 994 P Sbjct: 193 PSP 195 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXP-PPXPXPP-XPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P PPP P P P PP P P P P P P P P Sbjct: 173 PMPSPPPPVSP--PPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 220 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P P PP P P P P PP P P P P Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVPTDPM-PSPPPPVSPPPPTPTPSVPSP 195 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P P PP PP PP P P P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPP-PPVSPPPPTPTPSVPSPPDVTP 200 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P PP P P PP P PP P P Sbjct: 155 PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVT 214 Query: 992 P 994 P Sbjct: 215 P 215 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP--------PPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P P P P PPP P PP PP P PP P P Sbjct: 165 PTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPS 224 Query: 968 XPXXXXXPP 994 P PP Sbjct: 225 PPDVTPTPP 233 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX--PPXPXPPXXPXXPXXXPXPXXP 1241 P P S P + P P P P PP P P PP P P P Sbjct: 200 PTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 32.3 bits (70), Expect = 0.68 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPP----PPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P P P PP P P P P PP PPPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Query: 980 XXXPP 994 P Sbjct: 143 SVPSP 147 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P P PP PP P P P P P P Sbjct: 129 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP 178 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T P+ P P P PPPP Sbjct: 99 PPPPTPTPS-VPSPTPPVSPPPP 120 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T P+ P P P PPPP Sbjct: 117 PPPPTPTPS-VPSPTPPVSPPPP 138 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T P+ P P P PPPP Sbjct: 135 PPPPTPTPS-VPSPTPPVSPPPP 156 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/47 (31%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP + PP P P P P P P P P P Sbjct: 195 PPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTP 241 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +3 Query: 816 PPPXTXPPAPX-PXPVXPXXPPPP 884 PP PP P P P P PPPP Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPP 102 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 42.7 bits (96), Expect = 5e-04 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P PPP PPP PP P PP P P P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXX--PRPXPPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P P P PPPR P PPPP PP PPPPP Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNR 573 Query: 980 XXXPP 994 PP Sbjct: 574 APSPP 578 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P PPP PPP P P P PP P P P P Sbjct: 493 PPPTPPAFKPLKGSAPPP-PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PPP PPP PP P PP P P P Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PPP PPP PP P PP P P P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P P PPPP PR PPPPP P PP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPP 563 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP---RXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 PP P P PPP PPPP P R P PPPPP P Sbjct: 542 PPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLAN 601 Query: 983 XXPP 994 P Sbjct: 602 GATP 605 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PPP PPP PP P PP P P P P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP--PGTAAAPPPPPPP 555 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP + P PPP PP P PP P PP P P P P Sbjct: 473 APPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP + PPP PPP P P P PP P P P Sbjct: 523 PPPPPP--PPRAAVAPPP-PPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-----XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP P PP P P P Sbjct: 528 PPPRAAVAPPPPP--PPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + PP PPP P P P PP P P P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 35.5 bits (78), Expect = 0.073 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 11/58 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP----PPXPPPXPX-------PPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P PPP P PP PP P P P P P Sbjct: 554 PPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 7/54 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP-------XPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PL PP PP P PP PP P P P P P Sbjct: 424 PPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP 477 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXP-----PXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PPP PPP P P PP P PP P P P Sbjct: 444 PPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 35.1 bits (77), Expect = 0.096 Identities = 28/142 (19%), Positives = 29/142 (20%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP 995 PPP PP P P+ PPPP PP Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Query: 996 XXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPX 1175 P PP PPP PPP Sbjct: 515 PLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRA 574 Query: 1176 PPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P Sbjct: 575 PSPPPMPMGNSGSGGPPPPPPP 596 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXP----RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P P P PPP P P PP PPPPP P Sbjct: 460 PPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTT 519 Query: 980 XXXPP 994 PP Sbjct: 520 IAAPP 524 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 10/64 (15%) Frame = +3 Query: 1080 AXXXPPPXXXSXPP--XXPLXPPPXPPPXPXPP--------XPPXPXPPXXPXXPXXXPX 1229 A PPP PP PL PPP P PP PP P PP P Sbjct: 450 AISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPP 509 Query: 1230 PXXP 1241 P P Sbjct: 510 PPPP 513 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G P P P P P PPPP PP PPPPP Sbjct: 505 GSAPPPPPPPPLPTTIAAPPPPPPPP--RAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAP 562 Query: 986 XPP 994 PP Sbjct: 563 PPP 565 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 10/60 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--------PPPXPPPXPXP--PXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PPP PPP P PP P PP P P P Sbjct: 567 PPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 14/64 (21%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL-----XPPPXPPPXP---------XPPXPPXPXPPXXPXXPXXXPX 1229 PPP PP P P PPP P PP PP P PP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPP 475 Query: 1230 PXXP 1241 P P Sbjct: 476 PPPP 479 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P P PPP PPP P PP P P P Sbjct: 442 PTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMP 486 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 10/47 (21%) Frame = +3 Query: 1131 LXPPPXPPPXPXP---------PXP-PXPXPPXXPXXPXXXPXPXXP 1241 L PPP PPP P P P P P P PP P P P Sbjct: 414 LFPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPP 460 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 8/52 (15%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXX--------PRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P PPP P PPPP P PP PPPPP P Sbjct: 416 PPPPP---PPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP--RXXPXPPP-PXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P PPP P PPP P PPPPP P Sbjct: 555 PPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 29.1 bits (62), Expect = 6.3 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP------RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P PPP P P PP P PP PPPPP P Sbjct: 416 PPPP----PPPPPPPLSFIKTASLPLPSPPPTPP--------IADIAISMPPPPPPPPPP 463 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 42.7 bits (96), Expect = 5e-04 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXP-XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P+ PP PPP P PP P P PP P P P Sbjct: 125 PPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP----RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P H R PPP R P PP P R PP P P P P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSN 278 Query: 980 XXXPP 994 PP Sbjct: 279 SSSPP 283 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P H PR P P PPPP P P PPPP P PP Sbjct: 175 PSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPP 232 Score = 39.5 bits (88), Expect = 0.004 Identities = 32/145 (22%), Positives = 34/145 (23%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 G PP + + PPP PPP P PP P PP P Sbjct: 48 GNPPETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTE 107 Query: 986 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPPPXPL 1165 PP PP PP PP SPP P Sbjct: 108 APPPANPVSSPPPESSPPPPPPTEAPPTTPITSP--------SPPTNPPPPPESPPSLPA 159 Query: 1166 XXXXXXXXXXXXXXXXXXXPPPXLP 1240 PP LP Sbjct: 160 PDPPSNPLPPPKLVPPSHSPPRHLP 184 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P P P PPP P PP P P P P P P P Sbjct: 63 PPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPP-PEPSPPPPLPTEAPPPANP 114 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P P PP P P P P P P P P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDP-PSNP 166 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP PL PP P P P P P P P P P P P Sbjct: 57 PAQSSPPPETPLSSPP-PEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P PP PP P P P P PP P P P Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLP 184 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP---XXPXXXPXPXXP 1241 PP + PP + P P P P PP P PP P P P P P Sbjct: 77 PPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P P PPP PP PP P P P P P Sbjct: 101 PPPLPTEAPP--PANPVSSPPPESSPPPPPPTEAP--PTTPITSPSP 143 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP P P PP P PP P P P Sbjct: 86 PPTTIPVSPPPEPSPPPPLPTEAP-PPANPVSSPPPESSPPPPPPTEAPP 134 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP----PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P P P P PP P P P P P Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPP 163 Score = 36.3 bits (80), Expect = 0.042 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P PP P PP P PP P P Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Score = 36.3 bits (80), Expect = 0.042 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX-PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + PP P+ PPP P P PP P P P P P Sbjct: 102 PPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPP 149 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PL PP PP PP P PP P P P Sbjct: 154 PPSLPAPDPPSNPLPPPKLVPPSHSPPRH-LPSPPASEIPPPPRHLPSPP 202 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P PP PP PP P P P Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPP 195 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPXPXXX 982 PP P P P P P PPP P PP P P PP Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERP 207 Query: 983 XXPP 994 PP Sbjct: 208 STPP 211 Score = 32.7 bits (71), Expect = 0.51 Identities = 30/144 (20%), Positives = 30/144 (20%), Gaps = 5/144 (3%) Frame = +3 Query: 816 PPPXTXPPA-PXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 PPP PP P P P PPPP P Sbjct: 127 PPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSP 186 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSX----PPXXPLXPPPXPPPX 1160 P PPP PP P P PP Sbjct: 187 PASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Query: 1161 PXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P P Sbjct: 247 SDSKRPVHPSPPSPPEETLPPPKP 270 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P PPP P PP P P P P P P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPP 119 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P P P PP PP P P P P P Sbjct: 232 PPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLP--PPKPSPDPLP 276 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--------PPPP 967 P P P P P PPPP R PP P P PP Sbjct: 199 PSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPP 258 Query: 968 XPXXXXXPP 994 P PP Sbjct: 259 SPPEETLPP 267 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXX--SXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P L PP PPP P PP P P P P P Sbjct: 168 PPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPP 222 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP----XPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P PP P PP P P P P P P Sbjct: 202 PASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHP 255 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S P P P P P P P P P P P Sbjct: 243 PPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLP 287 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +3 Query: 816 PPPXTXP----PAPXPXPVXPXXPPPP 884 PPP T P P P P P P PPP Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/62 (27%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPR-XXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 P P + P P PP P PP P PP PP P Sbjct: 141 PSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPS 200 Query: 989 PP 994 PP Sbjct: 201 PP 202 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 1098 PXXXSXP-PXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXP 1226 P S P P PPP P P P P PP PP P P Sbjct: 252 PVHPSPPSPPEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPP 298 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX-PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S P P+ PPP PP PP PP PP P P P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPP 458 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P + PP P PP PP PP PP PP P P P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ PP PP PP PP P P P P Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 6/57 (10%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP------PPPXPXXXXXPP 994 P PPP P PPP P PP PP PPP P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPP 467 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P P PPP P P PP P PPPPP PP Sbjct: 411 PPPPPPSP-PLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P S PP P+ PP PP PP P P P Sbjct: 429 PSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPP 469 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P PP P P PP P PPPP P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPPXPXXXXXPP 994 +P PP P PPPP PP PP PPP P P Sbjct: 402 KPSPPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP 456 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP 958 PP P P PPP PPPP P PP PP Sbjct: 446 PPPPSIHYSSPPPPPVHHSSPPPPS--PEFEGPLPPVIGVSYASPPPPP 492 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P++ P P+ P PPPP + + PPPPP Sbjct: 423 PVYSPPPSPPVFSPPPSPPVYSPPPPPSIH-YSSPPPPP 460 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXX-XPPPPXHNXFXGPPPPPXF 380 P+F P P+ PP PPPP + PPP P F Sbjct: 432 PVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSPEF 473 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXP--PXXPXXPXXXPXPXXP 1241 P P PP P PP PP P P P P P P P Sbjct: 403 PSPPIVALPPPP-PPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP +P P PV PPPP Sbjct: 447 PPPSIHYSSPPPPPVHHSSPPPP 469 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P+ PP PP P P PP PP P P P P P Sbjct: 104 PPTKPHPHPKPPIVKPPTKPP-PSTPKPPTKPPPSTPKPPTTKPPPSTP 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PP P P PPP P PP P P PP Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPP 173 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP P P P P P P P P P P Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 P P P P PP PP P PP P PP P P P P P Sbjct: 34 PAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PP P PP PP P P P P P P P Sbjct: 134 PPPSTPKPPTTKP--PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP 182 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPR-XXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P PP P P PP P PP P PP P Sbjct: 54 PPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPK 113 Query: 989 PP 994 PP Sbjct: 114 PP 115 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P PP P P P P P PP P P P Sbjct: 123 PPPSTPKPPTKP--PPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPP 166 Score = 35.5 bits (78), Expect = 0.073 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPP 1196 PP PP PP PP P PP PP P PP Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + P P PP P P PP P P P P P P P Sbjct: 76 PPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTP 128 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX--PPXPXPPXXPXXPXXXPXPXXP 1241 P P + P P PP P P P PP PP PP P P P P P Sbjct: 90 PHPKPPTVKPPHP-KPPTKPHPHPKPPIVKPPTKPPPSTP-KPPTKPPPSTP 139 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PP--PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + PP PP PP P P PP PP P P P P P Sbjct: 124 PPSTPKPPTKPPPSTPKPPTTKPP-PSTPKPPHHKPPPTP-CPPPTPTPTPP 173 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP-XPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P P PPP P PP PP P PP P P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP PP PP PP PP P P P P P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAV-KPPKPPAVKPP-TPKPPTVKPHPKPP 77 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPP-PXPPPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 PP P + PP P PP P P P PP PP P P P P Sbjct: 85 PPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKP--PPSTPKP 130 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXP-XPPXXPXXPXXXPXPXXP 1241 PP P P+ PP P PP PP P P P P P P P Sbjct: 172 PPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTP 222 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 8/54 (14%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP------PPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP P PP P PP PP P PP P P Sbjct: 192 PPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP--PXPXXXX 985 P P P P PP + P P PP P PP PPP P P Sbjct: 92 PKPPTVKPPHPKPPTKPHPHPKPPIVKP------PTKPPPSTPKPPTKPPPSTPKPPTTK 145 Query: 986 XPP 994 PP Sbjct: 146 PPP 148 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPP---XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 P P H P P P P P P PP P PP P PP Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210 Query: 986 XPP 994 PP Sbjct: 211 TPP 213 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PP PPP P P P PP P PP Sbjct: 151 PKPPHHKPPPTP--CPPPTPTPTPPVVTPPTPTPP 183 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXP-XPPXXPXXPXXXPXPXXP 1241 PP P P+ PP P PP PP P P P P P P P Sbjct: 182 PPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +3 Query: 1092 PPPXXXSXPP--XXPLXPPP-XPPPXPXPP--XPPXPXPP 1196 PPP PP P PP PP P PP PP P PP Sbjct: 164 PPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPP 203 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P PP PP P P PP P P P P Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXP-XPPXXPXXPXXXP 1226 PP P P+ PP P PP PP P P P P P P Sbjct: 202 PPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIP 247 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P + P P PP P PP PP P P P Sbjct: 67 PPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPP 115 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP---XPXPPXPPXPXPPXXP 1205 PP P P+ PP P P P P PP P P P Sbjct: 212 PPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 31.9 bits (69), Expect = 0.90 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPP---PXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P PP P P PP PP P PP P P P Sbjct: 65 PKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPP 120 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P PP PP P P P P P P Sbjct: 74 PKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKP 123 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP PP P P V P P PP Sbjct: 222 PPVVTPPTPTPPVVTPPTPTPP 243 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP PP P P V P P PP Sbjct: 212 PPVITPPTPTPPVVTPPTPTPP 233 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP---XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 P P P P PP P P PP P PP P PP Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPT 229 Query: 983 XXPP 994 PP Sbjct: 230 PTPP 233 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP PP P P + P P PP Sbjct: 202 PPVITPPTPTPPVITPPTPTPP 223 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P PPP PPP P PP P PP P Sbjct: 146 PPPSTPKPPHHKPPPTPC---PPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Query: 992 P 994 P Sbjct: 203 P 203 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-----PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PP PP P P P P P P P P P P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP P PPP PP P PP PP P P P Sbjct: 70 PPPPVSSPP--PASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PP PPP PP P PP P P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 35.5 bits (78), Expect = 0.073 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P PPP P P PP PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP PP P P P PP PP P P P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P + PP P P P P P P P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPP---XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP PP PP PP P P P Sbjct: 45 PPPV--SAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP + PP P PPP P P PP P P P P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXP 1214 PPP + PP PL PP P P P P P P P P P Sbjct: 105 PPPV--ATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P PPP PPP PP PP P P P Sbjct: 26 PPTATPAPPT-PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP P P P PP P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP---PXPXXXX 985 P P P P PP PPP P PP PPP P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 986 XPP 994 PP Sbjct: 118 SPP 120 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP-RXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P PPP P P P PP PPP P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVAS 92 Query: 989 PP 994 PP Sbjct: 93 PP 94 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP PPP PP P P P P P P P P Sbjct: 82 PPP---ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPXPXXX 982 PP P P PP PP P PP P PPP P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPA 85 Query: 983 XXPP 994 PP Sbjct: 86 TPPP 89 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 795 AXXXAXRPPPXTXPPAPXPXPVXP---XXPPPP 884 A A PPP + PP P P P PPPP Sbjct: 64 APPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T P P P PPPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPP 73 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T PP P P P PPP Sbjct: 82 PPPATPPPVASPPP--PVASPPP 102 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-----PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PP PP P P P P P P P P P P P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP P PPP PP P PP PP P P P Sbjct: 70 PPPPVSSPP--PASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PP PPP PP P PP P P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSP 135 Score = 35.5 bits (78), Expect = 0.073 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P PPP P P PP PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 35.1 bits (77), Expect = 0.096 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP PP P P P PP PP P P P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P + PP P P P P P P P P P Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPP---XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP PPP PP PP PP P P P Sbjct: 45 PPPV--SAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP + PP P PPP P P PP P P P P P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXP 1214 PPP + PP PL PP P P P P P P P P P Sbjct: 105 PPPV--ATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPPLP 146 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P PPP PPP PP PP P P P Sbjct: 26 PPTATPAPPT-PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP P P P PP P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP---PXPXXXX 985 P P P P PP PPP P PP PPP P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 986 XPP 994 PP Sbjct: 118 SPP 120 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP-RXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P PPP P P P PP PPP P Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVAS 92 Query: 989 PP 994 PP Sbjct: 93 PP 94 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP PPP PP P P P P P P P P Sbjct: 82 PPP---ATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPXPXXX 982 PP P P PP PP P PP P PPP P Sbjct: 26 PPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPA 85 Query: 983 XXPP 994 PP Sbjct: 86 TPPP 89 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 795 AXXXAXRPPPXTXPPAPXPXPVXP---XXPPPP 884 A A PPP + PP P P P PPPP Sbjct: 64 APPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T P P P PPPP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPP 73 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP T PP P P P PPP Sbjct: 82 PPPATPPPVASPPP--PVASPPP 102 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP P P PP P P PP P P P P Sbjct: 613 PPPSPLYYPPVTP--SPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + P PPP PPPP PP PPPP P P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYV---YSSPPPPYVYSSPPPPPPSPPPPCPESSPPP 540 Query: 992 P 994 P Sbjct: 541 P 541 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXP-XXXPXPXXP 1241 PP S PP PP PPP P PP P P PP P P P P Sbjct: 506 PPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P P P PP P P P P P Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP + P PP P PP P PP P P P P Sbjct: 496 PPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPP--PPCPESSPPP 540 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 6/55 (10%) Frame = +3 Query: 1095 PPXXXSXPPXXPLX----PPPXPPPXPX--PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ P PPP P PP P P PP P P P P Sbjct: 591 PPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A PPP P PPP PPP P PP P P P P P Sbjct: 438 AYSPPPPPYSKMSPSVRAYPPP-PPPSPSPPPPYVYSSPPPPYVYSSPPPP 487 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPP-----XXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXX 979 P P + P PPP PPPP P PP PP PP P Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Query: 980 XXXPP 994 PP Sbjct: 535 ESSPP 539 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP P P PP P P P P P Sbjct: 514 PPPYVYSSPPPPPPSPPP-PCPESSPPPPVVYYAPVTQSPPPPSPVYYPP 562 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP + P PPP PP P P P P P Sbjct: 467 PPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPP 516 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 9/56 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPX---------PPXPXPPXXPXXPXXXPXP 1232 PP S PP P PPP P P PP PP P P P P P Sbjct: 515 PPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P P P P P PP P P P P Sbjct: 583 PPPSPVYYPPV--TYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Score = 35.1 bits (77), Expect = 0.096 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 9/59 (15%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPP----XPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P + P PPP P PP PP P P P P P P Sbjct: 476 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P P PP P PP P P P P Sbjct: 568 PPPSPVYYPPV--TNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPP 615 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +3 Query: 1095 PPXXXSXPPXXPLX-----P-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ P PP P P PP P P PP P P P Sbjct: 621 PPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP---PPXPXPPXPPXP--XPPXXPXXPXXXP 1226 PPP PP PPP P PP P PP P PP P P Sbjct: 553 PPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXP---RPXPP-----PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P + P P PP P+ P PPPP PP P PP Sbjct: 584 PPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPP 643 Query: 968 XPXXXXXPP 994 P PP Sbjct: 644 PPSPVYYPP 652 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP---PPXPXPPXPPXP--XPPXXPXXPXXXPXPXXP 1241 PPP P PPP P PP P PP P PP P P P Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPP 592 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP---PXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PPP P P PP P P P P P P Sbjct: 426 PPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +3 Query: 270 PXXXSPLXPXFF----PPXXXXXPPPPXHNXFXGPPPPPXFF 383 P SP P + PP PPPP + + PPPPP + Sbjct: 461 PPSPSPPPPYVYSSPPPPYVYSSPPPPPY-VYSSPPPPPYVY 501 Score = 30.3 bits (65), Expect = 2.7 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 14/64 (21%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP----------PPXP----XPPXPPXPXPPXXPXXPXXXPX 1229 PPP S PP P PP P PP P PP P PP P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNS 581 Query: 1230 PXXP 1241 P P Sbjct: 582 PPPP 585 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PP P PP P P+ PP P PP P P Sbjct: 582 PPPPS---PVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYY--PPVTPSPPPPSPVYYP 636 Query: 992 P 994 P Sbjct: 637 P 637 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P P PP P P PP P PPP P Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYV 500 Query: 980 XXXPP 994 PP Sbjct: 501 YSSPP 505 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 P + PP P P P PP P PP PP P P P Sbjct: 451 PSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPP 497 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S P P PPP PP P PP P P P Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 507 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFF 383 P SP P PP PPPP + PPPPP + Sbjct: 459 PPPPSPSPP---PPYVYSSPPPPY--VYSSPPPPPYVY 491 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P PP P PP P P PP P PP P P Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSPVYYP--PVTPSPPPPSPVYYPPVTPSPPPPSPVYYP 666 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP P+ PPP PPP P P PP PP P P Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYP-PPIYSPPPTPISP 108 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PP P PP PP PP P P P P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXP----PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P P P+ PP PP P P P P P P P P P Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP P P PP PPP PP P PP Sbjct: 76 PPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P + P PPP PPPP P PP PPP P Sbjct: 55 PPPPVYSRPVAFPPPPPIYSPPPPPIYP---PPIYSPPPPPIYPPPIYSPPPTP 105 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/55 (40%), Positives = 23/55 (41%), Gaps = 8/55 (14%) Frame = +3 Query: 1092 PPPXXXSX---PPXXPLXPPPX--PPPXPX--PPXPP-XPXPPXXPXXPXXXPXP 1232 PPP S PP P+ P PPP P PP PP P P P P P P Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXP 1193 PPP PP P+ PPP PPP P P P P Sbjct: 82 PPPIYSPPPP--PIYPPPIYSPPPTPISPPPKVHHP 115 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXH-NXFXGPPPPP 374 P SP P +PP PPPP + PPP P Sbjct: 70 PPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP-----RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP---P 967 PP P + P PPP R PPPP PP PPP P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Query: 968 XPXXXXXPP 994 P PP Sbjct: 102 PPTPISPPP 110 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 SP P + P PPP PPPPP + Sbjct: 41 SPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIY 73 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP L PP PP PP P PP P P P Sbjct: 136 PPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP L PP PP PP PP P P P P Sbjct: 82 PPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 128 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP L PP PP PP PP P P P P Sbjct: 109 PPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPP 155 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP L PP PP PP PP P P P P Sbjct: 118 PPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPP 164 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 46 PPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 73 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 127 PPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 55 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 64 PPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPP 110 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 100 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPP 146 Score = 37.9 bits (84), Expect = 0.014 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P P P Sbjct: 91 PPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPP 137 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P L PPP P PP P PP P P P Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P L PPP P PP P PP P P P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P L PPP P PP P PP P P P Sbjct: 81 PPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P L PPP P PP P PP P P P Sbjct: 90 PPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 35.5 bits (78), Expect = 0.073 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP----PPXPXX 979 PP P P PP P PPP P P PPP PP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 103 Query: 980 XXXPP 994 PP Sbjct: 104 NLSPP 108 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP----PPXPXX 979 PP P P PP P PPP P P PPP PP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPV 148 Query: 980 XXXPP 994 PP Sbjct: 149 LLSPP 153 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P RP PPP PPPP PPPPP P Sbjct: 161 PPPPT--VTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXP 1232 P P PP P+ PPP PP PP P P P P Sbjct: 36 PAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 286 PSXXXFSPPXPXXXXPPXXTTXSXAPXPP 372 P FSPP P PP T + +P PP Sbjct: 154 PPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PPP P P PP P P P Sbjct: 161 PPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P + P P PP P PPP P P PP P Sbjct: 135 PPPPVNLSP-PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 29.5 bits (63), Expect = 4.8 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXP-----PPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPX 976 PP P P P P PP PPPP R P PPPP Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTP--PPPPYKY 201 Query: 977 XXXXPP 994 PP Sbjct: 202 GRVYPP 207 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 4/64 (6%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP----PPXPXXX 982 P P P PP PPP P P PPP PP P Sbjct: 36 PAPLVDLSPPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVL 95 Query: 983 XXPP 994 PP Sbjct: 96 LSPP 99 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP------PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP PP PP P PP P P P Sbjct: 172 PPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PL P P P P PP P P P P P P P Sbjct: 176 PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSP 226 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +3 Query: 1128 PLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP PPP P P P PP P P P P P P P Sbjct: 161 PPLPPP-PPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PL P PPP P P P P P P P P P P P Sbjct: 232 PPPSSSPTPGPDSPLP-SPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 8/57 (14%) Frame = +3 Query: 1095 PPXXXSXPPXX-PLXPPPXPPPXPXPPXP-PXPXP------PXXPXXPXXXPXPXXP 1241 PP PP PL PPP P P P P P P P P P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P PPP P PPPP P P P PPP P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P PL P P P P PP P P P P P Sbjct: 204 PPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGP 251 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P P P P Sbjct: 226 PLPLPGPPPSSSPTPGPDSPLPSPGPP--PSPSPTPGPDSPLPSPGPDSP 273 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P S P PL P PPP P P P P P P P P P P Sbjct: 186 PDSPLPSPGPDSPLP-LPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGP 232 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P P PP P P P PPP P P Sbjct: 161 PPLP----PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDS 216 Query: 992 P 994 P Sbjct: 217 P 217 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 P P P PPP P P P P P P PP P P P P Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSP-SPTPGPDSPLP 266 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P P PPP P P P P P P P PP Sbjct: 193 PGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPP 252 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXP 1226 P P P PPP P P P P P P P P P P Sbjct: 189 PLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPP 234 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P P P P P P P P P P P P P P P P Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLP 247 Score = 29.9 bits (64), Expect = 3.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSX-PPXXPLXPPPXPPPXP---XPPXPPXPXP-PXXPXXPXXXPXPXXP 1241 P P S P P P P P P P P P P P P P P P P P Sbjct: 210 PTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP 264 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P P P P PPP P P P P PP P P P Sbjct: 240 PGPDSPLPSPGPPPSPSPTPGPDSPLP--SPGPDSPLPSPGPDPPLPSPGP 288 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P P P P P PP P P P P Sbjct: 168 PPYPSPLPPPPSPSPTPGPDSPLPSPGP-------DSPLPLPGPPPSPSPTPGPDSPLPS 220 Query: 992 P 994 P Sbjct: 221 P 221 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXP-PXPPXPXP-PXXPXXPXXXPXPXXP 1241 P P P P P P P P P P P P P P P P P P P Sbjct: 193 PGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSP 245 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PL PP P P P PP PP P P P P Sbjct: 578 PPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P + PP PP P PP PP P P P P P Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PPP PPP P PP P P P P Sbjct: 580 PPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 815 PXPXHXXPRPXPPP--RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P P PPP R P P P P PP PPPPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P + P PP P R PP PPPPP P P Sbjct: 530 PPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPP 589 Query: 992 P 994 P Sbjct: 590 P 590 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P P P PP PP P PP P P P P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP--PPSSRSIPSPSAP 618 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P R PPP P PP P P PP PPPP Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 39.1 bits (87), Expect = 0.006 Identities = 32/127 (25%), Positives = 33/127 (25%), Gaps = 10/127 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPP-----PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPX 976 PP P P P PP P PPPP P PP PPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPA 653 Query: 977 XXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXS--- 1147 PP +PP PP PP S Sbjct: 654 AKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAP--KPPAPPPLPPSSTRL 711 Query: 1148 --PPPXP 1162 PPP P Sbjct: 712 GAPPPPP 718 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP-RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P P PPP P PPPP R P PPPP Sbjct: 718 PPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P+ P PPP P PP P PP P P P P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPP 604 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PPP PPP PP PP P P P P P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P PPP PP PP P PP P P P Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 36.3 bits (80), Expect = 0.042 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 8/43 (18%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP--------XPPXPPXPXPP 1196 PPP S P PPP PPP P P PP P PP Sbjct: 489 PPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 36.3 bits (80), Expect = 0.042 Identities = 34/147 (23%), Positives = 35/147 (23%), Gaps = 7/147 (4%) Frame = +3 Query: 813 RPPPXTXPPAPX---PXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 983 RPPP PP P P P PPPP Sbjct: 598 RPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCA 657 Query: 984 XXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXP----LXPPPXP 1151 PP A P + PP P L PP P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPP-P 716 Query: 1152 PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P P PP P P P Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 36.3 bits (80), Expect = 0.042 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Frame = +3 Query: 1092 PPPXXXSX-----PPXXPLXPPPXPPP-----XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP PP P PP PP P PP P P P Sbjct: 663 PPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPP-PLPPSSTRLGAPPPPPPPP 721 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PL P PPP P P P PP P P Sbjct: 714 PPP-----PPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXP--PXPPXPXPPXXPXXPXXXPXP 1232 P PPP PPP P P PP P P P P P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 7/42 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP-------XPPXPPXPXPP 1196 PPP S P PPP PPP P P P P PP Sbjct: 510 PPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP-----PXPX 976 P H PPP P PPPP R PP PPPP P P Sbjct: 560 PLTTLHQPINKTPPP---PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPS 616 Query: 977 XXXXPP 994 PP Sbjct: 617 APPPPP 622 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + P L P P P PP PP P P P P P P Sbjct: 551 PLPSFSNRDPLTTLHQPINKTPPPPPP-PPPPLPSRSIPPPLAQPPPPRP 599 Score = 31.9 bits (69), Expect = 0.90 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = +2 Query: 821 PXHXXPRPXPPPRXX----PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 P P P PPP+ P PP P P PP PPPPP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLP--------PSSTRLGAPPPPPPPPLSKTPAP 728 Query: 989 PP 994 PP Sbjct: 729 PP 730 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 10/60 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPX----------PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PPP P PP PP P P P Sbjct: 588 PPPLAQPPPPRPP--PPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPP 645 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSX-PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP PL P PPP P PP P P P Sbjct: 719 PPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 8/42 (19%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP--------XPXPPXPPXPXPP 1196 PP P PPP PPP P P PP P PP Sbjct: 471 PPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 29.9 bits (64), Expect = 3.6 Identities = 27/123 (21%), Positives = 29/123 (23%), Gaps = 6/123 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP------XP 973 PP P P + P PPPP PP PPPPP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPP------PLFMSTTSFSPSQPPPPPPPPPLFTSTTSF 541 Query: 974 XXXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRPPXXPPXPPXSPP 1153 PP + PP P PP PP Sbjct: 542 SPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPP 601 Query: 1154 PXP 1162 P P Sbjct: 602 PPP 604 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P PP PP P P P P Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PL P PP PP P P P P P Sbjct: 548 PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPP 597 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P PL P PPPP + PPPPP Sbjct: 698 PPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G G G G G GG + GGG Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G GG G G GG GGG GGG G G GGG A Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGA 139 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -3 Query: 1231 GXGXXXGXXGXX-GGXGXGGXGGXGXGGGXGGG 1136 G G G G GG G GG G G GGG G G Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXC 826 G GGGG GG G G GGG GGG G G C Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSGQWC 149 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGRXA 806 GGGG G TG G G GG GG A Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGA 139 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GG GGG G G GGG Sbjct: 122 GGGGGGVVIGG-GFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGG 170 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGG-GXRGXXGGXEXXXGGG 1091 G G G G G G G G GG G G G GG G G GG GGG Sbjct: 132 GGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGG 182 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GGG G GG GGG Sbjct: 115 GGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGG 164 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG GG G G GGG G G GGG Sbjct: 147 GWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGG 196 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXG-GXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG G G G GG G GGG G G GG GG Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGG 187 Score = 35.9 bits (79), Expect = 0.055 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXG---GXGGXGXGG---GXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G GG G GG G GGG G G G G Sbjct: 155 GGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGSG 210 Score = 35.1 bits (77), Expect = 0.096 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGG--GXGXXRGGGXGRGXXCXG 820 GG G G GGG G G GGG G GGG G G C G Sbjct: 132 GGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSG 191 Query: 819 XGG 811 GG Sbjct: 192 GGG 194 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGG G G G G G GG G GGG G G G G Sbjct: 126 GGVVIGGGFGGGAGYGSGGGLGWDGGNGGG---GPGYGSGGGGIGGGGGIGGGVIIGGGG 182 Query: 813 G 811 G Sbjct: 183 G 183 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = -3 Query: 1204 GXXGGXGXG-GXGGXGXGGGXGGG--XRGXXGGXEXXXGGG 1091 G GG G G G GG G GGG GG G GG GGG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGG 145 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G G G G G GG G G Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSG 162 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G GG GG GGG GGG GG GG Sbjct: 106 GYGGGGPGYGGGGYGPG---GGGGGVVIGGGFGGGAGYGSGGGLGWDGG 151 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG--GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GGG G G G G GGG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG 156 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGGGG GG G G GGGG G GG +G Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGG--GGGGGGYGHGGVSTKG 208 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP P P PP P P P P P P P P Sbjct: 340 PPVPIVNPPSLP--PPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIP 386 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S P P PL P PP P P P PP P P P P P P P Sbjct: 288 PNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLP 340 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXP-PXXPXXPXXXPXPXXP 1241 P P + PP L P P P PP PP P P P P P P P P Sbjct: 326 PIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PL PP PP P P P P P P P P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIP 302 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P P PP P P P P P P Sbjct: 268 PPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLP 317 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P+ PP P PP P P P P P P Sbjct: 347 PPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPP 390 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S PP P P P PP P PP P P P P P Sbjct: 349 SLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIP 389 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P+ P PP P P P PP P P P P P Sbjct: 322 PTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP 363 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P L P P P P PP P P PP P P P P P Sbjct: 273 PPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIP-LLPTPPTP 322 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P P P P P PP P P P P P P Sbjct: 299 PPIPLIPTPPTLPTIP--LLPTPPTPTLPPIPTIPTLPPLPVLPPVP 343 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + P P PL P PP P P P P P P P P P P Sbjct: 300 PIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPP 352 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 1128 PLXPPP-XPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PL P P PPP PP P P P P P P P P P Sbjct: 178 PLLPDPSFPPPLQDPPNPSPLPNLPIVPPLP-NLPVPKLP 216 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P P P PP P Sbjct: 186 PPPLQDPPNPSPLPNLPIVPPLP 208 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP--PXXPXXPXXXPXP 1232 PP P PL P PP P P P P P P P P P Sbjct: 186 PPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLPPGP 233 Score = 29.1 bits (62), Expect = 6.3 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 12/62 (19%) Frame = +3 Query: 1092 PPPXXXSXP----PXXPLXP-PPXPPPXPXPPXPP-------XPXPPXXPXXPXXXPXPX 1235 P P S P P PL P PP PP P P PP P PP P P P Sbjct: 274 PNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPP-TPTLPPIPTIPT 332 Query: 1236 XP 1241 P Sbjct: 333 LP 334 Score = 28.7 bits (61), Expect = 8.4 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPX----PPXPPXPXPP-XXPXXPXXXPXPXXP 1241 S PP PL PP P P P PP P P P P P P P Sbjct: 184 SFPP--PLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLPLPLVPPLLP 230 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPP-XPXPPXPPXPXPPXXP 1205 PP PP P PPP PP P PP P P PP P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 36.3 bits (80), Expect = 0.042 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P P P PP P P P P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 32.3 bits (70), Expect = 0.68 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP PP P PPP PP P Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 1116 PPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P PP P P P PP P P PP P P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFP-PEPPSIPPPPPPSP 194 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPP 1181 PP PP P PP P P P PP PP Sbjct: 165 PPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P F P P P +FPP PPPP PP PP Sbjct: 165 PPFSPSIPPP-SPPYFPPEPPSIPPPP-------PPSPP 195 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GGG G G G GG GGG Sbjct: 114 GRGRGSGGGGGHGG-GGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G GGG GG G G GGG Sbjct: 106 GSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRG 1127 G G G G G GG G G G G G GGG GGG G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG GG G GG GG G G GGG Sbjct: 109 GRSGSGRGRGSGG--GGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXG-GXG-GXGXGGGXGGG 1136 G G G G G GG G G G G G G GGG GGG Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXG---GGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GG GG G GG GGG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G G G G GGG GGG A Sbjct: 38 GGIGAGIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDA 91 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G G G G G GG G G RG GG GGG Sbjct: 85 GGGGGDAGSEAGSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGG 130 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGGG G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSG 142 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GG G G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNG 144 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 GRG G GG G GGGG G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGG 134 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRG 835 G GGGG G RGGG G G Sbjct: 123 GGHGGGGGGGGGRGGGGGSG 142 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G G G GG G G GGGG G GGG G G GG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGG-GRGGGGGSGNGEGYGEGGG 152 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 GRG GGGG GGGG G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRG 136 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPP---XPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P PP P+ PPP PPP P P P P PP P P P P Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSP 104 Score = 38.7 bits (86), Expect = 0.008 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P+ P P P P P P P P P P Sbjct: 83 PPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMESSPSPGPMP 129 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P P P PPP P P P PP P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PPP P P P PP P P P P Sbjct: 51 PPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P+ PPP P P P P P P P P Sbjct: 69 PPPMPMTPPPMPMAPPPMPM-ASPPMMPMTPSTSPSPLTVPDMPSPPMP 116 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +2 Query: 812 PPXPXHXXPRP-XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP P P P PPP PP P P P P PP Sbjct: 63 PPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPP 114 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 P P T PP P P P PPP Sbjct: 64 PMPMTPPPMPMTPPPMPMAPPP 85 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 1128 PLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 P+ PP P P P P P P P P P P P P Sbjct: 58 PMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASP-PMMP 95 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P P PP PPP P PP PP P P P P Sbjct: 710 PPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAP 760 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP-------XPPXPPXPXPPXXPXXP 1214 PPP S P PPP PP P PP PP P PP P P Sbjct: 695 PPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 37.9 bits (84), Expect = 0.014 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPPP--------XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P P PPP PPP PP PP P P P P P P Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPP 732 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXPXXP 1241 A PPP P PPP P PP PP P P P P P P P Sbjct: 685 ALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPP PPPP P PP PP P P Sbjct: 717 PPTPIVHTSSPPPPPP----PPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP 772 Query: 992 P 994 P Sbjct: 773 P 773 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 7/61 (11%) Frame = +3 Query: 1080 AXXXPP--PXXXSXPPXXPLXPPPXP-----PPXPXPPXPPXPXPPXXPXXPXXXPXPXX 1238 A PP P + PP P PPP P P PP PP P P P P Sbjct: 756 APPAPPRLPTHSASPPP-PTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPAL 814 Query: 1239 P 1241 P Sbjct: 815 P 815 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P P P PPPP P PP PP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAP 760 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 792 HAXXXAXRPPPXTXPPAPXPXPVXPXXPPPP 884 H+ PPP PPAP V PPPP Sbjct: 700 HSTVTKVPPPPPPAPPAPPTPIVHTSSPPPP 730 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 10/59 (16%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXP----------PXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PPP PP P P P P PP P P P P Sbjct: 720 PIVHTSSPPPPP--PPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAP 776 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP + P P PPP P P P P P P Sbjct: 778 PPPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALPTGP 818 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP PP P P PPPP Sbjct: 768 ASPPPPTAPPPPPLGQTRAPSAPPPP 793 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 9/69 (13%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP---------XXXPRXXXXXXXXXXXXXXXPPXPPPP 964 PP + +P P P PPPP P PP PPPP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Query: 965 PXPXXXXXP 991 P P P Sbjct: 734 PPPPAPPTP 742 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP PP P P P P P P P Sbjct: 198 PPPSTSGYPPIPSAYPPP-PPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXP 1214 PP + PP PP P P PP PP P PP P Sbjct: 191 PPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYP 234 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPP----XPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP PPP PP P PP PP P P P P P Sbjct: 185 PPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGP 237 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPX-PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP S PP P PPP P PP P P PP P P P P Sbjct: 31 ASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP 85 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXX-PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP P P P P PP P P P P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLP--PPSPPGSLTP 75 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PP--PXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P S PP P PP P P P P P P P P P P P Sbjct: 55 PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSP 105 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXPXXP 1241 P S PP PL P PP P PP P P P P P P P P Sbjct: 47 PSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITP-SPPSPTTP 96 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P P P P P PP P P P P P P P P Sbjct: 66 PPSPPGSLTPPLP-QPSPSAPITPSPPSPTTPSNPRSPPSPNQGP-PNTP 113 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPP 1172 S PP P PP PPP P PP Sbjct: 215 SLPPPKPPSPPRKPPPPPPPP 235 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXP 1193 PPP PP P P PP P P Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXPXXP 1241 P + PP PPP P PP P PP P P P P Sbjct: 19 PTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A PPP T P +P P P PPP Sbjct: 31 ASSPPPTTTPSSPPPSPSTNSTSPPP 56 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P+P PPR P PPPP Sbjct: 219 PKPPSPPRKPPPPPPP 234 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PP PP P P P P P PP Sbjct: 69 PPGSLTPPLPQPSPSAPITPSPP 91 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PP P PP P P PP P P P Sbjct: 44 PPSPSTNSTSP-PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSP 102 Query: 992 P 994 P Sbjct: 103 P 103 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 1180 PPPXPPXXPXXPXXXPXPP 1236 PPP PP P P P PP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P P PPP PPP PP P P P P P Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P P P PP P P P P P Sbjct: 64 PPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 37.1 bits (82), Expect = 0.024 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPPPPPXPXXX 982 PP P P P PPP+ P PP P P P P PPPPP P Sbjct: 63 PPPPQ--TPPPPPPPQSLP-PPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHF 119 Query: 983 XXP 991 P Sbjct: 120 SSP 122 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP------XPPXPPXPXPPXXP 1205 PPP S PP P P PP P P PP P PP P Sbjct: 71 PPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPP 114 Score = 35.9 bits (79), Expect = 0.055 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 P P PP P PPP P PP PP P Sbjct: 85 PEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P L PP P P P PP P P P P P P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Score = 32.3 bits (70), Expect = 0.68 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P P PP P P P P P P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPP 81 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 7/67 (10%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP-------XPPPPPXP 973 P P P PPP P PPPP P+ PP PPPP P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPP---PQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP 108 Query: 974 XXXXXPP 994 PP Sbjct: 109 LPPPPPP 115 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S P L PP P P PP P PP P P P Sbjct: 53 SPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPP 93 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P L P P PPPP H+ PPPP Sbjct: 72 PPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +2 Query: 836 PRPXPPPR-XXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P P P P P PPPP P P PPPP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PPP P PP P PP P P Sbjct: 384 PPPP----PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP-RXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P P PPP+ P PPP P + PP PP P Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P P PP P PP PP P P P P Sbjct: 388 PPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGP-PKPP 436 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PPP P P P PP P P P P Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + P PPP PPPP P+ PPPPP P P Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPP-PPPKKGPAAPPPPPPPGKKGAGPPPPP-PMSKKGP 432 Query: 992 P 994 P Sbjct: 433 P 433 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPP------XXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PPP PPP PP P P P P P Sbjct: 387 PPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P PP P PP P P P P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPP------XPXPPXXPXXP 1214 A PPP P P PPP PP PP P PP P P Sbjct: 392 AAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 327 PPPPXHNXFXGPPPPP 374 PPPP GPPPPP Sbjct: 410 PPPPPGKKGAGPPPPP 425 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GG GGG G G G G Sbjct: 136 GYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAG 185 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GGG GG G GG GG Sbjct: 139 GSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGX--GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G G GG G GG GGG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX--GXGGXGGXGXG-GGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G G GG GG G GG GG Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG GG GG GG GG G GG GG Sbjct: 149 GYGGSGGYGGGAGGYGGNSGGGYGGNA-AGGYGGSGAGGYGGDATGHGG 196 Score = 37.1 bits (82), Expect = 0.024 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGGG G G G G GG G GGG G G G G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYG-GNAAGGYG 180 Query: 813 G 811 G Sbjct: 181 G 181 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G G G GG G GG GG G G GG Sbjct: 152 GSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGG 200 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GAGG GG Sbjct: 133 GGGGYGGSGGYGGGAGGYGGSGG 155 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGG G Sbjct: 128 GGYGGGGGGYGGSGGYGGGAGG 149 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 40.3 bits (90), Expect = 0.003 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GG GGG +G G GGG Sbjct: 35 GYGGRGASGG--GSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 34.3 bits (75), Expect = 0.17 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 8/62 (12%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXX---RGXXXGGGGXGXXRGGGXG-----RGXXCXGX 817 G GGGGG GG G RG GGGG G GGG G RG G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Query: 816 GG 811 GG Sbjct: 82 GG 83 Score = 33.1 bits (72), Expect = 0.39 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGG-GXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GG GG G G GG GGG Sbjct: 19 GGDGYGGGGGYGG--GDAGYGGRGASG-GGSYGGRGGYGGGGGRGNRGGGG 66 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 412 GGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRG 257 GG P P GGGGG G G GG G RG G RG Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGG--DAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GGRG GGG G GGGG Sbjct: 48 GGRGGYGGGGGRGNRGGGGG 67 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 40.3 bits (90), Expect = 0.003 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GG GGG +G G GGG Sbjct: 35 GYGGRGASGG--GSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 Score = 34.3 bits (75), Expect = 0.17 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 8/62 (12%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXX---RGXXXGGGGXGXXRGGGXG-----RGXXCXGX 817 G GGGGG GG G RG GGGG G GGG G RG G Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 Query: 816 GG 811 GG Sbjct: 82 GG 83 Score = 33.1 bits (72), Expect = 0.39 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGG-GXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GG GG G G GG GGG Sbjct: 19 GGDGYGGGGGYGG--GDAGYGGRGASG-GGSYGGRGGYGGGGGRGNRGGGG 66 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 412 GGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRG 257 GG P P GGGGG G G GG G RG G RG Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGG--DAGYGGRGASGGGSYGGRGGYGGGGGRG 60 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GGRG GGG G GGGG Sbjct: 48 GGRGGYGGGGGRGNRGGGGG 67 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 6/59 (10%) Frame = +2 Query: 836 PRPXPPP------RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P PPP P PPPP R PP PPPPP P PP Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PL PPP PP PP P P P P P P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX----PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P PPP PP P PP PP P P P P Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PL PPP P P PP P PP P P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 L P P PPP P P PP P P P P Sbjct: 12 LVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 1128 PLXPPPXPPPXPX---PPXPPXPXPPXXPXXPXXXPXP 1232 PL PPP PPP P P PP P PP P P P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXX---PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PL PPP PP P PP P P P P P Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP--PXPPPPPXP 973 G P P P P P R P PPPP R P PPPPP P Sbjct: 19 GRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP----PXPXPPXPPXPXP 1193 PPP PL PPP P P PP PP P P Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPPXL 1242 P PPPP PP P P PP + Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPPM 48 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPPXL 1242 P PPPP PP P P PP + Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPPAM 62 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP PP P PP P P P P P Sbjct: 27 PPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P PP PP P PP P P P P P Sbjct: 35 PPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPP 84 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P P PP P PP P P P P P Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPP 72 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG G G GGG GG G G GGG Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G GG G G G G GGG GGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG GG G GG GGG Sbjct: 98 GRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGG 132 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G GG G G GGG GGG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 897 RGXXXGGGGXGXXRGGG-XGRGXXCXGXGG 811 RG GGGG G RGGG G G G GG Sbjct: 99 RGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGG-XGRGXXCXGX 817 GG G GG GG GG R GGGG GGG G G G Sbjct: 118 GGGYGGRGSGGRGGGGGDNSCFKCGEPGHMA-RECSQGGGGYSGGGGGGRYGSGGGGGGG 176 Query: 816 GG 811 GG Sbjct: 177 GG 178 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGGXEXXXGG 1094 GG G GG GGG G GG GG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGG G GGGG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGG 175 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 40.3 bits (90), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG GG G GGG GGG G G G G Sbjct: 78 GNGNAHGRADCPGGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSG 124 Score = 36.7 bits (81), Expect = 0.032 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GGG GGG G G GGG Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G GG G GG G G G G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG G GGG GG G G G Sbjct: 91 GIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYG 128 Score = 32.3 bits (70), Expect = 0.68 Identities = 27/116 (23%), Positives = 27/116 (23%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG G GG Sbjct: 98 GGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGG 157 Query: 981 XXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G G G G GGGG G GGG G G G G Sbjct: 158 GGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSG 213 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G G G G G G G GGG Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGG 193 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G G G G G G G G GGGG G G G G G G G Sbjct: 164 GSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 30.7 bits (66), Expect = 2.1 Identities = 31/121 (25%), Positives = 31/121 (25%), Gaps = 4/121 (3%) Frame = -1 Query: 1161 GXGGGEXGGXGGXXGGRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGXXGGXX 982 G GGG GG GG G G GG Sbjct: 101 GGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGGGGGGD 160 Query: 981 XXXGXGGGGGXG-GXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGG---GXGRGXXCXGXG 814 G G G G G G G GGGG G GG G G G G Sbjct: 161 GSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Query: 813 G 811 G Sbjct: 221 G 221 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG GG G G G G G G G Sbjct: 84 GRADCPGGIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSG 130 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG-GXGXGGGXGGG 1136 G G G G GG G G G G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G GG G GGG G G G G G G A Sbjct: 130 GDGRVSSSGEYSASAGGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTA 180 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP PPP PP PP P PP P P P P Sbjct: 54 PDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PPP PP P P P P PP P P P Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP + PP P PP PPP P PP PP P P P Sbjct: 60 PPPATAAQPP--PNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP PP P P PP P P P P Sbjct: 78 PPPTPPSSPP--PSITPPPSPPQPQP--PPQSTPTGDSPVVIPFPKPQLP 123 Score = 31.9 bits (69), Expect = 0.90 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLXPPP----XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P PPP PPP P P P PP P P P P P Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSP-PPSITPPPSPP 97 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P + PPP PPP PP PP P P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PP S PP + PPP PP PP P P P P P Sbjct: 79 PPTPPSSPPP--SITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPP 881 A +PPP PP P P P PPP Sbjct: 65 AAQPPP-NQPPNTTPPPTPPSSPPP 88 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PP P P PP P PP P P+ P PPP P Sbjct: 79 PPTPPSSPPPSITPP---PSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFP 129 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P P P P PP P P P P P P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P P P P PP P P P P P P Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P P P P PP P P P P P P Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P P P P PP P P P P P P Sbjct: 64 PKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P P P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPK-PKPKPAPTPPKPKPAPAPTPP 73 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P P P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPK-PKPAPAPTPPKPKPAPAPTPP 84 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P P P P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPK-PKPAPAPTPPKPKPKPAPTPP 95 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P P P P Sbjct: 59 PTPPKPKPAPAPTPPKPKPAPAPTPPK-PKPKPAPTPPNPKPTPAPTPP 106 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPP-PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P P PP P+ P P PP P+ PP P P P P Sbjct: 61 PPKPK-PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPA 119 Query: 989 P 991 P Sbjct: 120 P 120 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 812 PPXPXHXXPRPXPP-PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 PP P P P PP P+ P P PP P+ PP P P P P Sbjct: 28 PPKPK-PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Query: 989 PP 994 P Sbjct: 87 KP 88 Score = 37.9 bits (84), Expect = 0.014 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 PP P P P P P P P P P P P PP P P P Sbjct: 72 PPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P P P P P P P P PP P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P P P P P P P P PP P P P Sbjct: 39 PPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P P P P P P P P PP P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P P P P P P P P PP P P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Score = 36.3 bits (80), Expect = 0.042 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P P P P P P PP P P P P P P P Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPK-PTPAPTPPKPKPAPAP 114 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P PP P P P P PP P P P P P P Sbjct: 75 PKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP-APTPAPKP 122 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P P P P P P P P PP P P P P P P P P Sbjct: 81 PTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP-APKPKPAP 126 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 PP P P P P P P P P P P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP-KPKPAPKP 128 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXP-PPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 P P P+P P PP+ P P PP P PP P P P P Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPK 107 Query: 986 XPP 994 P Sbjct: 108 PKP 110 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P P P P P P P P P P P P Sbjct: 94 PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 815 PXPXHXXPRPXP-PPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 P P P P P PP+ P P PP P PP P P P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPN 96 Query: 986 XPP 994 P Sbjct: 97 PKP 99 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXP 1205 P P PP P P PP P P P P P P P Sbjct: 86 PKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P PP P P P P P P P P P Sbjct: 97 PKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A P P P P P P PP P P P P P P P P P Sbjct: 80 APTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKP-KPAPKPAP 130 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/61 (27%), Positives = 18/61 (29%), Gaps = 3/61 (4%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP---PPPPXPXXXXXP 991 P P+P P P P P P P P P PP P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTP 83 Query: 992 P 994 P Sbjct: 84 P 84 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 PP S PP P PP PP PP PP P P P P P Sbjct: 90 PPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 PP S PP P P P PP P P PP P P P P P Sbjct: 109 PPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP P + PPP P P PP P PP P P P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPP 149 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P+ PPP PP P P P PP P P P Sbjct: 29 PTTPSAPP--PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP + PP P PP PP P P P P P P Sbjct: 81 PPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSP--PPPPDASPSPPAP 128 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S P P P P P P PP P P P P P Sbjct: 116 PPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTP 165 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P P PPP P PP P P P P P Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETP 146 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P PPP PP P PP P P P P P Sbjct: 22 PPPLQTQ--PTTPSAPPPVTPP-PSPPQSPPPVVSSSPPPPVVSSPP 65 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PPP PP PP PP P P P P Sbjct: 56 PPPPVVSSPPPSS-SPPPSPPVITSPPPTVASSPP--PPVVIASPPPSTP 102 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPXTXPPAP--XPXPVXPXXPPPP 884 PPP T PP+P P PV PPPP Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP S PP PPP P P P P PP P Sbjct: 41 PPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPP 81 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP PPP PP P PP P P P Sbjct: 74 PPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPP 119 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +2 Query: 815 PXPXHXXPR-PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P P PP P P PP P P PPP P P Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPP 81 Query: 992 P 994 P Sbjct: 82 P 82 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX-PPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP + PPP P P PP P P P Sbjct: 48 PPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPP 89 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP + PP P PP P P P P P P P P Sbjct: 121 ASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPP 174 Score = 32.3 bits (70), Expect = 0.68 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 6/55 (10%) Frame = +3 Query: 1095 PPXXXSXPPXXPLX--PPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP P+ PPP P PP PP P P P P P Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPP 118 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-----PPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP + PP P PPP PPP P P PP P P Sbjct: 35 PPPV--TPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPP 82 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PL P P P P PP P PP P P P P Sbjct: 12 PPSSNSSTTAPPPLQTQPTTPSAPPPVTPP-PSPPQSP-PPVVSSSPPPP 59 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 PP P P PPP P P P P PP P P P P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSP-PKPSPSTP 163 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP---PXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P PP P P P P P P P P Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNP 186 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP PPP P PP P PP PPP P P Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPPQSPPP--VVSSSPPPPVVSSPPPSSSPPPSPPVITSP 80 Query: 992 P 994 P Sbjct: 81 P 81 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXPP 994 P P P PP+ PPPP P PP P P P PP Sbjct: 97 PPPSTPATTPPAPPQTVSPPPPPDASP-------SPPAPTTTNPPPKPSPSPPGETPSPP 149 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP P P P P PP P P Sbjct: 141 PPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDP 189 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX---PPPXPX----PPXPPXPXPP 1196 PP S PP P PPP PPP P PP PP P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PPP PPP P P P PP P P P P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQP--PPPPSVSKAPPPPPPPPPP 343 Score = 36.3 bits (80), Expect = 0.042 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 R PPP+ PPPP P PP PPPPP P Sbjct: 300 RADPPPQKS-IPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 8/40 (20%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP----PXPPPX----PXPPXPPXP 1187 PPP PP P PP P PPP P PP PP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP----PPXPPPXPXPPXPPXPXPP 1196 PP PP P P PP PP P PP P PP Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 PPP PP + P PPP P PP Sbjct: 317 PPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-----PPPXPXPPXP 1178 PPP PP PPP PPP P PP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P +P PPP PPPP P Sbjct: 314 PPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P PL PPP PP P PP P P Sbjct: 25 PSPLPLPPPPPPPLKPPSSGSATTKPPINPSKP 57 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 PP P P P P P PPPP P+ Sbjct: 316 PPPPLLQQPPPPPSVSKAPPPPPPPPPPK 344 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P PP PPPP + PPPPP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P P P PP PPPP PPPPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 310 PPPPPPPPPPLLQQPPP 326 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 307 PPXPXXXXPPXXTTXSXAPXPPP 375 PP P PP + S AP PPP Sbjct: 316 PPPPLLQQPPPPPSVSKAPPPPP 338 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GG G G GGG G GG GGG Sbjct: 56 GGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G GG GGG GG GGG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 39.1 bits (87), Expect = 0.006 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G G GGG GG G GG GGG Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G G G GG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G G GGG GG GGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 31.9 bits (69), Expect = 0.90 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G GGGG G G G GGGG GGG G G G G Sbjct: 56 GGGHGHGGHNGGGGHG--LDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Query: 813 G 811 G Sbjct: 114 G 114 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 GG G GGGGG G G GGGG G GGG G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGG-GHHGGGGHG 116 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 91 GGGGHYGGGGGGYGGGGGHHGGG 113 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPP-XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP + PPP PPP P P P PP P P P P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P P P P P P P P P P Sbjct: 113 PPPVS---PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAP 159 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + PP P PPP P P P P P P P P P P Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPP--PVQAPSP 161 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP P P PPP P P P PP P P P P Sbjct: 112 SPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 37.9 bits (84), Expect = 0.014 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A PPP S PP P PPP PPP P P PP P P P P Sbjct: 121 APTSPPPTPASPPPA-PASPPPAPASPPPAPVSP-PPVQAPSPISLPPAPAPAP 172 Score = 36.3 bits (80), Expect = 0.042 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PPP PP P P PP P P P Sbjct: 82 PPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPP 127 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/60 (33%), Positives = 22/60 (36%), Gaps = 11/60 (18%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXP---------PXPPXPXPPXXP--XXPXXXPXPXXP 1241 PP + PP P+ PPP P P P P P PP P P P P P Sbjct: 59 PPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSP 118 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 PPP + PPAP P P PPP Sbjct: 113 PPPVSPPPAPTSPPPTPASPPP 134 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP---PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P P P PP P PP P P P P P Sbjct: 73 PPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP 125 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLXPPPXPPPXPXPPXPPXP--XPPXXPXXPXXXPXPXXP 1241 PPP + P P P PPP P PP P P P P P P Sbjct: 52 PPPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPP 105 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/60 (26%), Positives = 16/60 (26%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P P P P P PP PP P P Sbjct: 147 PPAPVSPPPVQAPSPISLPPAPAPAPTKHKRKHKHKRHHHAPAPAPIPPSPPSPPVLTDP 206 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P P P PPP P PP P P P P Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPP--APTSPPPTPASPPPAPASPPPAPASPPPAPVSPP 154 Query: 992 P 994 P Sbjct: 155 P 155 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 P P + PPAP P P PPP Sbjct: 127 PTPASPPPAPASPPPAPASPPP 148 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 P P + PPAP P P PPP Sbjct: 134 PAPASPPPAPASPPPAPVSPPP 155 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/54 (29%), Positives = 16/54 (29%), Gaps = 2/54 (3%) Frame = +2 Query: 812 PPXPXHXXPRP--XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P P PP P P P P PP P P P Sbjct: 119 PPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P PPP PP P PP PP P P P P P Sbjct: 513 PPPPSSEMSPSVRAYPPP-PPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP-----PXPXXXXXPP 994 P P PPP P PPPP PP PPPP P P PP Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPP 558 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP--XPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 PPP P PPP PPP P PP P P P P P P P Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP 540 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 PPP PP P PPP P P PP P PP P P P P Sbjct: 505 PPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 35.5 bits (78), Expect = 0.073 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPP-----PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPX 976 PP P P P PP P PPPP P PP P PP P Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSP--PPPSPPPPYIYSSPPPPSPSPPPPY 560 Query: 977 XXXXPP 994 PP Sbjct: 561 IYSSPP 566 Score = 34.7 bits (76), Expect = 0.13 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXH--NXFXGPPPPPXFF 383 P P ++PP PPPP + PPPPP ++ Sbjct: 634 PPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYY 668 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXPXXP 1241 PPP S PP P P P P P PP P PP P P P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PP PP P P P P P P Sbjct: 719 PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPPP 769 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP P P P PP PP PP P P P P Sbjct: 499 AYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 33.9 bits (74), Expect = 0.22 Identities = 30/145 (20%), Positives = 32/145 (22%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 986 A PPP PP P P P PPP Sbjct: 526 AYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQ 585 Query: 987 XPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPX 1166 P + PPP P + PP PPP Sbjct: 586 TPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPP-----PTYYAVQSPPPPPPVYY 640 Query: 1167 PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P PP P P P Sbjct: 641 PPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFF 383 P + SP P ++ PPPP + PPPPP + Sbjct: 598 PPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVY 639 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 10/60 (16%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----------XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PPP PPP P P P P PP P P P Sbjct: 472 PPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPP 531 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P PPP PPPP P P PPP Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPP 580 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP P PP P P P P P Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPP 736 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 A PPP PP PPP P PP P PP Sbjct: 730 AKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASPNQSPP 768 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P + PPP P P P PP P P P Sbjct: 425 PPPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPP 474 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPX-PPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PPP P P PP P P P P P P Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P PPP P P P P P P P P Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 285 PLXPXFFPPXXXXXPPPPXH--NXFXGPPPPPXFF 383 P P ++PP PP P + PPPPP ++ Sbjct: 677 PPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYY 711 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P+ PP PPP PP P P P P P Sbjct: 713 PVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASP 763 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P PP PP P P P P Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPP 685 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/46 (30%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +3 Query: 258 PLFXPXXXS--PLXPXFFPPXXXXXPPPPXH--NXFXGPPPPPXFF 383 P++ P + P P ++ P PPPP + PPPPP + Sbjct: 637 PVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVY 682 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +3 Query: 258 PLFXPXXXS--PLXPXFFPPXXXXXPPPPXH--NXFXGPPPP-PXFF 383 P++ P P P ++PP PPPP + PPPP P ++ Sbjct: 680 PVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYY 726 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P PPP P P P PP P P P Sbjct: 471 PPPPSSKMSPSFRATPPP-PSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/62 (27%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = +2 Query: 815 PXPXHXXPRPXPP--PRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXX 988 P P P P PP PPP + PP PPP P Sbjct: 587 PSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTAS 646 Query: 989 PP 994 PP Sbjct: 647 PP 648 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX---PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PP PP PP P P P P Sbjct: 676 PPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPP 728 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/44 (31%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 287 PLXXLFPPXXXXXPXPPXXQXXXX--PPXPPXXFXPXTGGXAPP 412 P +PP P PP PP PP + P T PP Sbjct: 635 PPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPP 678 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXX----PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S PP P+ P PPP P P PP P P Sbjct: 641 PPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSP 690 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PPP PPP PP P P PP P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P PP PPP PP PP P P Sbjct: 59 PPPP--SPPPPSP-PPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 35.1 bits (77), Expect = 0.096 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P + PP P P P PP P PP P P P Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP P P PPP P P P PP P Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPXTXPPAPXPX--PVXPXXPPPP 884 PPP PP+P P P P PPPP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP 84 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFFXL 389 P SP P PP PPP + + PPPP F + Sbjct: 64 PPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYI 103 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P PP P P PP P P P P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PPA P P P PPPP Sbjct: 65 PPPSPPPPACPPPPALP--PPPP 85 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP 958 P P PPP P PPPP P PP PP Sbjct: 60 PPPSPPP---PSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXP--PPP 884 PPP + PP P P P P PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPP 83 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1177 PPPPXPPXXPXXPXXXPXPPXL 1242 PPPP PP P P PP L Sbjct: 59 PPPPSPPPPSPPPPACPPPPAL 80 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXP--PXPXPPXXPXXPXXXPXP 1232 P+ P P PP P P P PP P P P P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 284 SPLXXLFPPXXXXXPXPPXXQXXXXPPXPPXXFXPXTG 397 SP PP P PP PP PP F TG Sbjct: 68 SPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITG 105 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P V PPPP Sbjct: 75 PPPPALPP-PPPKKVSSYCPPPP 96 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P P PP PP PP PP PP P P P P Sbjct: 136 PPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PP P PP P P PP P P P P P P Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEP-PRPP 164 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = +3 Query: 1110 SXPPXXPLXPPPXP------PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S PP PL PP P PP P PP P P PP P P P Sbjct: 113 SDPP--PLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEP 160 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +3 Query: 1128 PLXPPP-XPPPXPXP--PXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP PP P P P PP P PP P P P P P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPP-MPDTP-NPPTPKTP 150 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP 964 P P PP P PP P P PP PPP Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPP 174 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P PP P+ PP PP P PP P P P Sbjct: 142 PNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPXPP--PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P+ P P PP P PP P P P P P Sbjct: 116 PPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFP 168 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG GGG G GG GG Sbjct: 153 GGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGG 202 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GGG G GG GG Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGG 194 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GGG GG G GG GG Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGG 198 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G GGG GG G GG G Sbjct: 157 GGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G G GG GG G GG GG Sbjct: 140 GGDKPGGASGGGPGGASGGASGGASGGASGGASGG 174 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG GG G GG GG Sbjct: 141 GDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGG 190 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G GG GG G GG GG Sbjct: 136 GASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGG 186 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G G GG GG G GG Sbjct: 169 GGASGGASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGG 218 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG GGG G GG GG Sbjct: 121 GEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGG 166 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG GG G GG GG G G G G Sbjct: 135 GGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPG 181 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 P P P PPP P PPP P P PPPPP P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPP 157 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPP--XXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP P PP PP P P P Sbjct: 118 PPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTP 160 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP------PXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP + PP PP PPP P PP P P P P Sbjct: 111 PPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P PP P PP P P P P Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPP-PPPAPVSASPPLTP 160 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P S P P P P P PP P P P P P Sbjct: 88 PTDSSSSTSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPP 127 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P PPP PP P P P P P Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPP 148 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P + PPP PP P PP P P PP P P Sbjct: 65 PVIISVGPPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP P PP PP P PP P PP P Sbjct: 72 PPPKP-PEPPKPPEPEKPKPPPAPEPPKHVCKP 103 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP 1172 PP PP P P PPP P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1155 PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP PP P P P P P P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPP---PAPEPP 97 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G GG G GG G G GGG GGG G G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G G GGG GGG G GG + GGG Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYGGGGD--GGGG 157 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGG 1136 G G G G GG G GG GG GGG GGG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G G GG GGG Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGG 151 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG G GGG G GG GG Sbjct: 516 GGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSSRYSGG 565 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGG-XGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G GGG G GG GGG Sbjct: 501 GVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGG 548 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP--PXPXPPXPPXPXPPXXPXXPXXXP 1226 P P P L PPP PP P P PP PP P P P P Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXP--XPPPPXXXPR--XXXXXXXXXXXXXXXPPXPPPPPXPXX 979 PP P P P PPP P PPPP P PP PPPP P Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPP 83 Query: 980 XXXPP 994 P Sbjct: 84 LVPDP 88 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + PP P PPP PPP P P PP P P P Sbjct: 15 PSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 A PP PP PP PPP PP PP P P P P Sbjct: 2 ASYRPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 36.3 bits (80), Expect = 0.042 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PL PP PP PP PP P P P P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPP 47 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXX--PPPPXHNXFXGPPPPP 374 PL P + L P PP PPPP H + PPPPP Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPP 50 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-----PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP PPP P PP P P P P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPP 76 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXX--PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P P P PP + P PPPP P PP PPPPP Sbjct: 6 PPYP----PLPQPPSQNSLAPPPPPPSLPP--PVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP + P P P PP PP PP P P Sbjct: 49 PPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Frame = +3 Query: 1092 PPPXXXSXP-----PXXPLXPPPXPPPXPXPPXPPXPXPPXXP--XXPXXXPXPXXP 1241 PPP S P P P PP PPP PP PP PP P P P P P Sbjct: 848 PPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPP-PPQALPPPLPHSHPPLVPPPPFSP 903 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXP---LXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P + PPP PPP P P P PP P P Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLP 910 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP + PP P PP PP P P PP Sbjct: 878 PPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLPP 911 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP P P PP P PP P P P Sbjct: 872 PPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLPP 911 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP P P P P PPPP Sbjct: 878 PPPPQALPPPLPHSHPPLVPPPP 900 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G G G G GGG G GG GGG Sbjct: 48 GLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGG 94 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G GG G GG G G GGG GGG G GG Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLG-GGGFGGGAGGGLGG 106 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXG-GXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G G GGG GGG G GG G G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 34.3 bits (75), Expect = 0.17 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXG--GGGXGXXRGGGXGRGXXCXGX 817 G G GGG G GG G G GGG G GGG G G G Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG-GGL 104 Query: 816 GGXP 805 GG P Sbjct: 105 GGLP 108 Score = 32.7 bits (71), Expect = 0.51 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G G G G G G GG GGG Sbjct: 41 GGGGSGDGLGL-GLGGGAGLGGLG-IGAGIGAGAGL-GLGGGGGGLGGGG 87 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXG 821 GGGG G G G GAGG + G Sbjct: 86 GGGGLLGGGGFGGGAGGGLGG 106 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP P P PP P P P P P P P Sbjct: 249 PPPPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 38.7 bits (86), Expect = 0.008 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P PPP PPP PP PP P P Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXP 1226 PP P P PPP PP PP P PP P P Sbjct: 206 PPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPP 251 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP P PP PPP P P P PP Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPP-PQLPQSSQPPPP 252 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPPP P+ PP PPPP P P Sbjct: 200 PPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVR---------PPLPPPPQLPQSSQPP 250 Query: 992 P 994 P Sbjct: 251 P 251 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G GGG GGG G G GG Sbjct: 64 GNLGYGGFGGAGGGLGG-GLGGGAGSGLGGGLGGG-SGIGAGTSGGSTGG 111 Score = 35.5 bits (78), Expect = 0.073 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G GGG GGG GG GGG Sbjct: 57 GGVSGPGGNLGYGGFGGAGG-GLGGGLGGGAGSGLGG---GLGGG 97 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG G G GGG G G G GG G Sbjct: 58 GVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAG 103 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G GG GGG Sbjct: 54 GVGGGVSGPG-GNLGYGGFGGAGGGLGGGLGGGAGSGLGGG 93 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S P P+ PP P P P P PP P P P P Sbjct: 546 PPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSP 591 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP-----XPPPPPXPX 976 PP P + P P P PPPP PP PPPPP P Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPA 775 Query: 977 XXXXPP 994 PP Sbjct: 776 HYSPPP 781 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP--PXPPXPXPPXXPXXPXXXP 1226 PPP S PP P PPP P P PP PP P P Sbjct: 716 PPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPP 762 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +2 Query: 806 GXPPXPXHXXPR-PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 G PP P P P P P PP P + PP P PP P Sbjct: 544 GSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVI 603 Query: 983 XXPP 994 PP Sbjct: 604 PSPP 607 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S PP PPP P PP PP P PP P P P Sbjct: 745 PPPQ--SHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPP 793 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP-PPXPPPXPXP----PXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P P P P P P PP P P P P P P Sbjct: 529 PPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIP 582 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P+ P PP P P P P P PP P P P P P Sbjct: 567 PPTPISPGQNSPPIIPSPPFTGPSP-PSSPSPPLPPVIPSPPIVGPTPSSP 616 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 1116 PPXXPLXP--PPXPPPXPXPPXPP-XPXPPXXPXXPXXXPXPXXP 1241 PP P P P PP P PP PP P PP P P P P Sbjct: 578 PPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTP-SSPPPSTP 621 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP 958 PP P H P P PP PPPP P PP PP Sbjct: 771 PPSPAHYSPPPSPPVYYYNSPPPP---PAVHYSPPPPPVIHHSQPPPPP 816 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXP 1226 P P PP PP P P PP P P PP P P Sbjct: 424 PSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPP 469 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXPXXP 1241 P PP P P P P P P P PP P P P P Sbjct: 475 PTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSP 523 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 P P PP PP P PP P P P P P P P P Sbjct: 521 PSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXP 1193 P P PP P+ P PP P P P P P P Sbjct: 589 PSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PP P+ PPP P P P P P P Sbjct: 793 PPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPPIPGISYASPPPPP 837 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPP--XPPPXPXPPXP--PXPXPPXXPXXPXXXPXP 1232 P PP P P P PP P P P P P P P P P Sbjct: 488 PTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSP 536 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP P PP PP P P P P Sbjct: 737 PPPTPIHSPP--PQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 6/67 (8%) Frame = +2 Query: 812 PPXPXHXXP-RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPX-----PPPPPXP 973 PP P H P + PP PPPP PP PPPPP Sbjct: 738 PPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAV 797 Query: 974 XXXXXPP 994 PP Sbjct: 798 HYSPPPP 804 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P S PP P+ PPP P P P P P P P Sbjct: 772 PSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGP 821 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = +3 Query: 1092 PPPXXXSXPPXXP----LXPPPXPP----PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP PP P PP PP P P P Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP 814 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPX--PXPPXXPXXPXXXPXP 1232 PP PP P P PP P PP P PP P P P Sbjct: 406 PPVVVPSPPTTP-SPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP 452 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXP 1205 PP PP P PP PP P PP P PP P Sbjct: 584 PPFTGPSPPSSP--SPPLPPVIPSPPIVGPTPSSPPPSTP 621 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 6/60 (10%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP------PPPXP 973 PP H P P P P PP P P PP PP PPP P Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSP---PVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPX-PXPPX--PPXPXPPXXPXXPXXXPXP 1232 P P S PP P+ P PP P PP P P P P P P Sbjct: 559 PSPPTPSTPPT-PISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPP 607 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXF 380 PP PPPP PPPPP + Sbjct: 794 PPAVHYSPPPPPVIHHSQPPPPPIY 818 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXPXP 1232 P P P P P P P P PP P P P P P P Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSP 458 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P PP P P P P PP P P P P Sbjct: 552 PTPSSPIPSPPTPSTPPTPISPGQNSP-PIIPSPPFTGPSPPSSPSPPLP 600 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 294 PXFFPPXXXXXPPPPXHNXFXGPPPP 371 P PP PPPP + PPPP Sbjct: 747 PQSHPPCIEYSPPPPPTVHYNPPPPP 772 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P P PP P PP PP P P P Sbjct: 759 PPPPTVHYNPPPPPSPAHYSPP-PSPPVYYYNSPPPPPAVHYSPPPP 804 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 38.7 bits (86), Expect = 0.008 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G G G GG GG GGG GGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G G G G GG G G GGG GG G GG + Sbjct: 14 GVGGGGAGCSAGNS-GGSSGCGAGGGGGGSGGGGGGGGD 51 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP L PPP P PP PP P PP P Sbjct: 8 PPPPPL--PPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 872 PPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PPPP PR PP PPPPP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPP 41 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPR 898 P+P PPP P PPPP PR Sbjct: 27 PQPPPPPPPPPPPPPPRLGPR 47 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 8/40 (20%) Frame = +3 Query: 1131 LXPPPXPPP--------XPXPPXPPXPXPPXXPXXPXXXP 1226 + PPP PP P P PP P PP P P P Sbjct: 7 IPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP P PPP PPP P PP Sbjct: 25 PPPQ----PPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P P PPP P PPPP Sbjct: 25 PPPQPPPPPPPPPPPP 40 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 834 PPAPXPXPVXPXXPPPP 884 PP P P P P PPPP Sbjct: 26 PPQPPPPPPPPPPPPPP 42 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 7/35 (20%) Frame = +3 Query: 1149 PPPXPXPPX-------PPXPXPPXXPXXPXXXPXP 1232 PPP P PP P P PP P P P P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 38.7 bits (86), Expect = 0.008 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG G G GGG GGG G GG GGG Sbjct: 68 GGGGHGLD-GYGGGHGGHYGGGGGHYGGGGGHGGG--GHYGGGGHHGGGG 114 Score = 37.1 bits (82), Expect = 0.024 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGG----GXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G G GG G GGG G GG GGG Sbjct: 42 GYHGGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGG 95 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGX-GXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G G GG GG G GGG GG G GG GG Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 Score = 33.1 bits (72), Expect = 0.39 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 993 GGXXXXXGXGGGG-GXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGX 817 GG GGGG G GG G G GGGG GGG G G G Sbjct: 48 GGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGG 107 Query: 816 G 814 G Sbjct: 108 G 108 Score = 29.1 bits (62), Expect = 6.3 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GGGG GG G G GGG G GGG G G GG Sbjct: 49 GHGGGGHYGGGGHGHGGHNGGGG--HGLDGYGGGHGGHYGGGGGHYGGGGGHGG 100 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 38.3 bits (85), Expect = 0.010 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXX---PLXPPPXPPPX---PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP P P PPP PPP P PP PP P P P P P Sbjct: 367 ASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP--PXXPXXP 1214 PP PP P P PPP P P PP P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP PPAP P P PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPP 406 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP--PXPXPPXPPXPXPPXXPXXP 1214 PPP P PPP P P P PP P P P P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPR P PPP P PPPPP P P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGG-----------------PKPPPPPGPKGPRPP 414 Query: 992 P 994 P Sbjct: 415 P 415 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPP-RXXPXPPPP 883 P P P+P PPP P PPPP Sbjct: 393 PPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P PRP PP P P P P Sbjct: 403 PPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 5/51 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP-----PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PPP P PP PP P PP P P P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P P PP P PP P PP P P P Sbjct: 144 SSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 38.3 bits (85), Expect = 0.010 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXX---PLXPPPXPPPX---PXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PPP P P PPP PPP P PP PP P P P P P Sbjct: 367 ASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRP 426 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP--PXXPXXP 1214 PP PP P P PPP P P PP P P P P Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPP 427 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 819 PPXTXPPAPXPXPVXPXXPPPP 884 PP PPAP P P PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPP 406 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP--PXPXPPXPPXPXPPXXPXXP 1214 PPP P PPP P P P PP P P P P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP P P PPR P PPP P PPPPP P P Sbjct: 372 PPVPAPQMPSSAGPPRPPPPAPPPGSGG-----------------PKPPPPPGPKGPRPP 414 Query: 992 P 994 P Sbjct: 415 P 415 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 815 PXPXHXXPRPXPPP-RXXPXPPPP 883 P P P+P PPP P PPPP Sbjct: 393 PPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P PRP PP P P P P Sbjct: 403 PPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 5/51 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP-----PXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PPP P PP PP P PP P P P Sbjct: 356 PPKFLKVSSKKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 S P P PP P PP P PP P P P Sbjct: 144 SSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P+ PP PP P PP PP P P P P Sbjct: 126 PPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKP 175 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP P PP PP P P P P Sbjct: 159 PPTSPVKPPTTT--PPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + PP PP PP P P P P P P Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPP-XPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP PP PP PP PP P P Sbjct: 76 PPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPP 122 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P + P P PP PP PP P P P P P Sbjct: 166 PPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPP 208 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXP--PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P+ PP PP P P P P P P P Sbjct: 54 PPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPP 105 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP P P P P PP P P P P Sbjct: 47 PPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPP 96 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPP-XPPXPXPPXXP 1205 P P + PP L PP PP P P PP PP P Sbjct: 39 PSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKP 80 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P+ PP PP P P P P P P P Sbjct: 90 PPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXP-PXXPXXPXXXPXP 1232 PPP PP PPP PPP P P PP P P P P P Sbjct: 216 PPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPP 266 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP P P P PP P P P P P P Sbjct: 208 PPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVP 260 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P P P PP P P P P Sbjct: 264 PPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKP 319 Score = 35.1 bits (77), Expect = 0.096 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXP-XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PPP P P P PP P P P Sbjct: 201 PPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKPP 251 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P PP PP PP P PP P P P Sbjct: 231 PPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPP 280 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP----PXPXX 979 PP P H P+ PP+ PP P P P PPP P P Sbjct: 287 PPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPPKI 346 Query: 980 XXXPP 994 PP Sbjct: 347 EHPPP 351 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PP PP P PP P P P Sbjct: 342 PPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKP 393 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXX-PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P P P P PP P P P P P P P Sbjct: 377 PPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKP-CPPLPQLPPLPKFP 426 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP-XPXPPXXPXXPXXXPXPXXP 1241 PPP PP + P PP PP P P PP P P P Sbjct: 395 PPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFPPLPPKYIHHPKFGKWPPLP 445 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 PPP PP PPP P P P P P P P P P Sbjct: 193 PPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP P+ PP P P P P P P P P Sbjct: 298 PCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPPKIVIPPP 344 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 812 PPXPXHXXPRPX--PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P H P PPP+ PP P P P PPP P Sbjct: 328 PPVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVP 381 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPX---PXPPXPPXPXPPXX-PXXPXXXPXP 1232 PPP PP PP PP P PP P PP P P P P Sbjct: 349 PPPVPVYKPPPKIEHPPIYIPPIVKKPCPPPVPIYKPPVVIPKKPCPPPVP 399 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXP----PXXPXXPXXXPXPXXP 1241 PPP PP PPP P P P P P P P P P P P Sbjct: 256 PPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVP 310 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPP--XXPXXPXXXPXPXXP 1241 PP PP P+ PP P P PP P PP P P P P P Sbjct: 369 PPIVKKPCPPPVPIYKPPVVIPKKPCPPPVPVYKPPVVVIPKKP-CPPLPQLP 420 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P+ PP P PP P PP P P P Sbjct: 248 PKPPKIEHPPPVPVYKPP--PKIEKPPPVPVYKPPPKIEHPPPVPVHKLP 295 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXP---LXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 PP PP P L P PP PP P PP P P P P Sbjct: 279 PPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVP 331 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP P P P P P P P P P Sbjct: 181 PCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPP 218 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P P PP+ PP P P P PPP P Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPPVP 290 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP--XXPXXPXXXPXP 1232 PP P PL PP PP P PP PP P P P P Sbjct: 157 PPFKGFDHPF-PLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPP 203 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G GG G G G G G G GGG R G + GG Sbjct: 16 GGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGG 55 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G G G G GGG G GG G G Sbjct: 13 GDGGGSGGGGGSGDGSGSGDGGG-SGDGGGSRDSDGSG 49 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G GG G GGG G G GG GG Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGG 41 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P PPP PP P PP P P P P P P Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P + P P PP PPP P PP PP P Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAP 1157 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 G PP P H P P PPP+ PPPP P+ Sbjct: 1124 GSPPLP-HESP-PSPPPQPPSSPPPPSSPPQ 1152 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP S PP P P P P P P P P P Sbjct: 1136 PPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAPAQSIALP 1180 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPP 880 PP P P P PP+ P PPP Sbjct: 1137 PPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP----XPPXXPXXP 1214 P S PP P PPP P P PP PP P P Sbjct: 1129 PHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAPLAP 1173 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S P P P PP P P P P PP P P P Sbjct: 1120 SFPAGSPPLPHESPPSPP-PQPPSSPPPPSSPPQLAPAPPP 1159 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 37.9 bits (84), Expect = 0.014 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P PP P PPP P P P P P P P P Sbjct: 120 PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP P P P P P P P P P P P P Sbjct: 99 PPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSP 143 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P P P P P P P P P P P P P Sbjct: 91 PPPAPKKSPP--PPTPKKSPSPPSLTPFVPHPTPKKSPSPP---PTPSLP 135 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P PP P P P P PP P P P Sbjct: 92 PPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P S P P P P P P PP P PP P P Sbjct: 104 PKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLP 149 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P P P P P P P P P P P Sbjct: 128 PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPP 172 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPP---PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S P P P P PPP P P P P P P P P Sbjct: 108 PSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPP 158 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P PPP P PP P P P P P P Sbjct: 82 PSTPSTPSP-PPPAP-KKSPPPPTPKKSPSPPSLTPFVPHP 120 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP--PPXPPPXPXPPXPPXP 1187 PPP PP P P PPP P PP P Sbjct: 128 PPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + P P P P PP P P P P P P Sbjct: 71 PAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPP 111 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/63 (26%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP--XPXXXX 985 P P + PPP P PP P P PPP P P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPS 147 Query: 986 XPP 994 PP Sbjct: 148 LPP 150 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPP 881 P P PPAP P P PPP Sbjct: 130 PTPSLPPPAPKKSPSTPSLPPP 151 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 37.9 bits (84), Expect = 0.014 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PPP PP PP PP P P Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 36.7 bits (81), Expect = 0.032 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PP P P PPP P PP P PP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPP 883 G PP P P PPP P PPPP Sbjct: 678 GPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 33.1 bits (72), Expect = 0.39 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P P PPP P PPP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPP 699 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 294 PXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P PP PPPP GPPPPP Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPP 694 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP PP P PP PPP P Sbjct: 682 PPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP L P P PP PP P P P P P P Sbjct: 654 PPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P P PPP P P PP P PP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P P P PPP P PP P PP P P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PP P P PP PP P P P P P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP PPPPP Sbjct: 683 PPPPGGGPPPPPGGGPPPPPPPP 705 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.9 bits (84), Expect = 0.014 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGG--XGGGXRGXXGGXEXXXGGG 1091 G G G G G GG GG GG GGG GGG R GG GGG Sbjct: 88 GSGGGGGHRGGGG--GGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGG 137 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 G G G G GG GG GG G GGG GGG G GG Sbjct: 130 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 37.1 bits (82), Expect = 0.024 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G G GG GG G G GGG GGG G GG GGG Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 145 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G G G GG GGG R GG GGG Sbjct: 121 GGGRREGGGGYSGGGGGYSSRGGG-GGSYGGGRREGGGGYGGGEGGG 166 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G GG G GG GGG GGG G GG GGG Sbjct: 130 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 5/55 (9%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX--GGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG GGG GGG GG GGG Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGG 151 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G G G GGG GGG G GG GGG Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG--SGGGGG 175 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G GG G GG G G GG GGG Sbjct: 143 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG GGGGG G G GGGG GGG G G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGG 156 Query: 813 G 811 G Sbjct: 157 G 157 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 GGGG GG G GGGG G GGG G Sbjct: 127 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 168 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G GG GG GG G G GGG Sbjct: 144 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 37.9 bits (84), Expect = 0.014 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 + PP PPP P PP P PP P P P P Sbjct: 91 IPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PPP PP P PP P PP P P P Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 35.9 bits (79), Expect = 0.055 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P + PP P P P PP PP P P PP P Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCP 124 Score = 31.9 bits (69), Expect = 0.90 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP--PPXPXPPXPP----XPXPP 1196 PPP S PP P PPP PP P PP PP P PP Sbjct: 92 PPP---SPPPPSP--PPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 P P P P PP + P PP P P+ Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPPK 119 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G G GGG GG G GG + GGG Sbjct: 30 GGGEGKKKNGGGEGGGGEGTSGEGGGGGG--DGTKGGGDGISGGG 72 Score = 35.1 bits (77), Expect = 0.096 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXG--GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G G G GGG RG G GGG Sbjct: 55 GGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGG 106 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G G GGG G G GG + GGG Sbjct: 43 GGGGEGTS-GEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGG 91 Score = 32.7 bits (71), Expect = 0.51 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G GGG GGG G G E GGG Sbjct: 14 GGGGDGTKGGGNTITGG---GGEGKKKNGGGEGGGGEGTSG--EGGGGGG 58 Score = 31.5 bits (68), Expect = 1.2 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG GGG G GG G GGG G GGG G G C G G Sbjct: 30 GGGEGKKKNGGGEGGGGEGTSGEGGGGG-----GDGTKGGGDGIS-GGGHGDGLGCSGGG 83 Query: 813 G 811 G Sbjct: 84 G 84 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GGG G G G GGGG G GG G G G G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGG 65 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G GGG G G G GGG Sbjct: 39 GGGEGGGGEGT-SGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGG 84 Score = 28.7 bits (61), Expect = 8.4 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGG 305 GG GGG + + GGGG GGGG GG Sbjct: 22 GGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGG 64 Score = 28.7 bits (61), Expect = 8.4 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 8/69 (11%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGG--------GXGR 838 GG G GGGGG G GGGG G GG G GR Sbjct: 44 GGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGR 103 Query: 837 GXXCXGXGG 811 G G G Sbjct: 104 GGGRGGWNG 112 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 37.9 bits (84), Expect = 0.014 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G GG G G GG G GGG GGG G GG Sbjct: 165 GIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGG-HGVVGG 206 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXG-GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG GG G GG GG G GGG Sbjct: 146 GGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGG 196 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G GG G GGG G GG E GGG Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 37.1 bits (82), Expect = 0.024 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GG GGG + GG GGG Sbjct: 30 GGNGGGSGKGQW-LHGGGGEGG-GGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXG-XXRGGGXGRGXXCXGXGG 811 GGGG GG +G GG G G GG G G G GG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 37.5 bits (83), Expect = 0.018 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P PP PPP PPP PP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 1137 PPPX--PPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PPP PP PP P P P P P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P+ PP PP P PP P PP P P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 S P PPP P P PP PP PP P Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 P P P P PPP P PPPP PR Sbjct: 373 PPPLQTPPPPPPPPPLAP-PPPPQKRPR 399 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + P PPP PP P PP P P P P Sbjct: 348 PPPPNRAAFQAITQEKSPVPPPRRSPP--PLQTPPPPPPPPPLAPPP 392 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P P PP P PP P P P P P Sbjct: 34 PLFPESSTPPPPDFQSTPSPPLPDTPDQPFFPENPSTP 71 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 SP+ P P PPPP PPPPP Sbjct: 364 SPVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 G G G G GG GG GG G GGG GGG G GG Sbjct: 113 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 36.7 bits (81), Expect = 0.032 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G GG G G G G GGG GGG G GG GGG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGG 128 Score = 36.3 bits (80), Expect = 0.042 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXX-GGXGXGGXGGX-----GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G GG GGG R GG GGG Sbjct: 94 GHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGG 149 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G GG GG GG GGG GGG GG GGG Sbjct: 91 GGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGG 134 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 G G GG G GG GGG GGG G GG GGG Sbjct: 113 GYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G G G GGG GGG G GG GGG Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG--SGGGGG 158 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G GG G GG G G GG GGG Sbjct: 126 GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 GGGG GG G GGGG G GGG G Sbjct: 110 GGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 151 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G GG GG GG G G GGG Sbjct: 127 GGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -1 Query: 993 GGXXXXXGXGGGGGX--GGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXG 820 GG GGGGG GG G GGG G G G G G Sbjct: 93 GGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGG 152 Query: 819 XGG 811 GG Sbjct: 153 SGG 155 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 37.5 bits (83), Expect = 0.018 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +3 Query: 1119 PXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PPP PPP P P PP P PP P P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP-PPXPXPPXPPXPXPPXXP 1205 PPP P P P P PP P PP P PP P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPP 184 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXP-PPXPPPXPXPPXPPXPXPP 1196 PPP S PP P P PP P P P P P PP Sbjct: 152 PPPE--SLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPP-XPXPPXXPXXPXXXPXPXXP 1241 PP PPP PP P P PP P P P Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 P P P P PP P PPPP Sbjct: 162 PESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXX-PXPPPPXXXP 895 G PP P P PPP P PP P P Sbjct: 144 GQPPPPESPPPESLPPPSPESPSPPSPEPPP 174 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = -3 Query: 1204 GXXGGXGXG-GXGGXGXGGGXGGGXRG---XXGGXEXXXGGG 1091 G GG G G G GG G GGG GGG +G GG E G G Sbjct: 5 GYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGGEQGRGRG 46 Score = 30.7 bits (66), Expect = 2.1 Identities = 26/87 (29%), Positives = 31/87 (35%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRGX 254 GG G G R GGGGG GGG G + RG G RG Sbjct: 4 GGYRGGRGDGRGRGGRGYGGGGGGGEQGRDRGYGGG---EQGRGRGSERGGGNRGQGRGE 60 Query: 253 PTXF*NFFKRGISPPN*GWGFXXXKNP 173 F + +RG P + G G + P Sbjct: 61 QQDFRSQSQRGPPPGHGGRGTTQFQQP 87 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 37.1 bits (82), Expect = 0.024 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG GGG GGG R GG GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGG 102 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GG G G GG GG GGG Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXG----GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G G G GGG GG GGG Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGGG 118 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 880 GGGXXGXTGXGXGAGGXVXGGG 815 GGG G G G G GG GGG Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGG 94 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G G GG GG G GG GGG R GG GG Sbjct: 41 GGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGGG 84 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G G G GGG G GG GGG Sbjct: 42 GGFGDNGGGRYQGGGGHGGHGGGGYQGGGG 71 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 37.1 bits (82), Expect = 0.024 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG GG G GGG GGG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G G GG G GGG GGG GG GGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGG-----GGCGGGGGGG 89 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G GG G G GG G GGG GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGG-GCGGGGGGG 89 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G G GGG GGG G GG GGG Sbjct: 59 GGGDGGGDGGGDGGGG-GCGGGGGCGGGGG 87 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 G GG G G GGG G G C G GG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 879 GGGXGXXRGGGXGRGXXCXGXGG 811 GGG G GGG G G C G GG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGG 81 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 880 GGGXXGXTGXGXGAGGXVXGGG 815 GGG G G G G GG GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGG 80 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG GGGG G GGGG G Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGG 88 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 37.1 bits (82), Expect = 0.024 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G G G G GG GG GGG GGG +G GG GG Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGG 114 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GG G GG GGG G GG G G Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAG 100 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXX-GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G G G G +G GG GGG Sbjct: 137 GGAGKGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAG-KGVDGGAIGGIGGG 186 Score = 32.7 bits (71), Expect = 0.51 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXX-GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G G GG G GG GGG Sbjct: 145 GGVGKGFEGGIGKGIEGGVGKGFDGGAGKGVD-GGAIGGIGGGAGKEIGGG 194 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G GGG GGG G GG G G Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGG--GGFGGGAGKG 102 Score = 31.9 bits (69), Expect = 0.90 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GG G G GG +G GG GG Sbjct: 91 GGGGFGGGAGK-GVDGGFGKGVDGGAGK-GVDGGAGKGFDGGVGKGVDGG 138 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGG GG G GGG G GGG G+G Sbjct: 57 GGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKG 102 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG G GG GG GGG GGG G GG Sbjct: 69 GSGGGGGGRGYGG-GGRREGGGYGGGDGGSYGG 100 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -3 Query: 1180 GGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 GG GG G GGG GGG G GG GGG Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G G GG GG G G GG GGG G Sbjct: 69 GSGGGGGGRGYGG--GGRREGGGYGGGDGGSYGGGGGG 104 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G GG G G G GGG R GG GG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGG 96 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 36.7 bits (81), Expect = 0.032 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G GG GG GG GG G GG GGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -3 Query: 1192 GXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGGG 1091 G G GG GG G G G GGG G GG GGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 35.5 bits (78), Expect = 0.073 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G GG G G GG G GG GGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG GGG R GG GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGG 115 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGX--GXGGGXGGGXRG 1127 G G G GG GG GG G GGG GG G Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 GGGGG GG G GGGG G GGG G Sbjct: 89 GGGGGRGGSGGGYRSGGG------GGYSGGGGGGYSGGGGGG 124 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 36.7 bits (81), Expect = 0.032 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXP---PPXPXPPXPPXPXPP 1196 A PPP PP L PPP P PP PP P PP Sbjct: 52 ADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPP-PXPPPXPXPPXPPXPXPP 1196 PPP PP PP PPP P P PP PP Sbjct: 64 PPPADLPPPPTPYYSPPADLPPPTPIYP-PPVAFPP 98 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 P PP PPP P P P PP PP P P P Sbjct: 51 PADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFP 97 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPX-PPXPXPPXXPXXPXXXPXPXXP 1241 P S P P PPP P P P PP P P P P P P Sbjct: 44 PSPVYSSPADLP--PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYP 91 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 36.7 bits (81), Expect = 0.032 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP PP PPP PP P P PP Sbjct: 708 PPPV--QVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 36.3 bits (80), Expect = 0.042 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP PP PP P P P P Sbjct: 388 PPPI--QKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPP 439 Score = 36.3 bits (80), Expect = 0.042 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP PP PP P P P P P Sbjct: 488 PPPV--QKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSP-PIKP 538 Score = 36.3 bits (80), Expect = 0.042 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP P PP P P P P Sbjct: 691 PPPV--QVPPTPTYSPPVKPPPVQVPPTPTY-SPPIKPPPVQVPPTPTTP 737 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PPP PP P P P P P P P P Sbjct: 321 PPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PPP PP P P P P P P P P Sbjct: 455 PPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP PP PP P P P P Sbjct: 438 PPPVHK--PPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPP 489 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PPP P P+ PPP PP P PP P P PP P P P Sbjct: 505 PPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 557 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 135 PPPI--QKPPTPSYSPPVKPPPVQMPPTPTY-SPPIKPPPVHKPPTP 178 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 657 PPPV--QKPPTPTYSPPVKPPPVQLPPTPTY-SPPVKPPPVQVPPTP 700 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 674 PPPV--QLPPTPTYSPPVKPPPVQVPPTPTY-SPPVKPPPVQVPPTP 717 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 118 PPPI--QKPPTPTYSPPIYPPPIQKPPTPSY-SPPVKPPPVQMPPTP 161 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP PP PP PP P P P P Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPP 355 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 84 PPPI--QKPPTPTYSPPIYPPPIQKPPTPTY-SPPIYPPPIQKPPTP 127 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 101 PPPI--QKPPTPTYSPPIYPPPIQKPPTPTY-SPPIYPPPIQKPPTP 144 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 640 PPPVHK--PPTPTYSPPIKPPPVQKPPTPTY-SPPVKPPPVQLPPTP 683 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P PP PP PP PP PP P P P Sbjct: 58 PPPPIYS-PPIYP--PPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPP 103 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPP-XPPPXP--XPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P + PPP PP P PP PP PP P P P P Sbjct: 472 PPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKP 527 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 538 PPPVHK--PPTPTYSPPIKPPPIHKPPTPTY-SPPIKPPPVHKPPTP 581 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 555 PPPIHK--PPTPTYSPPIKPPPVHKPPTPTY-SPPIKPPPVHKPPTP 598 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 572 PPPVHK--PPTPTYSPPIKPPPVHKPPTPTY-SPPIKPPPVHKPPTP 615 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 589 PPPVHK--PPTPTYSPPIKPPPVHKPPTPTY-SPPIKPPPVHKPPTP 632 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 606 PPPVHK--PPTPTYSPPIKPPPVHKPPTPTY-SPPIKPPPVHKPPTP 649 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 623 PPPVHK--PPTPTYSPPIKPPPVHKPPTPTY-SPPIKPPPVQKPPTP 666 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 219 PPPVHK--PPTPTYSPPVKPPPVHKPP-TPIYSPPIKPPPVHKPPTP 262 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P+ PP P P PP PP P P P P Sbjct: 293 PPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKP 343 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PP PPP PP P PP P P P Sbjct: 371 PPPVHK--PPTPIYSPPVKPPPIQKPPTPTY-SPPIKPPPLQKPPTP 414 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP PP P P PP P P P Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP PP P P PP P P P Sbjct: 418 PPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 464 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP--XPPPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 PP PP PPP PP P P PP PP P P P Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-XPPPXP--XPP--XPPXPXPPXXPXXPXXXPXP 1232 PPP P+ PPP PP P PP PP PP P P P Sbjct: 69 PPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PP PPP PP P P P P P Sbjct: 152 PPPV--QMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPP 199 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP S P P+ PP P P PP PP P P P Sbjct: 175 PPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P+ PP PP P P PP P P P Sbjct: 182 PPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTP 228 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 242 PPTPIYSPPIKP--PPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 259 PPTPIYSPPVKP--PPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 343 PPTPIYSPPVKP--PPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 389 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PP PP P P P P P P P P Sbjct: 405 PPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P + PP P P PP PP P P P P Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKP 477 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP--PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P + P PP + P P PP P PP PP P Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPI 536 Query: 986 XPP 994 PP Sbjct: 537 KPP 539 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 646 PPTPTYSPPIKP--PPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXX--PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P P+ PP PP P P P P P P P P P Sbjct: 169 PPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSP-PIKP 219 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 191 PPTPIYSPPIKP--PPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPP 237 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P+ PP PP P P PP P P P Sbjct: 202 PPPVHK---PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTP 245 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P P Sbjct: 208 PPTPIYSPPIKP--PPVHKPPTPTYSPPVKPPPVHKPPTPIYSP-PIKP 253 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 225 PPTPTYSPPVKP--PPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P+ PP PP P P PP P P P Sbjct: 236 PPPVHK---PPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP P P+ PP PP P P PP P P P Sbjct: 253 PPPVHK---PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTP 296 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP--PPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXX 985 PP P + P PP P P PP P PP PP P Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPV 486 Query: 986 XPP 994 PP Sbjct: 487 QPP 489 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPX--PPX-PPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 444 PPTPIYSPPVKP--PPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPP-XPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PPP P P + PPP PP P PP P P PP P P P Sbjct: 522 PPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPP 574 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 629 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P P Sbjct: 124 PPTPTYSPPIYP--PPIQKPPTPSYSPPVKPPPVQMPPTPTYSP-PIKP 169 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP PP PPP PP P P P Sbjct: 270 PPPV--QTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPP--XPPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 276 PPTPIYSPPVKP--PPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPP 323 Score = 31.1 bits (67), Expect = 1.6 Identities = 29/140 (20%), Positives = 30/140 (21%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 992 +PPP PP P P P PPP P Sbjct: 320 KPPPVQKPPTPTYSP--PIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKP 377 Query: 993 PXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXPPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 P PP S P P PP P P Sbjct: 378 PTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVK 437 Query: 1173 XPPXPXPPXXPXXPXXXPXP 1232 PP PP P P P Sbjct: 438 PPPVHKPPTPIYSPPVKPPP 457 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP P P PP P P P Sbjct: 561 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP P P PP P P P Sbjct: 578 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP P P PP P P P Sbjct: 595 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPPXPPXP--XPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP P P PP P P P Sbjct: 612 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P P P P P P P P Sbjct: 663 PPTPTYSPPVKP--PPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPP--XPPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 90 PPTPTYSPPIYP--PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXP--XPP--XPPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 107 PPTPTYSPPIYP--PPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPX--PPX-PPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 158 PPTPTYSPPIKP--PPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP 204 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPX--PPX-PPXPXPPXXPXXPXXXPXP 1232 PP PP P PP PP P PP PP PP P P P Sbjct: 310 PPTPTYSPPIKP--PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP PP P P PP P P P Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP PP P P PP P P P Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P + PP P P PP PP P P P Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P + PP P P PP PP P P P Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 29.9 bits (64), Expect = 3.6 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +2 Query: 815 PXPXHXXPRP--XPPPRXXP-XPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP--PXPXX 979 P P H P P PP + P PP P P PP PPP P Sbjct: 455 PPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Query: 980 XXXPP 994 PP Sbjct: 515 TYSPP 519 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP P + PP P P P PP PP P P P Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSP-PIKPPPVKPPTPTYSPPIKPPP 540 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 7/53 (13%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXP---PPXPXPPX--PPXPXPPXXPXXPXXXPXP 1232 PP PP P + PP P PP PP PP P P P P P Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPPQGGYGTPPP 749 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP--PPPPXPXXXXX 988 P P H P P P P PPP P PP P PP P Sbjct: 354 PPPVHKPPTPIYSP---PVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQK 410 Query: 989 PP 994 PP Sbjct: 411 PP 412 Score = 29.5 bits (63), Expect = 4.8 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP + P P PPP P PP P PP Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPP 705 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 706 VKPPPVQVPP 715 Score = 29.1 bits (62), Expect = 6.3 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP + P P PPP P PP P PP Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPP 318 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 319 IKPPPVQKPP 328 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXP--LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P + PP P P PP PP P P P Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKP 427 Score = 29.1 bits (62), Expect = 6.3 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP P P PPP P PP P PP Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPP 688 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 689 VKPPPVQVPP 698 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP P P PPP P PP P PP Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPP 250 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 251 IKPPPVHKPP 260 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP P P PPP P PP P PP Sbjct: 527 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPP 586 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 587 IKPPPVHKPP 596 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXP-------PPPXXXPRXXXXXXXXXXXXXXXPPXP--PPP 964 PP P + P PP P P PPP P PP P PP Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPP 637 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 638 IKPPPVHKPP 647 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP------PXPPXPXPPXXPXXPXXXPXP 1232 PP PP P+ PPP P P P P PP PP P P P P Sbjct: 151 PPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPP--PKVPVISPDP 201 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP---XXPXXPXXXPXPXXP 1241 P PP P+ PPP P P P P P P P P P P P Sbjct: 144 PSSFCPKPPTAPVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVP 195 Score = 35.5 bits (78), Expect = 0.073 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP---PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P+ P P P P P PP P P P P P P Sbjct: 159 PPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVP 211 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P S P P P PP P P P P P P P P P Sbjct: 141 PVQPSSFCPKPPTAPVMPPPQVPVMPPPQVPVKP-HPKVPVISPDP 185 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP-XXPXXPXXXPXPXXP 1241 P P PP P+ P P P P P PP P P P P Sbjct: 183 PDPPATLPPPKVPVISPDPPTTLPPPLVPVINLPPVTSPPQFKLPPLPQIP 233 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 36.7 bits (81), Expect = 0.032 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S PP P + P PPP P PP P PP P P P Sbjct: 142 PPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPP 193 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 146 Query: 980 XXXPP 994 PP Sbjct: 147 YSSPP 151 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYV 186 Query: 980 XXXPP 994 PP Sbjct: 187 YSSPP 191 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX---PPPXPPPXPXPPXPPXP-XPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 132 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPP 182 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 170 PPPPPYVYQSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 226 Query: 980 XXXPP 994 PP Sbjct: 227 YSSPP 231 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 266 Query: 980 XXXPP 994 PP Sbjct: 267 YSSPP 271 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYV 306 Query: 980 XXXPP 994 PP Sbjct: 307 YSSPP 311 Score = 35.5 bits (78), Expect = 0.073 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 126 Query: 980 XXXPP 994 PP Sbjct: 127 YKSPP 131 Score = 35.5 bits (78), Expect = 0.073 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPPPPPXPXXX 982 PP P + P PPP PPPP + P PPPPP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSY 349 Query: 983 XXPP 994 PP Sbjct: 350 SPPP 353 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 92 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 143 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 182 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 233 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 202 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 253 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 222 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 273 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 242 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 293 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 262 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 313 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 282 PPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPP 333 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 292 PPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPP 343 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP PPP P PP PP PP P P P Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPP 103 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP + PP P PPP P PP PP PP P P P Sbjct: 82 PPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 33.9 bits (74), Expect = 0.22 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP P PP PP P P P P Sbjct: 122 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL--XPPPXPP-PXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP PP PP PP PP P P P Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPP 203 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 102 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 153 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S PP P + P PPP PP P PP P P P Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 163 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 172 PPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 223 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 192 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 243 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 212 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 263 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 232 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 283 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 252 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPP 303 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 272 PPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 323 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S PP P + P PPP PP P PP P P P Sbjct: 72 PPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 123 Score = 32.3 bits (70), Expect = 0.68 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PP PP P PP P P P P Sbjct: 62 PPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPP 113 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + PPPPP + Sbjct: 162 PPPYVYSPPPPPPYVYQSPPPPPYVY 187 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFF 383 P SP P PP PPPP + + PPPPP + Sbjct: 164 PYVYSPPPP---PPYVYQSPPPPPY-VYSSPPPPPYVY 197 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +3 Query: 282 SPLXPXFF---PPXXXXXPPPPXHNXFXGPPPPPXFF 383 SP P + PP PPPP + + PPPPP + Sbjct: 52 SPSPPPYVYKPPPYIYSSPPPPPY-VYSSPPPPPYVY 87 Score = 30.3 bits (65), Expect = 2.7 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 9/59 (15%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX-----PPPX----PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P PPP PPP P P P P P P P Sbjct: 302 PPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKP 360 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 73 PPYVYSSPPPPPY-VYNSPPPPPYVY 97 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 83 PPYVYNSPPPPPY-VYSSPPPPPYVY 107 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 93 PPYVYSSPPPPPY-VYKSPPPPPYVY 117 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 103 PPYVYKSPPPPPY-VYSSPPPPPYVY 127 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 113 PPYVYSSPPPPPY-VYKSPPPPPYVY 137 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 123 PPYVYKSPPPPPY-VYSSPPPPPYVY 147 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 133 PPYVYSSPPPPPY-VYSSPPPPPYVY 157 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 143 PPYVYSSPPPPPY-VYKSPPPPPYVY 167 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 183 PPYVYSSPPPPPY-VYKSPPPPPYVY 207 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 193 PPYVYKSPPPPPY-VYSSPPPPPYVY 217 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 203 PPYVYSSPPPPPY-VYKSPPPPPYVY 227 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 213 PPYVYKSPPPPPY-VYSSPPPPPYVY 237 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 223 PPYVYSSPPPPPY-VYKSPPPPPYVY 247 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 233 PPYVYKSPPPPPY-VYSSPPPPPYVY 257 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 243 PPYVYSSPPPPPY-VYKSPPPPPYVY 267 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 253 PPYVYKSPPPPPY-VYSSPPPPPYVY 277 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 263 PPYVYSSPPPPPY-VYKSPPPPPYVY 287 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 273 PPYVYKSPPPPPY-VYSSPPPPPYVY 297 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 283 PPYVYSSPPPPPY-VYSSPPPPPYVY 307 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 293 PPYVYSSPPPPPY-VYSSPPPPPYVY 317 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 303 PPYVYSSPPPPPY-VYKSPPPPPYVY 327 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 313 PPYVYKSPPPPPY-VYTSPPPPPYVY 337 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPP 374 PP PPPP + + PPPPP Sbjct: 323 PPYVYTSPPPPPY-VYKSPPPPP 344 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP P P P Sbjct: 332 PPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPPYVYNYSPPP 378 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP + P P P P PP PP PP P P P Sbjct: 45 PPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPP 93 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 153 PPYVYKSPPPPPY-VYSPPPPPPYVY 177 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P PPP P P P P P Sbjct: 322 PPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPP 368 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 36.3 bits (80), Expect = 0.042 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G GG G GG GGG G GG GG Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGG 379 Score = 35.5 bits (78), Expect = 0.073 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = -3 Query: 433 GGXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRGX 254 GG GGG P K GGGGGP GGG GG G +G G G Sbjct: 341 GGKNGGKGGGGHPLD-GKMGGGGGGPN---GNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Query: 253 P 251 P Sbjct: 397 P 397 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG GG G GGG GGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 8/58 (13%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXR-------GXXGGXEXXXGGG 1091 G G G G G GG G GG G GG GGG G GG GGG Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG 372 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGGGG GG +G GGGG G GGG G G Sbjct: 103 GKGGGGGGGGPANNN----------KGQKIGGGGGGGGGGGGGGGG 138 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 Query: 412 GGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGG 305 GGG P + GGGGG GGGG GG Sbjct: 314 GGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGG 349 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXX--GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG G GGG GG G GGG Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGG 412 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 412 GGGPPPRXRXKXXGGGGGPXXXLXXGGGG 326 GGGP + + GGGGG GGGG Sbjct: 110 GGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG GG GGG G G G GGG Sbjct: 367 GNKGGGGVQMNGGPNGGKKGGGGGG---GGGGGPMSGGLPPGFRPMGGGG 413 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GGG +G G GGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGG 131 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG G GGG GGG G GG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 10/37 (27%) Frame = -3 Query: 1195 GGXGXGGXGGX----------GXGGGXGGGXRGXXGG 1115 GG G GG GG G GGG GGG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGG-GXGGGXRGXXGGXEXXXGGG 1091 G GG G G G G GG GG G G GGG Sbjct: 356 GKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGG 394 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -1 Query: 966 GGGGGXGGXXXXXXXXXXXXGXX--RGXXXGGGGXGXXRGGGXGRGXXCXGXGG 811 GGGGG G +G GGGG G GG G G GG Sbjct: 360 GGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGG 413 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXP 1205 P + PP PP P P P P P P PP P Sbjct: 529 PMMYARPPPAVNYMPPQPQPHQQHPYPYPYPYPPQYP 565 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXR---GXXGGXEXXXGGG 1091 G G G G GG GG G GGG + G GG + GGG Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGG 391 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 36.3 bits (80), Expect = 0.042 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P PP P P P P P Sbjct: 166 PPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P PP P P P P P Sbjct: 94 PPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 35.5 bits (78), Expect = 0.073 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P PP P P P P P Sbjct: 146 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P PP PP P PP P P P P P Sbjct: 74 PPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 123 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP PP P PP PP P PP P P P P Sbjct: 178 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYP 222 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P P PP P PP P P P P P Sbjct: 78 APVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 131 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + PP P PP PP P PP P P P P P Sbjct: 99 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 147 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P P PP P PP P P P P P Sbjct: 150 APVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + PP P PP PP P PP P P P P P Sbjct: 171 PVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPP 219 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P PP PP P P P P P P P Sbjct: 98 APVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 151 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP P PP P P P P P Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 115 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PP P PP PP P PP P P P Sbjct: 126 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYP 166 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P P PP P PP P P P P P Sbjct: 130 APVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 A PP PP P PP PP P P P P P P P Sbjct: 170 APVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P PP P PP P P P P P Sbjct: 114 PPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP P PP P P P P P Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPP 167 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP P PP P P P P P Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPP 187 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P P PP PP P PP P P P P Sbjct: 90 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPP 139 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P P PP PP P P P P P P P Sbjct: 122 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAP 171 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P P PP PP P P P P P P P Sbjct: 142 PPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP + P P PP PP P PP PP P P P Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPPV-KPPVYPPTKAPVKPPVSP 210 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P + P P P PP P PP P P P P P Sbjct: 62 PHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 111 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP PP P PP P P P Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVK-PPVSPPAKPPVKPPVYPPTKAPVKP 134 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP PP P PP P P P Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVK-PPVSPPAKPPVKPPVYPPTKAPVKP 206 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 35.9 bits (79), Expect = 0.055 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 P L PPP PPP P PP PP Sbjct: 374 PQYQSLIPPPSPPPPPPPPPPP 395 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP----PXPPPPPXPXX 979 PP P P PPP P PPPP + P PPPPP P Sbjct: 373 PPQYQSLIPPPSPPP-PPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRY 431 Query: 980 XXXPP 994 P Sbjct: 432 TQFDP 436 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 1112 RPPXXPPXPPXSPPPXPL 1165 +PP PP PP PPP PL Sbjct: 295 QPPPSPPPPPPPPPPQPL 312 Score = 31.9 bits (69), Expect(2) = 0.064 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXP 1187 PPP PPP P PP PP P Sbjct: 296 PPPSPPP-PPPPPPPQP 311 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PP PPP P PP P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKP 267 Score = 30.7 bits (66), Expect(2) = 0.31 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXP 1214 PPP P PP PP P P P Sbjct: 296 PPPSPPPPPPPPPPQPLIAATP 317 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXP 1193 PPP P PP PP P P Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.9 bits (64), Expect(2) = 0.083 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXP 1187 S PP P PP PPP P P P Sbjct: 242 SSPPQQPPATPPPPPPPPPVEVPQKP 267 Score = 29.5 bits (63), Expect(2) = 0.14 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 302 PPPPPPPPQPLIAATPP 318 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP 1157 PP PP P PPP PPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPP 394 Score = 29.5 bits (63), Expect = 4.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP PP PP P PP PP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPP 394 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P PP PP P P PP P P P P Sbjct: 241 PSSPPQQPPATP--PPPPPPPPVEVPQKP 267 Score = 27.9 bits (59), Expect(2) = 0.11 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP 1178 P PP P PPP PPP P P Sbjct: 241 PSSPPQQPPATP-PPPPPPPPVEVPQKP 267 Score = 25.8 bits (54), Expect(2) = 0.11 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 1155 PXPXPPXPPXPXPPXXPXXPXXXP 1226 P P PP PP P PP P P Sbjct: 296 PPPSPP-PPPPPPPPQPLIAATPP 318 Score = 24.6 bits (51), Expect(2) = 7.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 1137 PPPXPPPXPXPP 1172 PPP PPP PP Sbjct: 474 PPPPPPPFRVPP 485 Score = 24.2 bits (50), Expect(2) = 0.083 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 1167 PPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PP P P P Sbjct: 296 PPPSPPPPPPPPPPQPLIAATP 317 Score = 23.8 bits (49), Expect(2) = 0.14 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 P P P PPP PPPP P+ Sbjct: 241 PSSPPQQPPATPPPP----PPPPPVEVPQ 265 Score = 22.6 bits (46), Expect(2) = 0.064 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PP + PP P PP P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKP 267 Score = 22.6 bits (46), Expect(2) = 7.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 1119 PXXPLXPPPXPPP 1157 P + PPP PPP Sbjct: 467 PLIQITPPPPPPP 479 Score = 21.4 bits (43), Expect(2) = 0.31 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP 1172 P P P PPP P P P Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKP 267 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G GG G G G GGG G GG GGG Sbjct: 318 GGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGGMPAGMGGG 364 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGX--GXGGXGGXGXG--GGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GG GG G GG GGG GG GGG Sbjct: 303 GGMPGGFPGGMGGMPGGFPGGMGGMGGMPGGFPGGMGGGMPAGMGGGMPGMGGG 356 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 35.9 bits (79), Expect = 0.055 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXP 1187 PPP PPP P PP PP P Sbjct: 107 PPPPPPPSPSPPPPPGP 123 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PP + + P PPP P P PP P P Sbjct: 91 PPSVVADTEKVKVEANPPPPPPPSPSPPPPPGP 123 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 35.9 bits (79), Expect = 0.055 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 L PPP PPP P PP P P P P P Sbjct: 192 LPPPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 1180 GGXGGXGXG-GGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GG GGG RG GG GGG Sbjct: 205 GGRGGRGGARGGRGGGARGGRGGSRDFGGGG 235 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP S PP PL PP PP P P P P P P Sbjct: 38 PPPQQHSQPPVAPLVPP-GPPYAPPAQIPSSLLPTNLPPPPPFRP 81 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG-GGXGGG 1136 G G G G GG G GG GG G G GG GGG Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG GG G GGG GGG G Sbjct: 786 GCGGGHHGGGGGGCGGCG-GGGCGGGGDG 813 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GGG GGG G GG GGG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGG 805 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G GGG G G G G GGG Sbjct: 780 GHHGGGGCGG--GHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPP---PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYI 106 Query: 980 XXXPP 994 PP Sbjct: 107 YKSPP 111 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV 146 Query: 980 XXXPP 994 PP Sbjct: 147 YKSPP 151 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 196 Query: 980 XXXPP 994 PP Sbjct: 197 YSSPP 201 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 236 Query: 980 XXXPP 994 PP Sbjct: 237 YSSPP 241 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 276 Query: 980 XXXPP 994 PP Sbjct: 277 YSSPP 281 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 316 Query: 980 XXXPP 994 PP Sbjct: 317 YSSPP 321 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYV 356 Query: 980 XXXPP 994 PP Sbjct: 357 YSSPP 361 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 426 Query: 980 XXXPP 994 PP Sbjct: 427 YKSPP 431 Score = 35.5 bits (78), Expect = 0.073 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPPP P PP P PPP P Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYV 186 Query: 980 XXXPP 994 PP Sbjct: 187 YKSPP 191 Score = 35.5 bits (78), Expect = 0.073 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPPPPPXPXXX 982 PP P + P PPP PPPP + P PPPPP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSS 439 Query: 983 XXPP 994 PP Sbjct: 440 PPPP 443 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 52 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 103 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 92 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 143 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 152 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 203 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 172 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 223 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 192 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 243 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 212 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 263 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 232 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 283 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 252 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 303 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 272 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 323 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 292 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 343 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 403 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 372 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 423 Score = 35.1 bits (77), Expect = 0.096 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P PP PP PP P P P Sbjct: 392 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 443 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPPPPPXPXXX 982 PP P + P PPP PPPP P PPPPP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKS 449 Query: 983 XXPP 994 PP Sbjct: 450 PSPP 453 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP S PP P + P PPP PP P PP P P P Sbjct: 72 PPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 123 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP + PP P PPP P PP PP PP P P P Sbjct: 132 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 183 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 142 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 193 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 162 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 213 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 182 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 233 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 202 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 253 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 222 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 273 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 242 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 293 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 262 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 313 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 282 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 333 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX---PPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 322 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPP 373 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 342 PPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 382 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 433 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXXXXX 988 P H P PPP PPPP P PP P PPP P Sbjct: 43 PTHIYSSPPPPPYVYSSPPPP---PYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSS 99 Query: 989 PP 994 PP Sbjct: 100 PP 101 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 62 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 113 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP PP P P P Sbjct: 82 PPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPX--PPXPP--XPXPPXXPXXPXXXPXP 1232 PPP S PP P + P PPP PP PP PP P P P Sbjct: 112 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPP 163 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXP----PPPPXPXX 979 PP P + P PPP PPP P PP P PPP P Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPP---SPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYV 396 Query: 980 XXXPP 994 PP Sbjct: 397 YSSPP 401 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P + P PPP PP P P P Sbjct: 412 PPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPP 453 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP P + P PPP PP P P P Sbjct: 312 PPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 353 Score = 32.3 bits (70), Expect = 0.68 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP----XPPXXPXXPXXXPXP 1232 PPP + PP P + P PPP PP P PP P P P Sbjct: 332 PPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPP 383 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXP---PXPPPPP 967 PP P + P PPP PPPP P PPPPP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PP S PP P PPP P PP PP PP P P P Sbjct: 42 PPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 93 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPPXPXPPXPPXP 1187 PPP S PP P + P PPP PP P Sbjct: 432 PPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP PP P PP P P P P Sbjct: 122 PPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 173 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP PP P PP P P P P Sbjct: 402 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPP 453 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXFF 383 SP + PP PPP + PPPPP + Sbjct: 34 SPPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIY 67 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 63 PPYIYKSPPPPPY-VYSSPPPPPYIY 87 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 83 PPYIYKSPPPPPY-VYSSPPPPPYIY 107 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX--PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PP PP P PP P P P P Sbjct: 302 PPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 353 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 P P PP P PPP P PP PP PP P P P Sbjct: 362 PSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 413 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 53 PPYVYSSPPPPPY-IYKSPPPPPYVY 77 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 73 PPYVYSSPPPPPY-IYKSPPPPPYVY 97 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 93 PPYVYSSPPPPPY-IYKSPPPPPYVY 117 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 103 PPYIYKSPPPPPY-VYSSPPPPPYVY 127 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 113 PPYVYSSPPPPPY-VYKSPPPPPYVY 137 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 123 PPYVYKSPPPPPY-VYNSPPPPPYVY 147 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 133 PPYVYNSPPPPPY-VYKSPPPPPYVY 157 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 143 PPYVYKSPPPPPY-VYSSPPPPPYVY 167 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 153 PPYVYSSPPPPPY-VYKSPPPPPYVY 177 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 163 PPYVYKSPPPPPY-VYSSPPPPPYVY 187 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 173 PPYVYSSPPPPPY-VYKSPPPPPYVY 197 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 183 PPYVYKSPPPPPY-VYSSPPPPPYVY 207 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 193 PPYVYSSPPPPPY-VYKSPPPPPYVY 217 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 203 PPYVYKSPPPPPY-VYSSPPPPPYVY 227 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 213 PPYVYSSPPPPPY-VYKSPPPPPYVY 237 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 223 PPYVYKSPPPPPY-VYSSPPPPPYVY 247 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 233 PPYVYSSPPPPPY-VYKSPPPPPYVY 257 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 243 PPYVYKSPPPPPY-VYSSPPPPPYVY 267 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 253 PPYVYSSPPPPPY-VYKSPPPPPYVY 277 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 263 PPYVYKSPPPPPY-VYSSPPPPPYVY 287 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 273 PPYVYSSPPPPPY-VYKSPPPPPYVY 297 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 283 PPYVYKSPPPPPY-VYSSPPPPPYVY 307 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 293 PPYVYSSPPPPPY-VYKSPPPPPYVY 317 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 303 PPYVYKSPPPPPY-VYSSPPPPPYVY 327 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 313 PPYVYSSPPPPPY-VYKSPPPPPYVY 337 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 323 PPYVYKSPPPPPY-VYNSPPPPPYVY 347 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 333 PPYVYNSPPPPPY-VYKSPPPPPYVY 357 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 373 PPYVYSSPPPPPY-VYKSPPPPPYVY 397 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 383 PPYVYKSPPPPPY-VYSSPPPPPYVY 407 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 393 PPYVYSSPPPPPY-VYKSPPPPPYVY 417 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 403 PPYVYKSPPPPPY-VYSSPPPPPYVY 427 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 413 PPYVYSSPPPPPY-VYKSPPPPPYVY 437 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 423 PPYVYKSPPPPPY-VYSSPPPPPYVY 447 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 PP P PPP P PP PP PP P P P Sbjct: 35 PPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPP 83 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPP + PPPPP + Sbjct: 352 PPPYVYSSPPPSPYVYKSPPPPPYVY 377 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP----XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP + P PPP P PP PP P P P Sbjct: 423 PPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPPPP 476 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXG 1118 GG G GG G G GGG GGG G G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGG 1136 G GG G GG G G GGG GGG Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGGG 35 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G GG G G GG G G G GGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGGXEXXXGG 1094 GG G GGG GGG G GG GG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGG 1115 G GG G GGG GGG G GG Sbjct: 13 GAGGGGGHGGGAGGGFGGGAGG 34 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P PP PP P P P Sbjct: 377 PPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP 423 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXP--LXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P PPP P P PP PP P P P Sbjct: 384 PPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPP 434 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-XPPPXPXPPXPPXPXP 1193 PPP S PP PPP PPP P P P Sbjct: 401 PPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP S PP PPP P PP PP Sbjct: 35 PPPYVYSSPPPYTYSPPPSPYVYKSPPYVYSSPPP 69 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PP PPP PPP P PP P P P P Sbjct: 362 PSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPP 411 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP PP P P P Sbjct: 346 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYSPPPP 394 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP PPP P PP P P P P P Sbjct: 370 PPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPP-PYVYSSPPPYVYNPPPSSP 421 Score = 29.9 bits (64), Expect = 3.6 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP---XPPPXPXP-PXPP--XPXPPXXPXXPXXXP 1226 PPP S PP PPP PPP P PP PP P P Sbjct: 139 PPPYVYSSPPPYAYSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSP 189 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 60 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 93 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 84 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 117 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 108 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 141 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 171 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 204 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 226 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 259 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 250 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 283 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 274 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 307 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 298 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 331 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S PP PPP P PP PP Sbjct: 322 PPYVYSSPPPYAYSPPPSPYVYKSPPYVYSSPPP 355 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP L PP PPP P PP P P P P Sbjct: 9 PPPPPP--PPPRLLVLPPLPPPPP-PPPPQLPFGPKLP 43 Score = 35.1 bits (77), Expect = 0.096 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 1137 PPPXPPPXP----XPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PPP P PP PP P PP P P P Sbjct: 9 PPPPPPPPPRLLVLPPLPP-PPPPPPPQLPFGPKLP 43 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PPP PL PPP PPP P P P P Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = +3 Query: 1128 PLXPPPXP------PPXPXPPXPPXPXPPXXPXXP 1214 P PPP P PP P PP PP P P P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P PP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPP 30 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P PPPP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPP 32 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 GG G GG G G GGG GGG GG Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 G GG GG G G G GGG G GG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXR 1130 G GG G GG G G GGG GGG R Sbjct: 211 GGGGGLG-GGNGSGGGGGGGGGGGR 234 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G GGG GGG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGG 232 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GGG G G G GG GG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GGGG G G G G GG GGGR Sbjct: 212 GGGGLGGGNGSGGGGGGG-GGGGR 234 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G G G G GG G G GG GGG GG G G Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNG-GGYNGGGGYNGGGHGGRHG 84 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GGG GG GG GG Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGG 81 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 35.1 bits (77), Expect = 0.096 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 1116 PPXXPLXPPP-XPPPXPXPP--XPPXPXPPXXPXXPXXXPXP 1232 PP P PPP PPP PP P P PP P P P Sbjct: 226 PPPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNP 267 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.1 bits (77), Expect = 0.096 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G GG G G GG G G G GGG Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGG 215 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G GG G G GGG G G G G GGG Sbjct: 179 GRQGSRYGGGGGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G GG G GG G G GGG G G G G Sbjct: 187 GGGGSFGGGGGGGAGSYG-GGGAGAGSGGGGG 217 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG GGGG G GGGG G Sbjct: 188 GGGSFGGGGGGGAGSYGGGGAG 209 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G G G G GGG G G G GGG A Sbjct: 179 GRQGSRYGGGGGSFG--GGGGGGAGSYGGGGAGAGSGGGGGFSKA 221 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 P P PP PL P PP P PP PP Sbjct: 42 PLPLSPISPPFFPLESSPPSPPPPLPPTPP 71 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 1116 PPXXPLXP--PPXPPPXPXPPXPPXPXPPXXP 1205 P PL P PP P PP PP P PP P Sbjct: 40 PLPLPLSPISPPFFPLESSPPSPPPPLPPTPP 71 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 34.7 bits (76), Expect = 0.13 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP P+ PP PP P PP PP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP PP P PPP PPP PP P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXP 1178 S PP PP PPP P PP P Sbjct: 36 SPPPPPVYSPPISPPPPPPPPPP 58 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S P P PPP PP PP P P Sbjct: 38 PPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPP 84 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G G GG GG G GGG GGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 31.9 bits (69), Expect = 0.90 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 972 GXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGGGG GG +G GGGG G GGG G G Sbjct: 103 GKGGGGGGGGPANNN----------KGQKIGGGGGGGGGGGGGGGG 138 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 Query: 412 GGGPPPRXRXKXXGGGGGPXXXLXXGGGG 326 GGGP + + GGGGG GGGG Sbjct: 110 GGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GGG +G G GGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGG 131 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG G GGG GGG G GG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 10/37 (27%) Frame = -3 Query: 1195 GGXGXGGXGGX----------GXGGGXGGGXRGXXGG 1115 GG G GG GG G GGG GGG G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXP 1205 P + PP PP P P P P P P PP P Sbjct: 407 PMMYARPPPAVNYMPPQPQPHQQHPYPYPYPYPPQYP 443 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRG 1127 G G GG GG G G G GGG RG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRG 80 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGG 1136 G GG G GG G G GGG GGG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGG 1115 G G GG G GGG GGG G GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGG 82 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXG 1097 GG GG G GGG GG G GG G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRG--XXGGXEXXXG 1097 GG GG GG G GG GGG G GG + G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGGLDNVRG 93 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 879 GGGXGXXRGGGXGRGXXCXGXGGXP 805 GGG G GGG G G G GG P Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGP 83 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 894 GXXXGGGGXGXXRGGGXGRG 835 G GGGG G GGG GRG Sbjct: 61 GMGGGGGGGGGSGGGGGGRG 80 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGGXG 864 GG G GGGG G GGG G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGG 81 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P RP PPP PPPP R P PPPPP P Sbjct: 561 PLKPLRILSRPPPPP-----PPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPP 609 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/51 (33%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +2 Query: 836 PRPXPPPRXX----PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPP-PXP 973 P P PP + P PPPP PP PPPP P P Sbjct: 623 PPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAPAP 673 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP + PPP P P PP PP P Sbjct: 102 PPPPDLFPPPSAQMLPPP-PASSPAPPSPPSSSRP 135 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP L PPP P PP P PP P P P Sbjct: 102 PPPPDLFPPPSAQMLPPPPAS-SPAPPSPPSSSRPRPLP 139 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 34.7 bits (76), Expect = 0.13 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPP 1181 L PPP PPP P PP PP Sbjct: 245 LAPPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXP 1187 P PPP P PP PP P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXP 1193 PPP P PP PP P P Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPP 1196 PP P PP PP P PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPP 1172 P PPP PPP P PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1109 LRPPXXPPXPPXSPPP 1156 L PP PP PP PPP Sbjct: 245 LAPPPPPPPPPPPPPP 260 Score = 27.1 bits (57), Expect(2) = 0.19 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 842 PXPPPRXXPXPPPP 883 P PPP P PPPP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 25.8 bits (54), Expect(2) = 1.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 247 PPPPPPPPPP 256 Score = 25.8 bits (54), Expect(2) = 0.19 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 252 PPPPPPPPPP 261 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP P PP Sbjct: 248 PPPPPPPPPPPPPP 261 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXG---GXGGXGXGGGXGGGXRG 1127 G G G G G G G G GG G GGG GGG G Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G G G G G GG GGG Sbjct: 41 GGGGSGDGLGL-GLGGGAGLGGLG-IGAGIGAGAGLGLGGGGFGGGAGGG 88 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXG 841 G G GGG G GG G GGGG G GGG G Sbjct: 46 GDGLGLGLGGGAGLGGLGIGAGIGAGA-----GLGLGGGGFGGGAGGGLG 90 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S P P+ PP P P PP P P P P P P Sbjct: 22 SETPVTPVNTVRPPPSQPPPAPPPLPPPTYRPIAPLRHPNP 62 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 RPPP PPAP P P P P Sbjct: 33 RPPPSQPPPAPPPLPPPTYRPIAP 56 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP P PPP P PP PP P P Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYP 115 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP PPP PP PP P PP P P P Sbjct: 63 PPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPP 110 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPP 1196 PP PP PPP PPP P PP PP Sbjct: 199 PPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKYPP 234 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + P PPP P PP P P P P P P Sbjct: 219 PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWP 264 Score = 32.3 bits (70), Expect = 0.68 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXXSXP-PXXPLXPPPX---PPP--XPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P P PPP PPP P PP P P P P P P Sbjct: 233 PPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPPADP 288 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP PPP PPP P P PP P P P Sbjct: 180 PPPE--KYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPP 229 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PP PPP PPP PP P P P P P Sbjct: 56 PPPIEKYPPPVQ--YPPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPP 104 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 PP + P PPP P PP P PP PPP P P Sbjct: 207 PPIKKYPPPEEYPPP-IKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPP-PEHYPWP 264 Query: 992 P 994 P Sbjct: 265 P 265 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP PP PP PP P P Sbjct: 128 PPPEQYS-PPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPPQEQYP 173 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP---XPPPXPXPPXPP-XPXPPXXPXXP 1214 PP PP PP PPP PP P P PP P Sbjct: 228 PPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPP 271 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 A P P P P+ PP P P PP PP P P Sbjct: 7 AYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P + P P PP PP PP PP P PP P Sbjct: 9 PYPAPGNYPQGPP--PPVGVPPQYYPPPPPPPPPPPPP 44 Score = 32.3 bits (70), Expect = 0.68 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P+ PPP P PPPP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPP 43 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 1137 PPPXPPPXPXPPX--PPXPXPPXXPXXP 1214 P PPP PP PP P PP P P Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 842 PXPPPRXXPX-PPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P P P PPPP P PP PPPPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVP---------PQYYPPPPPPPPPPPPP 44 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P PP PP P P P P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG----XRGXXGGXEXXXGGG 1091 G G G GG G GG G GGG GGG RG G GG Sbjct: 11 GFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGG 61 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -1 Query: 972 GXGGG--GGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 G GGG GG G RG GGG G GG GRG Sbjct: 7 GSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRG 54 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 34.3 bits (75), Expect = 0.17 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P S PP P P P P PP P P P P Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLP 163 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S P P P P P P PP PP Sbjct: 141 PPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPP 174 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P PP P P P P PP P P P P P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP P P P PP PP P P P P P P Sbjct: 22 PPEKPPSPEP-PPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP P P P P P P P Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP S P PPP P P P P PP Sbjct: 22 PPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP P P PP PP P P P P Sbjct: 45 PPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPP 95 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PP P P PP P P P P P P Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPP 112 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP P P PP PP P P P P Sbjct: 77 PPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 127 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP--XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP PP P P PP P P P P P P Sbjct: 141 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPP 192 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP P P PP PP P P P P Sbjct: 93 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 143 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP P P PP PP P P P P Sbjct: 109 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 159 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PP P P PP PP P P P P Sbjct: 125 PPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 175 Score = 32.3 bits (70), Expect = 0.68 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP----XXPXXPXXXPXP 1232 PPP PP P+ PP P PP P PP P P P P Sbjct: 37 PPPYEYKSPPP-PVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP 86 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P P PP PP P Sbjct: 157 PPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPP 197 Score = 31.5 bits (68), Expect = 1.2 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 12/73 (16%) Frame = +2 Query: 812 PPXPXHXXPRPX---PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP-----XPPP-- 961 PP H P P PPP PPPP P PP PPP Sbjct: 70 PPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 129 Query: 962 --PPXPXXXXXPP 994 PP P PP Sbjct: 130 KSPPPPYYYHSPP 142 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 38 PPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 31.1 bits (67), Expect = 1.6 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 12/73 (16%) Frame = +2 Query: 812 PPXPXHXXPRPX---PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP-----XPPP-- 961 PP H P P PPP PPPP P PP PPP Sbjct: 118 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 177 Query: 962 --PPXPXXXXXPP 994 PP P PP Sbjct: 178 KSPPPPYLYSSPP 190 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP S PP PP P P PP PP Sbjct: 173 PPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPP 207 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 70 PPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 54 PPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + + PPPP Sbjct: 95 PPVKSPPPPYYYHSPPPPVKSPPPPYY--YHSPPPP 128 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + + PPPP Sbjct: 111 PPVKSPPPPYYYHSPPPPVKSPPPPYY--YHSPPPP 144 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + + PPPP Sbjct: 127 PPVKSPPPPYYYHSPPPPVKSPPPPYY--YHSPPPP 160 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + + PPPP Sbjct: 143 PPVKSPPPPYYYHSPPPPVKSPPPPYY--YHSPPPP 176 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 150 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 86 PPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 102 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 118 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S PP PPP P PP P P P P P Sbjct: 134 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPPPXF 380 P SP P + PP PPPP + + PPPP + Sbjct: 175 PPVKSPPPPYLYSSPPPPVKSPPPPVY-IYASPPPPTHY 212 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + PPPP Sbjct: 63 PPVKSPPPPYYYHSPPPPVKSPPPPY--VYSSPPPP 96 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P ++ PP PPPP + PPPP Sbjct: 159 PPVKSPPPPYYYHSPPPPVKSPPPPY--LYSSPPPP 192 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 270 PXXXSPLXPXFF--PPXXXXXPPPPXHNXFXGPPPP 371 P SP P + PP PPPP + + PPPP Sbjct: 79 PPVKSPPPPYVYSSPPPPVKSPPPPYY--YHSPPPP 112 >At2g05540.1 68415.m00586 glycine-rich protein Length = 135 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G G G GG G G GG GGG GG GG Sbjct: 48 GGFPGGGYGGFPGGGYGGNPGGGYGNRGGGYRNRDGG 84 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG G G GG GGG G GG GGG Sbjct: 48 GGFPGGGYGGFPGGGYGGNPGGGYGNRGGG 77 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP + P PPP P P PP P PP P Sbjct: 412 PPVIEITRDPSPPPSPVQP-PPPPSPPPQP 440 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 S P P PPP P PP P P P P P P Sbjct: 401 SVKPLLPTLPPPPVIEITRDPSPP-PSPVQPPPPPSPPPQP 440 Score = 29.1 bits (62), Expect(2) = 0.40 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 812 PPXPXHXXPR-PXPPPRXXPXPPPPXXXPR 898 PP P R P PPP PPPP P+ Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPPPQ 439 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP P P PPP P PP P Sbjct: 411 PPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 Score = 22.6 bits (46), Expect(2) = 0.40 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP P PPP P Sbjct: 431 PPPPSPPPQP 440 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G GGG GGG G GG G G Sbjct: 718 GCGGCGGCGGGGGCGGG--GRCGGMTKIEGCG 747 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PL PPP P PP P P P P Sbjct: 48 PPFFPLYSSTSPPPPPSPPQPLPPPAPTFATFP 80 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 282 SPLXPXFFPPXXXXXPPPPXHNXFXGPPPPPXF 380 S P FFP PPPP PPP P F Sbjct: 44 STFSPPFFPLYSSTSPPPPPSPPQPLPPPAPTF 76 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GGG R GG GGG Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGG 815 GGGG G G G GG GGG Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGG 29 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 29.5 bits (63), Expect = 4.8 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 S P PL PPP PPP PP P PP Sbjct: 363 SPPSQFPLPPPP-PPP---PPSPSTSSPP 387 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 1110 SXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXP 1205 S P P PP P P P PP PP P P Sbjct: 355 SCPIQFPASPPSQFPLPPPPPPPPPSPSTSSPP 387 Score = 26.6 bits (56), Expect(2) = 0.23 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 PP PPPPP P P Sbjct: 372 PPPPPPPPSPSTSSPP 387 Score = 25.8 bits (54), Expect(2) = 0.23 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXP 895 P PP P PPPP P Sbjct: 361 PASPPSQFPLPPPPPPPP 378 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXP 1205 PP PP P P PP P PP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPP 1181 PP P P PPP P PP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXP 1214 PP P PP P P PP P P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXP 866 RPPP + PP P P P P Sbjct: 265 RPPPPSSPPPPPPPPPTP 282 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP PPP P P P PP P P P Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPPDPFSWTNP 129 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXP 1169 A PPP P L PP PPP P P Sbjct: 94 ATRIPPPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 807 AXRPPPXTXPPAPXPXPVXPXXPPPP 884 A R PP PP P P + PPPP Sbjct: 94 ATRIPPPQPPPPPQPLNLFSPPPPPP 119 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P PP Sbjct: 99 PPQPPPPPQPLNLFSPP 115 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 309 PXXXXXPPPPXHNXFXGPPPPP 374 P PPP N F PPPPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPP 119 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PP S PP P PPP PP PP P P P Sbjct: 299 PPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPP 342 Score = 33.5 bits (73), Expect = 0.29 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP S PP P PP PPP P PP P Sbjct: 356 PPYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPP 393 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 270 PXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPP 368 P SP +FPP PPP + PPP Sbjct: 287 PNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPP 319 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP----PXXPXXPXXXPXPXXP 1241 PPP P P PPP P P P P P P P P P P Sbjct: 317 PPPTQSLHQP--PYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNPP 368 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P PP L PP PP P P P P Sbjct: 312 PPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPP 343 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPP----XPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P S PP P PPP PPP P P PP P P P Sbjct: 26 PSNESSPPTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPP 77 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP S P P P P P PP P P P P Sbjct: 68 PPTSPSSSPPVVANPSPQTPENPSPPAPEGSTPVTPPAPP 107 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 33.5 bits (73), Expect = 0.29 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P PPP P P PP P P P Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPP 68 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P PP PP P PP PP P P P Sbjct: 40 PCQPNPSPPPPPSNPSPP-PPSPTTTACPPPP 70 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP + P P P P PPPP Sbjct: 48 PPPPSNPSPPPPSPTTTACPPPP 70 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGG 1136 G GG G GG G G GGG GGG Sbjct: 194 GDGGGFGGGGSGFGGGGGGGGGG 216 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 1213 GXXGXXGGXGXG-GXGGXGXGGGXGGGXRG 1127 G G G G G G GG G GGG GGG G Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGGGG 216 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 G G GGGG G GGGG G Sbjct: 196 GGGFGGGGSGFGGGGGGGGGG 216 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G GGG G G G GGG Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGG 290 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GG G GGG G G + GGG Sbjct: 275 GGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG GG G GGG GG G GGG Sbjct: 264 GGGGAGGGKGAGGG-AKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGG 309 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G GG G GGG GG G GGG Sbjct: 256 GGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G GG G G GG GGG Sbjct: 289 GGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGGG 338 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP-PXPP 1181 PPP PP P P P P P P P PP Sbjct: 421 PPPAVNYMPPNPHQYPNPHPYPYPYPYPYPP 451 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = -3 Query: 409 GGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXRGXXXXGXKRG 257 GGP + + GGGG GGGG G K G G G G Sbjct: 280 GGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGG 330 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 430 GXXXXXGGGPPPRXRXKXXGGGGGPXXXLXXGGGGXXXXXGGKKXGXR 287 G GGG P K GGGGGP G GG GG G R Sbjct: 288 GGGKNGGGGHP--QDGKNGGGGGGPNAG-KKGNGGGGPMAGGVSGGFR 332 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXG 1118 GG G GG G G GG GGG G G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 1204 GXXGGXGXGGX-GGXGXGGGXGGGXRG 1127 G GG G GG GG G GG GGG G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 882 GGGGXGXXRGGGXGRGXXCXGXGGXP 805 GGGG G GG G G G GG P Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGGP 37 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGG 1115 GG GG G GG GGG GG Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGG 34 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 1162 GXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G GGG GGG GG GGG A Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCGA 40 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 GG G G GG GGG GG G G Sbjct: 13 GGGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX--GGXGGXGXGGGX--GGGXRGXXGGXEXXXGGG 1091 G G G GG G GG G GGG GGG R GG GGG Sbjct: 54 GGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGG 104 Score = 32.3 bits (70), Expect = 0.68 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG GG G GG GG GG GGG Sbjct: 43 GYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGG 89 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGX---GGXGGXGXGGG--XGGGXRGXXGGXEXXXGG 1094 G G G G G G GG G GGG GGG R GG GG Sbjct: 60 GGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGG 110 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 PPP P PPPP PP PPPPP P Sbjct: 365 PPP---PPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPP 403 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGGXXXA 1079 G G G G GG G G G GGG G G + GGG A Sbjct: 842 GGGGFGGLGSGTGGFGGFAPQGSSGGFAGAAGGGGFGGFGGQAQGQAGGGGFSA 895 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +3 Query: 1131 LXPPPXPPPXPX-PPXPPXPXPPXXP 1205 L PPP PPP PP PP P P P Sbjct: 19 LRPPPAPPPESSSPPTPPEPPDPPDP 44 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXP 1187 PP P PP P PP PP P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP P PPP P P PP P P P P Sbjct: 30 PPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYP-PPPGAYPPAGYPGPSGP 78 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PP PP PP P P P P P P Sbjct: 25 PPGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYP 73 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXP---PXPXPPXXPXXP 1214 P PL PPP PPP P P P P PP P Sbjct: 215 PVLLPLQPPPPPPPSQPLPRPLLLPPPPPPSFHAQP 250 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 +PPP P P P P+ PPPP Sbjct: 221 QPPPPPPPSQPLPRPLLLPPPPPP 244 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPP 1157 PPP S P PL PP PPP Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPP 244 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -1 Query: 990 GXXXXXGXGGGGGXG-GXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G G GGGG G G G RG G G G RGGG RG G G Sbjct: 45 GRGDGHGRGGGGDRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHGRGGGGDRGRGYSGRG 104 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRP------XPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PP 964 PP P + P P PPP PPPP P P PP P Sbjct: 567 PPPPPYYSPSPKPAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPS 626 Query: 965 PXPXXXXXPP 994 P P PP Sbjct: 627 PKPTYKSPPP 636 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 191 PPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSP 250 Query: 968 XPXXXXXPP 994 P PP Sbjct: 251 KPAYKSPPP 259 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 241 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSP 300 Query: 968 XPXXXXXPP 994 P PP Sbjct: 301 KPAYKSPPP 309 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 291 PPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSP 350 Query: 968 XPXXXXXPP 994 P PP Sbjct: 351 KPAYKSPPP 359 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 341 PPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 Query: 968 XPXXXXXPP 994 P PP Sbjct: 401 KPVYKSPPP 409 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 618 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSP 677 Query: 968 XPXXXXXPP 994 P PP Sbjct: 678 KPTYKSPPP 686 Score = 31.9 bits (69), Expect = 0.90 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 8/69 (11%) Frame = +2 Query: 812 PPXPXHXX-PRPX----PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 PP P + P+P PPP PPPP P P PP P P Sbjct: 668 PPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSP 727 Query: 968 XPXXXXXPP 994 P PP Sbjct: 728 KPTYKSPPP 736 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP----PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P P P PP P P P P P P P Sbjct: 710 PPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPP 763 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 9/69 (13%) Frame = +2 Query: 815 PXPXHXXPRPX------PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PPP 967 P P + P P PPP PPPP P P PP P P Sbjct: 141 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSP 200 Query: 968 XPXXXXXPP 994 P PP Sbjct: 201 KPTYKSPPP 209 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP S P PP P PP PP P P P Sbjct: 542 PPPPCYSHSPKIEYKSPPTPYVYHSPPPPPYYSPSPKPAYKSSPP 586 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 108 PPPYVYSSPP----PPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSP 150 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 208 PPPYIYSSPP----PPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSP 250 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 233 PPPYVYSSPP----PPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 275 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 258 PPPYVYSSPP----PPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSP 300 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 308 PPPYVYSFPP----PPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSP 350 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 358 PPPYVYSSPP----PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSP 400 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 483 PPPYVYSSPP----PPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSP 525 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPP---XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P S PP PPP P P P PP P P P P P Sbjct: 579 PAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYSPSP 627 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 635 PPPYVYSSPP----PPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSP 677 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 660 PPPYVYSSPP----PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAP 702 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 685 PPPYVYSSPP----PPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSP 727 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P P P PP P P P P P Sbjct: 383 PPPYVYSSPP----PPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSP 425 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PPP S P PP P PP PP P Sbjct: 769 PPPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSP 802 Score = 28.7 bits (61), Expect = 8.4 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 9/70 (12%) Frame = +2 Query: 812 PPXPXHXXPRPX------PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP---PP 964 PP P P P PPP PPPP P P PP P Sbjct: 40 PPPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPS 99 Query: 965 PXPXXXXXPP 994 P PP Sbjct: 100 PKVDYKSPPP 109 Score = 28.7 bits (61), Expect = 8.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP----PXPPXPXPPXXPXXPXXXPXP 1232 P P S PP PP P P P PP P P P P P Sbjct: 125 PKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 175 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P P PP P P P P P Sbjct: 283 PPPYVYNSPP----PPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSP 325 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P P PP P P P P P Sbjct: 333 PPPYVYNSPP----PPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSP 375 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P P PP P P P P P Sbjct: 408 PPPYIYNSPP----PPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSP 450 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP + PP P P P P PP P P P P P Sbjct: 610 PPPYVYNSPP----PPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTP 652 Score = 28.7 bits (61), Expect = 8.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP PPP P P PP P P P P P Sbjct: 735 PPPYVYSSPP-----PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSP 778 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 27.1 bits (57), Expect(2) = 0.31 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 1128 PLXPPPXPPPXPXP 1169 P PPP PPP P P Sbjct: 280 PSPPPPPPPPPPLP 293 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP P P Sbjct: 329 PPPPPPPPPPVEYYKSP 345 Score = 25.8 bits (54), Expect(2) = 9.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP PP Sbjct: 330 PPPPPPPPPVEYYKSPP 346 Score = 25.0 bits (52), Expect(2) = 0.31 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPP 1196 P PPP P PP PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 Score = 21.8 bits (44), Expect(2) = 4.3 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = +2 Query: 821 PXHXXPRPXPPPRXXPXPPPPXXXP 895 P P P P PPPP P Sbjct: 265 PRKSNPIPNLASEFHPSPPPPPPPP 289 Score = 21.0 bits (42), Expect(2) = 9.2 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 854 PRXXPXPPPPXXXP 895 P P PPPP P Sbjct: 280 PSPPPPPPPPPPLP 293 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXP--PPXPXPPXPPXPXPPXXPXXP 1214 PPP S P PL P P P PP PP P P PP P Sbjct: 382 PPPSQIS-PSSQPLAPAPSPTSPPLSTPP-PARPCPPVYSPPP 422 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 1116 PPXXPLXPPPXP-PPXPXPPXPP-XPXPPXXPXXPXXXPXPXXP 1241 PP + P P P P P PP PP P P P P P Sbjct: 382 PPPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX--PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P + PP P PPP PPP PP P P P P P P Sbjct: 24 PAPTPTATPP--PATPPPVATPPPVATPPPAATPAPATPP--PAATPAP 68 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + PP PP PP P P P PP P P P Sbjct: 32 PPP---ATPPPVATPPPVATPPPAATPAPATP-PPAATPAPATTPPSVAP 77 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P PPP PP P P PP P P P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPPAATP 66 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1180 GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG GGG G G G GG GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 879 GGGXGXXRGGGXGRGXXCXGXGG 811 GGG G GGG GRG G GG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGG 46 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 33.1 bits (72), Expect = 0.39 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGG 1136 G G GG GG G GGG GGG Sbjct: 609 GEGGGGGGGGGPGGGGGGG 627 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 33.1 bits (72), Expect = 0.39 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP P PPP P P P P P P P Sbjct: 30 PPARPTTPPPARPTTPPPVWPTTPPPAGAP 59 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PP + PP P PPP P P P P P Sbjct: 30 PPARPTTPPPARPTTPPPVWPTTPPPAGAPVAVP 63 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP P PPP PPP P P PP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 P P PPP P P PP P PP P P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPP 1236 P PPPP PP P P PP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPP 262 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PPP P PP P P P P Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP PP P P PPPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 813 RPPPXTXPPAPXPXPVXPXXPPPP 884 +P P PP P P PV PPP Sbjct: 238 KPDPTPPPPPPPPIPVKQSATPPP 261 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 307 PPXPXXXXPPXXTTXSXAPXPPPXFFXXNGGXGPP 411 P P PP S P PPP N G PP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPP 275 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXP------PXPPXPXP 1193 PPP PP P+ PPP P P P PP P P Sbjct: 243 PPPPP---PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 839 RPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXXXXP 991 RP PPP+ P P P P PP PPPP P P Sbjct: 138 RPIPPPQHPP--PRPQSQPLDYYSAPQGNHYYSPSPPPPPPPQAPITAPSP 186 >At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 491 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 PP S PP PPP PP P P PP P Sbjct: 50 PPSSSISQPPT----PPPGPPDSPAPSLPPSP 77 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PP + PP PP P PP P P P P Sbjct: 50 PPSSSISQPPTPP--PGPPDSPAPSLPPSP 77 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P PPP PP PP PP P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PPP P P P PP P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 28.7 bits (61), Expect(2) = 0.46 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 842 PXPPPRXXPXPPPP 883 P PPP+ P PPPP Sbjct: 108 PPPPPKPQPPPPPP 121 Score = 27.1 bits (57), Expect(2) = 1.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P+ PPP P PPPP Sbjct: 104 PKRPPPPPPKPQPPPP 119 Score = 23.4 bits (48), Expect(2) = 1.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 PP P PPP P P Sbjct: 111 PPKPQPPPPPPRSQKP 126 Score = 23.0 bits (47), Expect(2) = 0.46 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 P PPPPP PP Sbjct: 114 PQPPPPPPRSQKPMQPP 130 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G GG GG G GGG GG G G Sbjct: 124 GTIGGGGQGGGGQGGGGGGAEGGTTG 149 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 5/55 (9%) Frame = +2 Query: 842 PXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPP-----PPXPXXXXXP 991 P P P+ P PPP P PP PPP PP P P Sbjct: 66 PPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPP 120 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P P PP PP P P P P Sbjct: 75 PPPPSQSSPPRSRCPPVPTTGCCNQPPGPP-PSTMYSPPYPYFYTPP 120 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 32.7 bits (71), Expect = 0.51 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 3/53 (5%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGG-XGGXGXGG-GXG-GGXRGXXGGXEXXXGGG 1091 G G G GG G GG G G GG G G GG RG G GGG Sbjct: 21 GGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGG 73 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 963 GGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRG 835 GG G GG R G GG G RGGG G G Sbjct: 21 GGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDG 63 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXG-GGXGGGXRG---XXGGXEXXXGGG 1091 G G GG G GG G G G GG G G R GG GGG Sbjct: 6 GGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGG 59 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -1 Query: 990 GXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 G G G GG G RG G G G RG G G G G G Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIGGGG 74 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 10/57 (17%) Frame = +3 Query: 1092 PPPXXXSXPPXX-----PLXPPPX-----PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PPP PPP P P P P P P P Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPP 246 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP---XPPPPPXPXXXXXP 991 PPP+ PPPP R PP PPPP P P Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PP P PPP P P P P P P Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 305 PPXXXXXPXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 PP PP PP P P GG APP Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPP 246 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 10/57 (17%) Frame = +3 Query: 1092 PPPXXXSXPPXX-----PLXPPPX-----PPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PPP S PP P+ PPP PPP P P P P P P P Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPP 246 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +2 Query: 848 PPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPP---XPPPPPXPXXXXXP 991 PPP+ PPPP R PP PPPP P P Sbjct: 190 PPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGMPPAP 240 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PP PP P PPP P P P P P P Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 305 PPXXXXXPXPPXXQXXXXPPXPPXXFXPXTGGXAPP 412 PP PP PP P P GG APP Sbjct: 211 PPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPP 246 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G GG G GG GG GGG GGG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GGG GGG G GG + GGG Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGD--GGGG 152 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 1137 PPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXPXXP 1241 P P P P P P P P PP P P P P P Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTP 67 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 S P P P P P PP P P P P P P Sbjct: 33 SPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P P P+ PP P P P P PP P Sbjct: 34 PKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP----XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP + P+ P P PP P PP P PP P P P Sbjct: 123 PPPPSKTHERSRPITPSPPPPSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPP 176 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXP-----PXPXPP 1196 PPP + P P PPP PPP P P P PP Sbjct: 140 PPPPSKTHEPSRPNTPPP-PPPPSKTHEPSRRITPSPPPP 178 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G G GGG GGG G GG GGG Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGGLGGG--GCGGGG 172 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRG 1127 GG G GG GG G GGG GGG G Sbjct: 153 GGGGGGGGGGLG-GGGCGGGGCG 174 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 926 GRGXGGGGXGXXXXXGGGGXG 864 G G GGGG G GGGG G Sbjct: 149 GHGCGGGGGGGGGGLGGGGCG 169 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G GGG GGG G GG GG Sbjct: 137 GSASSCSGGGSHGHGCGGGGGGGGGGLGG--GGCGGGGCGG 175 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXE 1109 GG G G G G G G GGG G G E Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGGSEE 89 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRG 1127 G GG G GG GG GGG G Sbjct: 61 GGGGGGSIGNHGGGSGSGGGGGGYGG 86 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P P P PP P PPPP Sbjct: 234 PPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 32.3 bits (70), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 L PPP PPP P PP P P P Sbjct: 229 LPPPPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 31.9 bits (69), Expect = 0.90 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 A PPP PP PPP PP PP PP Sbjct: 226 ANGLPPPPP---PPPHQAQPPPPPPSGLFPPPPP 256 Score = 31.9 bits (69), Expect = 0.90 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP 883 PP P H P PPP PPPP Sbjct: 233 PPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 288 LXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 L P PP PPPP + PPPPP Sbjct: 229 LPPPPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 26.6 bits (56), Expect(2) = 7.5 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P P PPP PPPP Sbjct: 231 PPPPPPPHQAQPPPPP 246 Score = 26.6 bits (56), Expect(2) = 5.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P P PP + P PPPP Sbjct: 232 PPPPPPHQAQPPPPPP 247 Score = 21.0 bits (42), Expect(2) = 5.8 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP PP Sbjct: 242 PPPPPPSGLFPPPP 255 Score = 20.6 bits (41), Expect(2) = 7.5 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 Query: 953 PPPPPXPXXXXXPP 994 PPPPP PP Sbjct: 243 PPPPPSGLFPPPPP 256 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G G GGG GG G G GGG Sbjct: 27 GYEGEEEWGGAGGGEWGGAEGG-GAWGGGGGGGGAWGGEGEGGGEWGGGG 75 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG 1136 G G G G GG G GG G GGG GGG Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGG--GEWGGGGEGGG 79 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGG-GXRGXXGGXEXXXGGG 1091 G G G G G G GG G GG GG G G G GGG Sbjct: 36 GAGGGEWGGAEGGGAWGGGGGG-GGAWGGEGEGGGEWGGGGEGGGG 80 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P+ P P P PP PP P P P P P P Sbjct: 41 PVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PPP P PL PPP PPP P Sbjct: 55 PPPPLPDFAPQ-PLLPPPSPPPPP 77 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXP--PPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP PPP PP P PP P P P P P Sbjct: 65 PPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAP 115 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P + PP PL P PP P P P P P P P P Sbjct: 159 PASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPTVPPKTP 208 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXP-PXPXPPXXPXXPXXXP 1226 PP S PP PP P P PP P PP P P Sbjct: 72 PPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPP 116 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPP----PXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP PP + PP P PP PP P PP P P P Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPP--PPTSNESPSP 105 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP + PP P PP PP PP P P P Sbjct: 15 PPADTAPPPETPSENSALPPVDSSPPSPPADSSSTPPLSEPSTPPP 60 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPP-PXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP S P P P P P P P P PP P P P P P Sbjct: 155 PPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAP-PSPFPTVP 204 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 P + PP P P PP P P P P P P P P Sbjct: 171 PLDPTNPPPIQPSGPATSPPANPNAP--PSPFPTVPPKTPSSGP 212 Score = 29.5 bits (63), Expect = 4.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP S PP PP P P P P P Sbjct: 78 PPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAP 115 Score = 28.7 bits (61), Expect = 8.4 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 1092 PPPXXX--SXPPXXP---LXPP-PXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP S PP P + P P PP PP PP P P P P Sbjct: 124 PPPSQDLQSPPPSSPSPNVGPTNPESPPLQSPPAPPASDPTNSPPASPLDPTNPPP 179 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 32.7 bits (71), Expect = 0.51 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P P PP P PP PP P PP Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLPPPP 38 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PL PPP PP P PP P P Sbjct: 23 PPSAPLPPPPPLPP-PPPPRQSHPESP 48 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 258 PLFXPXXXSPLXPXFFPPXXXXXPPPPXHNXFXGPPPPP 374 P + P SP P PP PPPP PPPPP Sbjct: 8 PTYDPWN-SPYSPHLHPPSAPLPPPPPL------PPPPP 39 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXP 1193 P P PP P P PP PP P P Sbjct: 16 PYSPHLHPPSAPLPPPPPLPPPPPP 40 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P P PPP P PP PP P P Sbjct: 24 PSAPLPPPPPLP-PPPPPRQSHPESP 48 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 827 HXXPRPXPPPRXXPXPPPP 883 H P PPP P PPPP Sbjct: 22 HPPSAPLPPPPPLPPPPPP 40 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPP 883 P H P P P P PPPP Sbjct: 16 PYSPHLHPPSAPLPPPPPLPPPP 38 Score = 23.4 bits (48), Expect(2) = 1.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 944 PPXPPPPP 967 PP PPPPP Sbjct: 32 PPLPPPPP 39 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP P PPP PPP P P P PP Sbjct: 120 PPSTAVEYQPHHRHHPPPPPPP-PPPRSPNSASPP 153 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXP 1193 PPP PPP P P P P Sbjct: 136 PPPPPPPPPRSPNSASPPP 154 Score = 26.2 bits (55), Expect(2) = 0.54 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXPP 994 PP PPPPP PP Sbjct: 137 PPPPPPPPRSPNSASPP 153 Score = 25.0 bits (52), Expect(2) = 0.54 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 815 PXPXHXXPRPXPPPRXXPXPPPPXXXPR 898 P P P R P PPPP PR Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPPPPPR 145 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGX-GXGGXGGXGXGGGXGGGXRG 1127 G G G G GG G G G GGG GGG G Sbjct: 86 GYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNG 121 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GG GGG G GGG Sbjct: 70 GRGSGYGY-GSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGG 115 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G GG GG G G G G GG G G Sbjct: 82 GSGTGYGY-GSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 29.5 bits (63), Expect = 4.8 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXG-GGXRGXXGGXEXXXGGG 1091 G G G G G G G G G GGG GG G G GGG Sbjct: 68 GWGRGSGY-GYGSGSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGG 114 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 32.3 bits (70), Expect = 0.68 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRG 1127 G GG GG G GGG GGG G Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 1171 GGXGXGGGXGGGXRGXXGG 1115 GG G GGG GGG G GG Sbjct: 9 GGGGGGGGSGGGIGGGGGG 27 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 929 GGRGXGGGGXGXXXXXGGGG 870 GG G GGGG G GGGG Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -3 Query: 1192 GXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G GG GGG G GG + G G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGG--GGGDGSDGKG 109 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G GG G G G G GG GGG G G Sbjct: 79 GNSGGSGGLGGSGGGGGGSGGGGGDGSDG 107 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 32.3 bits (70), Expect = 0.68 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +2 Query: 836 PRPXPPP--RXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXP 973 P P PPP R P PPPP PP PPPP P Sbjct: 11 PPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPP--PPPPLP 56 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 300 FFPPXXXXXPPPPXHNXFXGPPPPPXF 380 F PP PPPP PPPPP F Sbjct: 7 FTPPPPP--PPPPSFRSIPRPPPPPSF 31 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 1137 PPPXPPPXPXPPXPPXPXPP 1196 PPP PPP P P P PP Sbjct: 9 PPPPPPPPPSFRSIPRPPPP 28 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGG 1115 GG G G G G G G GGG G GG Sbjct: 63 GGGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXG 1118 GG G G G G G G GGG G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G GG G GG GG GGG G G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 32.3 bits (70), Expect = 0.68 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 PPP PP P PP P P P PP P P P Sbjct: 288 PPPSHPQPPPSNP--PPYQAPQTQTPHQPSYQSPPQQPQYPQQPP 330 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP P PP P Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSP 111 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PPP PP P PP P Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 127 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-----XPPPXPXPPXPPXPXPPXXP 1205 PPP PP PPP PPP P PP P P Sbjct: 63 PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP P PP PP P Sbjct: 79 PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 119 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 71 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 79 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 95 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 151 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 119 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 159 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP PPP PP P PP Sbjct: 47 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 95 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 32.3 bits (70), Expect = 0.68 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP P PP P Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSP 111 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PPP PP P PP P Sbjct: 87 PPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 127 Score = 29.5 bits (63), Expect = 4.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP-----XPPPXPXPPXPPXPXPPXXP 1205 PPP PP PPP PPP P PP P P Sbjct: 63 PPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP P PP PP P Sbjct: 79 PPPVKYYSPPPVYKSPPPPVYKSPPPPVKHYSPPPVYKSPP 119 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 31 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 71 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 79 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 95 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 135 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 103 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 143 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPP 151 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP PP PPP PP P PP P Sbjct: 119 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSP 159 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP PPP PP P PP Sbjct: 47 PPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 81 Score = 28.7 bits (61), Expect = 8.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S PP PP P PP PP P Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPP 95 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 32.3 bits (70), Expect = 0.68 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P S PP P PP P PP P PP Sbjct: 247 PAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPPP 281 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 32.3 bits (70), Expect = 0.68 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGX-GGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G G G GG G GG G G GGG RG GG GG Sbjct: 487 GGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGG-----RGRDGGRGRFGSGG 532 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPPXXP 1205 PP PPP PP PP P PP P Sbjct: 75 PPSPPPT-LPPSPP-PPPPFSP 94 Score = 28.7 bits (61), Expect = 8.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPPXP 1187 P PPP PP P PP P P Sbjct: 75 PPSPPPTLPPSPPPPPPFSP 94 Score = 27.5 bits (58), Expect(2) = 0.68 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 842 PXPPPRXXPXPPPP 883 P PPP P PPPP Sbjct: 76 PSPPPTLPPSPPPP 89 Score = 23.4 bits (48), Expect(2) = 0.68 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 944 PPXPPPPP 967 PP PPPPP Sbjct: 83 PPSPPPPP 90 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 1128 PLXP-PPXPPPXPXPPXPPXPXPPXXP 1205 P P PP PPP P PP P P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLPKFSP 111 Score = 29.1 bits (62), Expect(2) = 0.86 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPR 898 P+P PPP PPPP P+ Sbjct: 88 PQPPPPPPIENLPPPPPPLPK 108 Score = 21.4 bits (43), Expect(2) = 0.86 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 953 PPPPPXPXXXXXP 991 PPPPP P P Sbjct: 101 PPPPPLPKFSPSP 113 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 1195 GGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 GG G GG GG GGG GGG RG G Sbjct: 187 GGQGRGGQQRGGGRGGGGRGGGGRGRRPG 215 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 1195 GGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 GG G GG GG GGG GGG RG G Sbjct: 123 GGQGRGGQQRGGGRGGGGRGGGGRGRRPG 151 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 1195 GGXGXGGX--GGXGXGGGXGGGXRGXXGG 1115 GG G GG GG GGG GGG RG G Sbjct: 189 GGQGRGGQQRGGGRGGGGRGGGGRGRRPG 217 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PP P PPP P PP P P P Sbjct: 212 PPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPAP 246 >At4g32340.1 68417.m04603 expressed protein Length = 238 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G GG GG G GGG GGG G E Sbjct: 90 GFGGRGGDGAGGGGGGGGGSVDGYYE 115 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGG 1136 G GG G G G G GGG GGG Sbjct: 86 GSNGGFGGRGGDGAGGGGGGGGG 108 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXP 1178 L PPP PPP P PP P Sbjct: 425 LMPPPPPPPPPPPPPP 440 Score = 30.7 bits (66), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 1140 PPXPPPXPXPPXPP 1181 PP PPP P PP PP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1109 LRPPXXPPXPPXSPPP 1156 L PP PP PP PPP Sbjct: 425 LMPPPPPPPPPPPPPP 440 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 1131 LXPPPXPPPXPXPPXP 1178 L PPP PPP P PP P Sbjct: 42 LTPPPPPPPRPPPPPP 57 >At3g44950.1 68416.m04843 glycine-rich protein Length = 72 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGG-XRGXXGGXEXXXGGG 1091 G G G G G G G GG GGG G GG + GGG Sbjct: 18 GDGGCSGDNGSSGDNGNPNNGVVAPVGNSGGGGGGDDGGDVGGGDDGGGGG 68 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 31.9 bits (69), Expect = 0.90 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXPP 1196 PP PPP P PP P PP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 1/64 (1%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXX-PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPPXPXXX 982 G PP P H PPP PPPP PP PP Sbjct: 249 GGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGG 308 Query: 983 XXPP 994 PP Sbjct: 309 PRPP 312 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 31.9 bits (69), Expect = 0.90 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPP--XPPPXPXPPXP 1178 PPP P P PPP PPP PP P Sbjct: 35 PPPTNQYSAPYYPYPPPPYATPPPYASPPPP 65 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 806 GXPPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 G P P + P P PP P PPPP P PPPP Sbjct: 13 GQYPYP-YPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPPP 65 >At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 116 Score = 31.9 bits (69), Expect = 0.90 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP P P P P PP P P P P P P P P Sbjct: 52 PPGLPFGGVP-PLPSLFPPFVPSPFPGNIPRLPFPFPFPTSP 92 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 31.9 bits (69), Expect = 0.90 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 1240 GXXGXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXG 1118 G G G G G G GG G G G G GGG +G G Sbjct: 84 GGPGPGPWSGPRGPR--PGGGGGPGSGCGSGTGGGNQGQGG 122 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 430 GXXXXXGGGPPPRX----RXKXXGGGGGPXXXLXXGGGGXXXXXGG 305 G GGGP P R GGGGGP G GG GG Sbjct: 77 GPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTGGGNQGQGG 122 >At1g65440.1 68414.m07424 glycine-rich protein Length = 1647 Score = 31.9 bits (69), Expect = 0.90 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXG--GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G G G GGG GG GG + GG Sbjct: 1541 GGGSTGGWGSESGGNKSDGAGSWGSGSGGGGSGGWGNDSGGKKSSEDGG 1589 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -3 Query: 1231 GXGXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRG-XXGGXEXXXGGG 1091 G G G GG GG G G G GG G GG + GG Sbjct: 1568 GGGGSGGWGNDSGGKKSSEDGGFGSGSGGGGSDWGNESGGKKSSADGG 1615 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRG 1127 GG G G G G GGG GGG G Sbjct: 67 GGGGSGNRNGRGGGGGSGGGGGG 89 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGGGR 812 GGGG G G G G GGGR Sbjct: 67 GGGGSGNRNGRGGGGGSGGGGGGR 90 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 1177 GXGGXGXGGGXGGGXRGXXGG 1115 G GG G GGG GGG G GG Sbjct: 269 GGGGCGGGGGCGGGCGGGCGG 289 Score = 31.9 bits (69), Expect = 0.90 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGG 1136 GG G GG G G GGG GGG Sbjct: 271 GGCGGGGGCGGGCGGGCGGG 290 Score = 29.5 bits (63), Expect = 4.8 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRG 1127 GG G GG GG G GG GGG G Sbjct: 269 GGGGCGGGGGCG--GGCGGGCGG 289 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 883 GGGGXXGXTGXGXGAGGXVXGG 818 GGGG G G G G GG GG Sbjct: 269 GGGGCGGGGGCGGGCGGGCGGG 290 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 1131 LXPPPXPPPXPXPP 1172 L PPP PPP P PP Sbjct: 4 LLPPPPPPPPPPPP 17 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 1131 LXPPPXPPPXPXPP 1172 L PPP PPP P PP Sbjct: 5 LPPPPPPPPPPPPP 18 Score = 25.8 bits (54), Expect(2) = 0.92 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 9 PPPPPPPPPP 18 Score = 24.6 bits (51), Expect(2) = 0.92 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 848 PPPRXXPXPPPP 883 PPP P PPPP Sbjct: 6 PPPPPPPPPPPP 17 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXP 1187 P + PP P P P P P PP PP P Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYP-PPPPPSP 79 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 P P PPP P P P P PP P Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPPSP 79 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 816 PPPXTXPPAPXPXPVXPXXPPPP 884 PPP AP P P P PP P Sbjct: 57 PPPNPSQEAPVPSPYPPPPPPSP 79 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +3 Query: 1140 PPXPPPXPXPPXP-PXPXPPXXPXXPXXXPXP 1232 P PPP P P P P PP P P P Sbjct: 54 PTHPPPNPSQEAPVPSPYPPPPPPSPLFTNLP 85 Score = 27.5 bits (58), Expect(2) = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Frame = +2 Query: 812 PPXPXHXXPRPX---PPPRXXPXPPPP 883 P P H P P P P P PPPP Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPP 77 Score = 22.6 bits (46), Expect(2) = 1.1 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 Query: 944 PPXPPPPPXPXXXXXP 991 P PPPPP P P Sbjct: 70 PYPPPPPPSPLFTNLP 85 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 1171 PXPPPPXPPXXPXXPXXXPXPPXL 1242 P PPPP P P P P PP L Sbjct: 347 PSPPPPPPVIQPELPQPQPPPPQL 370 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP L P P P PP P P P P P P Sbjct: 329 PPQPTLPPQLVEPSRVQSPSPPPPPPVIQPELPQPQPPP 367 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 GG GG G GGG GGG G GG GGG Sbjct: 102 GGRRFGGRFGKPGGGGLGGG--GLPGGLGGLGGGG 134 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXP 1193 P PP P PP PP P P PP P P Sbjct: 154 PSSPDLPP--PHFPPEFPPETPTTPPPPPPRP 183 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXP 1163 PP PP P PPP PPP P Sbjct: 161 PPHFPPEFPPETPTTPPP-PPPRP 183 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P P PPP PP P P P PP Sbjct: 154 PSSPDLPPPHFPPEFPPETPTTPPPP 179 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXEXXXGG 1094 G GG G G GGG GGG G G GG Sbjct: 31 GVGGGVGVGIGGGGGGGGGGVWVGGGYNNGG 61 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -3 Query: 1213 GXXGXXGGXGXGGXG----GXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG GG G G G GG GGG GG GGG Sbjct: 70 GHASVGGGHASGGGGHAVEGGGHAGGGGGGHGEEEGGHGIGRGGG 114 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 1225 GXXXGXXGXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G G G GG G G GGG GG GGG Sbjct: 54 GGAHASVGGGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGGG 98 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -3 Query: 1195 GGXGXGGXGGXGXGGGX---GGGXRGXXGGXEXXXGGG 1091 GG GG G GGG GGG GG GGG Sbjct: 62 GGHASGGGGHASVGGGHASGGGGHAVEGGGHAGGGGGG 99 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 5/66 (7%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPP-----PPPXPX 976 PP + P PPP PPPP P PP PP PPP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPP---PPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTY 111 Query: 977 XXXXPP 994 PP Sbjct: 112 IYNSPP 117 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPP---XXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP P + P PPP PPPP P PPPPP Sbjct: 86 PPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPPYVYKSVPRITFIYSSPPPPP 140 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXPL---XPPPXPP-PXPXPPXPP--XPXPPXXPXXPXXXPXP 1232 P P S PP P PPP PP PP PP PP P P P Sbjct: 57 PSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPP 109 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 306 PPXXXXXPPPPXHNXFXGPPPPPXFF 383 PP PPPP + + PPPPP + Sbjct: 99 PPFVYSSPPPPTY-IYNSPPPPPYVY 123 Score = 29.5 bits (63), Expect = 4.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLX---PPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 P P PP P PPP P PP PP P P P P Sbjct: 47 PSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPP 99 Score = 28.7 bits (61), Expect = 8.4 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +3 Query: 1092 PPPXXXSXPPXXP-LXPPPXPPP----XPXPPXPPXPXPPXXP 1205 PPP + PP P + P PPP P PP PP P Sbjct: 78 PPPYIYNSPPRPPYVYKSPPPPPFVYSSPPPPTYIYNSPPPPP 120 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 866 PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P PPPP R PP PPPPP Sbjct: 7 PPPPPPSGFKRYKKKRSKKMDNKEVPPPPPPPPP 40 Score = 24.2 bits (50), Expect(2) = 6.9 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPP 1196 P P P PP P P PP Sbjct: 60 PLPRHYPPPPPPLPPPPP 77 Score = 23.0 bits (47), Expect(2) = 6.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 1137 PPPXPPPXP 1163 PPP PPP P Sbjct: 32 PPPPPPPPP 40 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP-RXXPXPPPPXXXP 895 PP P RP PPP R P PPP P Sbjct: 541 PPLPPPARARPLPPPARARPMPPPARARP 569 Score = 29.5 bits (63), Expect = 4.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 8/49 (16%) Frame = +3 Query: 1119 PXXPLXPP----PXPPPXPXPPXPP----XPXPPXXPXXPXXXPXPXXP 1241 P PL PP P PPP P PP P PP P P P Sbjct: 539 PRPPLPPPARARPLPPPARARPMPPPARARPLPPPARSYDRRPPVPLYP 587 >At2g02070.1 68415.m00143 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 602 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PP PP PPP P PP PP Sbjct: 24 PPNSSAAAPPPPPPHHQAPLPPLEAPP 50 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 7/32 (21%) Frame = +3 Query: 1131 LXPPPXPPPXPXPP-------XPPXPXPPXXP 1205 L PP PPP P PP PP P PP P Sbjct: 41 LPHPPPPPPPPPPPLYFSYFSLPPPPPPPHLP 72 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 7/37 (18%) Frame = +3 Query: 1143 PXPPPXPXPPXPP-------XPXPPXXPXXPXXXPXP 1232 P PPP P PP PP P PP P P P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 29.5 bits (63), Expect = 4.8 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +3 Query: 306 PPXXXXXPPPPXH-NXFXGPPPPP 374 PP PPPP + + F PPPPP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPP 67 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 PPP PP PPP P P PP P Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPP---XPPXPXPPXXPXXPXXXPXPXXP 1241 PPP PP P PPP PP PP PP P P P P Sbjct: 94 PPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQP-PPVTTPPGLLP 145 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 1128 PLXPPPXPP---PXPXPPXPPXPXPPXXPXXPXXXP 1226 PL PPP PP P PP PP P P P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 285 PLXPXFFPPXXXXXP-PPPXHNXFXGPPPPPXFF 383 PL P PP P PPP PPPPP F Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMF 55 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 812 PPXPXHXXPRPXPPPRXXPXPPPPXXXP 895 PP P P PPP PPPP P Sbjct: 26 PPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXPXP 1232 PP P P PPP P P P P P P P Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPPXPP 1181 PL PPP P P PP PP Sbjct: 148 PLPPPPPPMPRRSPPPPP 165 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 P PPPR P P R PP PPPPP Sbjct: 614 PAVNPPPRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPP 657 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 848 PPPRXX-PXPPPPXXXPRXXXXXXXXXXXXXXXPPXPPPPP 967 PP R P PPPP P PP PPPPP Sbjct: 15 PPMRGRVPLPPPP--PPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPP 1181 PPP S P P+ PPP P P P Sbjct: 28 PPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXPPXX-PXXPXXXPXPXXP 1241 P P+ P P P P P P P P P P P P P P Sbjct: 34 PKHKPV-PSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTP 75 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 1110 SXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXPXXXP 1226 S P P P P P P P P P P P P P Sbjct: 41 SPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPPRTP 79 >At3g47400.1 68416.m05154 pectinesterase family protein similar to pectinesterase (EC 3.1.1.11) from Vitis vinifera GI:15081598, Lycopersicon esculentum SP|Q43143 SP|P14280; contains Pfam profile PF01095 pectinesterase Length = 594 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXP 1205 PPP + P P P P P PP P P P Sbjct: 35 PPPWDHNVSPPPETAPSPTPTSSPSTTSPPSPGPVAAP 72 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 1186 GXGGXGGXGXGGGXGGGXRGXXGGXE 1109 G GG GG GGG GGG GG + Sbjct: 96 GGGGIGGDKFGGGGGGGDGNDDGGED 121 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 1204 GXXGGXGXGGXGGXGXGGGXGGGXRGXXGGXEXXXGGG 1091 G GG G GG G G GGG GG G G G Sbjct: 511 GRSGGGGYGGSSG-GYGGGRSGGSSNRYSGDSDRSGFG 547 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPP 1181 P + PP PPP P PP PP Sbjct: 194 PYSAVAIPPQPPPHPPPPPPP 214 Score = 29.5 bits (63), Expect = 4.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1128 PLXPPPXPPPXPXPP 1172 P PPP PPP P PP Sbjct: 201 PPQPPPHPPPPPPPP 215 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 PPP S P P P P P P P P P P Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPPASLPTFP 127 Score = 28.7 bits (61), Expect = 8.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 1149 PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PPP P PP P P P P P P Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPP 118 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -1 Query: 993 GGXXXXXGXGGGGGXGGXXXXXXXXXXXXGXXRGXXXGGGGXGXXRGGGXGRGXXCXGXG 814 GG G G GGG G GG G G GGG G G G G Sbjct: 33 GGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPGYGGGG 92 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPPXXPXXP 1214 P P P + PP P P PP PP PP P P Sbjct: 638 PRPYGQLPPSAMGMMQPP-PMPGMAPPPPPEEAPPPLPEEP 677 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 1116 PPXXPLXPPPXPPPXPXPPXPPXPXP 1193 PP PPP PP PP P P P Sbjct: 641 PPPMAEMPPPPPPGEAPPPLPEEPEP 666 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +3 Query: 1080 AXXXPPPXXXSXPPXXPLX--------PPPXPPPXPXPPXPPXPXP 1193 A PPP + PP PL PP PPP PP P P Sbjct: 221 APLPPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPPPPLP 266 >At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-related similar to glucan endo-1,3-beta-glucosidase precursor SP:P52409 from [Triticum aestivum] Length = 330 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 1095 PPXXXSXPPXXPLXPPPXPPPXPXP-PXPPXPXPPXXPXXPXXXPXP 1232 PP + PP + PP PP P P PP P P P Sbjct: 73 PPPTLTPPPVITIPPPTLTPPVTNPVTNPVTQYPPTQPSGTVPVPVP 119 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 1140 PPXPPPXPXPPXPPXPXP 1193 P PP P PP PP P P Sbjct: 76 PSTAPPPPHPPPPPPPLP 93 Score = 26.2 bits (55), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 836 PRPXPPPRXXPXPPPP 883 P PPP P PPPP Sbjct: 76 PSTAPPPPHPPPPPPP 91 Score = 23.0 bits (47), Expect(2) = 2.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 947 PXPPPPPXP 973 P PPPPP P Sbjct: 85 PPPPPPPLP 93 >At1g18170.1 68414.m02258 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q26486) [Spodoptera frugiperda]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 247 Score = 25.8 bits (54), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 944 PPXPPPPPXP 973 PP PPPPP P Sbjct: 42 PPPPPPPPQP 51 Score = 23.4 bits (48), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 812 PPXPXHXXPRPXPPP 856 PP P P P PPP Sbjct: 34 PPEPESSSPPPPPPP 48 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXP 1187 P PPP PPP P PP P Sbjct: 219 PDFKFSPPPPPPPSPPQSSPPSP 241 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPP 1196 P PPP P PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXP 1205 PP P PP PP PP P Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXP 1162 PP PP PP S PP P Sbjct: 226 PPPPPPSPPQSSPPSP 241 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 1119 PXXPLXPPPXPPPXPXPPXPPXP 1187 P PPP PPP P PP P Sbjct: 219 PDFKFSPPPPPPPSPPQSSPPSP 241 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 1143 PXPPPXPXPPXPPXPXPP 1196 P PPP P PP P PP Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 1152 PPXPXPPXPPXPXPPXXP 1205 PP P PP PP PP P Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 Score = 28.7 bits (61), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1115 PPXXPPXPPXSPPPXP 1162 PP PP PP S PP P Sbjct: 226 PPPPPPSPPQSSPPSP 241 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P P P P P P P P P P P Sbjct: 53 PPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTP 103 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +3 Query: 1092 PPPXXXSXPPXXPLXPPPX-PPPXPXPPXPPXPXPPXXPXXPXXXPXPXXP 1241 PP PP P P P P P P P P P P P P Sbjct: 53 PPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTP 103 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 1098 PXXXSXPPXXPLXPPPXPPPXPXPPXPPXPXPP 1196 P + PP P PP P P P PP PP Sbjct: 30 PGFSAIPPVVPPSFPPPMAPIPMMPHPPVARPP 62 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,663,344 Number of Sequences: 28952 Number of extensions: 504220 Number of successful extensions: 34494 Number of sequences better than 10.0: 349 Number of HSP's better than 10.0 without gapping: 1381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15847 length of database: 12,070,560 effective HSP length: 83 effective length of database: 9,667,544 effective search space used: 3190289520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -