BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J09 (1019 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 58 4e-07 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 58 5e-07 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 56 1e-06 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 56 1e-06 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 56 1e-06 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 56 2e-06 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 56 2e-06 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 56 2e-06 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 56 2e-06 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 56 2e-06 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 55 3e-06 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 55 3e-06 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 55 3e-06 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 54 4e-06 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 54 4e-06 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 54 6e-06 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 54 8e-06 UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein;... 53 1e-05 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 53 1e-05 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 53 1e-05 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 53 1e-05 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 53 1e-05 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 52 2e-05 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 52 2e-05 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 52 2e-05 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 52 3e-05 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 52 3e-05 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 51 4e-05 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 51 4e-05 UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein;... 51 4e-05 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 51 4e-05 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 51 6e-05 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 51 6e-05 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 50 7e-05 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 50 7e-05 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 50 7e-05 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 50 7e-05 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 50 1e-04 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 50 1e-04 UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; ... 50 1e-04 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 50 1e-04 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 50 1e-04 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 50 1e-04 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 50 1e-04 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 50 1e-04 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 50 1e-04 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 50 1e-04 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 49 2e-04 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 49 2e-04 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 49 2e-04 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 49 2e-04 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 49 2e-04 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 49 2e-04 UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary... 49 2e-04 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 49 2e-04 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 49 2e-04 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 49 2e-04 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 49 2e-04 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 48 3e-04 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 48 3e-04 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 48 3e-04 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 48 3e-04 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 48 3e-04 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 48 3e-04 UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17... 48 3e-04 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 48 3e-04 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 48 3e-04 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 48 3e-04 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 48 3e-04 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 48 3e-04 UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - B... 48 4e-04 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 48 4e-04 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 48 4e-04 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 48 4e-04 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 48 4e-04 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 48 4e-04 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 48 4e-04 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 48 4e-04 UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gamb... 48 4e-04 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 48 4e-04 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 48 5e-04 UniRef50_UPI0000DB75B1 Cluster: PREDICTED: similar to One cut do... 48 5e-04 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 48 5e-04 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 48 5e-04 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 48 5e-04 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 48 5e-04 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 48 5e-04 UniRef50_Q2GUA6 Cluster: Predicted protein; n=2; Pezizomycotina|... 48 5e-04 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 48 5e-04 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 48 5e-04 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 48 5e-04 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 47 7e-04 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 47 7e-04 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 47 7e-04 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 47 7e-04 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 47 7e-04 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 47 7e-04 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 47 7e-04 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 47 7e-04 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 47 7e-04 UniRef50_A0EFA7 Cluster: Chromosome undetermined scaffold_93, wh... 47 7e-04 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 47 7e-04 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 47 7e-04 UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium glob... 47 7e-04 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 47 7e-04 UniRef50_UPI00015B5EB5 Cluster: PREDICTED: similar to CG3606-PB;... 47 9e-04 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 47 9e-04 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 47 9e-04 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 47 9e-04 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 47 9e-04 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 47 9e-04 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 47 9e-04 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 47 9e-04 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 46 0.001 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 46 0.001 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 46 0.001 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 46 0.001 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 46 0.001 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 46 0.001 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 46 0.001 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 46 0.001 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 46 0.001 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 46 0.002 UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner a... 46 0.002 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 46 0.002 UniRef50_A3Q834 Cluster: Putative uncharacterized protein precur... 46 0.002 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 46 0.002 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 46 0.002 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 46 0.002 UniRef50_Q2V4A1 Cluster: Uncharacterized protein At2g05440.4; n=... 46 0.002 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 46 0.002 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 46 0.002 UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 46 0.002 UniRef50_A3BDT4 Cluster: Putative uncharacterized protein; n=2; ... 46 0.002 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 46 0.002 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 46 0.002 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 46 0.002 UniRef50_A6S8L3 Cluster: Predicted protein; n=2; Botryotinia fuc... 46 0.002 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 46 0.002 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 46 0.002 UniRef50_Q27294 Cluster: RNA-binding protein cabeza; n=5; Endopt... 46 0.002 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 46 0.002 UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus ... 46 0.002 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Re... 46 0.002 UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: T... 46 0.002 UniRef50_Q2V498 Cluster: Uncharacterized protein At2g05440.7; n=... 46 0.002 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 46 0.002 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 46 0.002 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 46 0.002 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 46 0.002 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 46 0.002 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 46 0.002 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 46 0.002 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 46 0.002 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 46 0.002 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 45 0.003 UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_UPI0000E49516 Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_Q6H3Y0 Cluster: Glycine-rich protein GRP22-like; n=3; O... 45 0.003 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 45 0.003 UniRef50_Q02021 Cluster: Glycine-rich protein; n=3; Eukaryota|Re... 45 0.003 UniRef50_A2YY95 Cluster: Putative uncharacterized protein; n=1; ... 45 0.003 UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.... 45 0.003 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 45 0.003 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 45 0.003 UniRef50_O01900 Cluster: Putative uncharacterized protein; n=2; ... 45 0.003 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 45 0.003 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 45 0.003 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 45 0.003 UniRef50_Q2HDB3 Cluster: Predicted protein; n=1; Chaetomium glob... 45 0.003 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.003 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 45 0.003 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 45 0.003 UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein;... 45 0.004 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 45 0.004 UniRef50_UPI00004D5DA1 Cluster: YLP motif containing protein 1 (... 45 0.004 UniRef50_UPI0000DC2237 Cluster: RIKEN cDNA D030022P06 gene; n=6;... 45 0.004 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 45 0.004 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 45 0.004 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 45 0.004 UniRef50_Q8YTC9 Cluster: All2793 protein; n=3; Bacteria|Rep: All... 45 0.004 UniRef50_Q3KEU2 Cluster: Putative uncharacterized protein precur... 45 0.004 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.004 UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triti... 45 0.004 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 45 0.004 UniRef50_Q0JA80 Cluster: Os04g0612100 protein; n=1; Oryza sativa... 45 0.004 UniRef50_Q0DME4 Cluster: Os03g0813200 protein; n=4; Oryza sativa... 45 0.004 UniRef50_Q015H7 Cluster: Chromosome 07 contig 1, DNA sequence; n... 45 0.004 UniRef50_Q011U7 Cluster: Myc-regulated DEAD/H box 18 RNA helicas... 45 0.004 UniRef50_O65530 Cluster: Putative uncharacterized protein F4D11.... 45 0.004 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 45 0.004 UniRef50_Q5CPV2 Cluster: Large low complexity protein with repea... 45 0.004 UniRef50_A2FA50 Cluster: Proline-rich protein MP-2-related prote... 45 0.004 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 45 0.004 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 45 0.004 UniRef50_Q5KGJ5 Cluster: Putative uncharacterized protein; n=2; ... 45 0.004 UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina... 45 0.004 UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=7... 45 0.004 UniRef50_Q99069 Cluster: Glycine-rich RNA-binding protein 1; n=4... 45 0.004 UniRef50_P23093 Cluster: Circumsporozoite protein precursor; n=3... 45 0.004 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 44 0.005 UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein;... 44 0.005 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 44 0.005 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 44 0.005 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 44 0.005 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 44 0.005 UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=... 44 0.005 UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein;... 44 0.005 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 44 0.005 UniRef50_Q6QNA3 Cluster: Proline-rich protein 1; n=2; Solanaceae... 44 0.005 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 44 0.005 UniRef50_Q69QS1 Cluster: Putative uncharacterized protein P0463D... 44 0.005 UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Ory... 44 0.005 UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n... 44 0.005 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 44 0.005 UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; ... 44 0.005 UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG051... 44 0.005 UniRef50_Q4CNE1 Cluster: Putative uncharacterized protein; n=4; ... 44 0.005 UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=... 44 0.005 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 44 0.005 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 44 0.006 UniRef50_Q90WR5 Cluster: Keratin alpha; n=1; Lampetra fluviatili... 44 0.006 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 44 0.006 UniRef50_A0HB13 Cluster: Putative uncharacterized protein precur... 44 0.006 UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Ara... 44 0.006 UniRef50_Q60E27 Cluster: Putative uncharacterized protein OSJNBb... 44 0.006 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 44 0.006 UniRef50_Q0J6R0 Cluster: Os08g0280200 protein; n=2; Oryza sativa... 44 0.006 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 44 0.006 UniRef50_A7RV64 Cluster: Predicted protein; n=2; Nematostella ve... 44 0.006 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 44 0.006 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 44 0.006 UniRef50_P17816 Cluster: Glycine-rich cell wall structural prote... 44 0.006 UniRef50_UPI0000E4A916 Cluster: PREDICTED: hypothetical protein;... 44 0.008 UniRef50_UPI0000DB7674 Cluster: PREDICTED: hypothetical protein;... 44 0.008 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 44 0.008 UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; ... 44 0.008 UniRef50_Q2IIP5 Cluster: Putative uncharacterized protein; n=1; ... 44 0.008 UniRef50_Q0LCI7 Cluster: Putative uncharacterized protein; n=1; ... 44 0.008 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 44 0.008 UniRef50_A5WD13 Cluster: Putative uncharacterized protein precur... 44 0.008 UniRef50_A3ZRC6 Cluster: Putative uncharacterized protein; n=2; ... 44 0.008 UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R... 44 0.008 UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structu... 44 0.008 UniRef50_Q6AV07 Cluster: Putative uncharacterized protein OJ1354... 44 0.008 UniRef50_Q01A68 Cluster: Chromosome 04 contig 1, DNA sequence; n... 44 0.008 UniRef50_Q9VNX6 Cluster: CG7421-PA, isoform A; n=3; Drosophila m... 44 0.008 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 44 0.008 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 44 0.008 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 44 0.008 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 44 0.008 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 44 0.008 UniRef50_Q9C0D6 Cluster: KIAA1727 protein; n=13; Tetrapoda|Rep: ... 44 0.008 UniRef50_A7ESG8 Cluster: Putative uncharacterized protein; n=1; ... 44 0.008 UniRef50_A4UCN1 Cluster: Predicted protein; n=1; Magnaporthe gri... 44 0.008 UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein p... 44 0.008 UniRef50_P35908 Cluster: Keratin, type II cytoskeletal 2 epiderm... 44 0.008 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 44 0.008 UniRef50_P10496 Cluster: Glycine-rich cell wall structural prote... 44 0.008 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 44 0.008 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 44 0.008 UniRef50_UPI0000DA4780 Cluster: PREDICTED: hypothetical protein;... 43 0.011 UniRef50_UPI0000D8E03E Cluster: WAS/WASL interacting protein fam... 43 0.011 UniRef50_Q5XGY6 Cluster: LOC495114 protein; n=3; Euteleostomi|Re... 43 0.011 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 43 0.011 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 43 0.011 UniRef50_Q92NU7 Cluster: PUTATIVE GLYCINE-RICH PROTEIN; n=4; Sin... 43 0.011 UniRef50_A4FBY5 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 43 0.011 UniRef50_A0YZF2 Cluster: Putative uncharacterized protein; n=2; ... 43 0.011 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 43 0.011 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 43 0.011 UniRef50_Q8RUS0 Cluster: Putative uncharacterized protein At2g18... 43 0.011 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 43 0.011 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 43 0.011 UniRef50_Q01L28 Cluster: OSIGBa0147J02.2 protein; n=7; Oryza sat... 43 0.011 UniRef50_O22015 Cluster: HEP200 protein; n=2; Cylindrotheca fusi... 43 0.011 UniRef50_A4S0A2 Cluster: Predicted protein; n=1; Ostreococcus lu... 43 0.011 UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep: CG5... 43 0.011 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_Q16G29 Cluster: Putative uncharacterized protein; n=2; ... 43 0.011 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 43 0.011 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 43 0.011 UniRef50_Q4PDN5 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_A5DUM3 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_P41479 Cluster: Uncharacterized 24.1 kDa protein in LEF... 43 0.011 UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Euka... 43 0.011 UniRef50_Q03250 Cluster: Glycine-rich RNA-binding protein 7; n=1... 43 0.011 UniRef50_P27483 Cluster: Glycine-rich cell wall structural prote... 43 0.011 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 43 0.011 UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing f... 43 0.015 UniRef50_UPI0001555AD6 Cluster: PREDICTED: similar to Glyceralde... 43 0.015 UniRef50_UPI0000F2DE72 Cluster: PREDICTED: hypothetical protein;... 43 0.015 UniRef50_UPI0000E7FEEA Cluster: PREDICTED: similar to desmoglein... 43 0.015 UniRef50_UPI0000E47947 Cluster: PREDICTED: similar to GA10247-PA... 43 0.015 UniRef50_UPI0000DB79A3 Cluster: PREDICTED: similar to CG32423-PB... 43 0.015 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 43 0.015 UniRef50_Q9PF60 Cluster: Endo-1,4-beta-glucanase; n=7; Xanthomon... 43 0.015 UniRef50_Q825Z2 Cluster: Putative proline-rich protein; n=2; Str... 43 0.015 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 43 0.015 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 43 0.015 UniRef50_Q099E7 Cluster: Putative uncharacterized protein; n=1; ... 43 0.015 UniRef50_A1SL00 Cluster: Putative uncharacterized protein precur... 43 0.015 UniRef50_Q38M49 Cluster: Putative glycine-rich RNA binding prote... 43 0.015 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 43 0.015 UniRef50_A4S292 Cluster: Predicted protein; n=1; Ostreococcus lu... 43 0.015 UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=... 43 0.015 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 43 0.015 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 43 0.015 UniRef50_A7SIG7 Cluster: Predicted protein; n=1; Nematostella ve... 43 0.015 UniRef50_A1Z8H7 Cluster: CG13214-PA, isoform A; n=5; Eukaryota|R... 43 0.015 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 43 0.015 UniRef50_A1CLV3 Cluster: Putative uncharacterized protein; n=2; ... 43 0.015 UniRef50_Q5T8P6 Cluster: RNA-binding protein 26; n=31; Euteleost... 43 0.015 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 43 0.015 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 43 0.015 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 43 0.015 UniRef50_UPI0000F2E6AE Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_UPI0000F2BBA8 Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 42 0.019 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_UPI0000D5579B Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_Q4T4H8 Cluster: Chromosome 2 SCAF9640, whole genome sho... 42 0.019 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 42 0.019 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 42 0.019 UniRef50_Q4A2G4 Cluster: Putative membrane protein precursor; n=... 42 0.019 UniRef50_Q1HH11 Cluster: Desmoplakin; n=1; Antheraea pernyi nucl... 42 0.019 UniRef50_Q7UQA9 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_Q3VHV4 Cluster: Protein kinase; n=2; Pelodictyon phaeoc... 42 0.019 UniRef50_Q2CA03 Cluster: Phosphoribosylformylglycinamidine synth... 42 0.019 UniRef50_Q13UU1 Cluster: Putative lipoprotein; n=2; Burkholderia... 42 0.019 UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Ca... 42 0.019 UniRef50_A0VCM8 Cluster: Putative uncharacterized protein precur... 42 0.019 UniRef50_Q69T79 Cluster: Putative glycine-rich cell wall structu... 42 0.019 UniRef50_Q2QR52 Cluster: Transposon protein, putative, CACTA, En... 42 0.019 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 42 0.019 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_A5BK18 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_A3AXB6 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster... 42 0.019 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_Q57WJ7 Cluster: Calpain, putative; n=3; Trypanosoma bru... 42 0.019 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 42 0.019 UniRef50_Q4XND7 Cluster: Putative uncharacterized protein; n=1; ... 42 0.019 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 42 0.019 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 42 0.019 UniRef50_A6RH13 Cluster: Predicted protein; n=2; Onygenales|Rep:... 42 0.019 UniRef50_P42858 Cluster: Huntingtin; n=29; Eumetazoa|Rep: Huntin... 42 0.019 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 42 0.019 UniRef50_P10323 Cluster: Acrosin precursor (EC 3.4.21.10) [Conta... 42 0.019 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 42 0.026 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 42 0.026 UniRef50_UPI0000F2CBCD Cluster: PREDICTED: hypothetical protein;... 42 0.026 UniRef50_UPI0000E4626F Cluster: PREDICTED: similar to heterogene... 42 0.026 UniRef50_UPI0000DB6EF9 Cluster: PREDICTED: hypothetical protein;... 42 0.026 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 42 0.026 UniRef50_Q66J90 Cluster: MGC81602 protein; n=3; Xenopus|Rep: MGC... 42 0.026 UniRef50_Q4A371 Cluster: Putative membrane protein precursor; n=... 42 0.026 UniRef50_Q89KP2 Cluster: Bll4862 protein; n=4; Bradyrhizobiaceae... 42 0.026 UniRef50_Q1IUZ9 Cluster: Putative uncharacterized protein precur... 42 0.026 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 42 0.026 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 42 0.026 UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyled... 42 0.026 UniRef50_Q8S9B5 Cluster: Matrix metalloproteinase; n=1; Volvox c... 42 0.026 UniRef50_Q8H776 Cluster: Putative uncharacterized protein; n=1; ... 42 0.026 UniRef50_O65450 Cluster: Glycine-rich protein; n=1; Arabidopsis ... 42 0.026 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 42 0.026 UniRef50_A2YML9 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_A2Y4N1 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_A2X327 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_Q9BIJ0 Cluster: Putative RNA-binding protein; n=1; Pate... 42 0.026 UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gamb... 42 0.026 UniRef50_Q6NMX2 Cluster: RE20733p; n=1; Drosophila melanogaster|... 42 0.026 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 42 0.026 UniRef50_O45522 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_A7RQB8 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.026 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 42 0.026 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 42 0.026 UniRef50_Q6FT22 Cluster: Candida glabrata strain CBS138 chromoso... 42 0.026 UniRef50_Q6C5H5 Cluster: Similarity; n=4; Eukaryota|Rep: Similar... 42 0.026 UniRef50_Q2GSQ8 Cluster: Putative uncharacterized protein; n=2; ... 42 0.026 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 42 0.026 UniRef50_A4QQZ5 Cluster: Predicted protein; n=1; Magnaporthe gri... 42 0.026 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 42 0.026 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 42 0.026 UniRef50_Q92558 Cluster: Wiskott-Aldrich syndrome protein family... 42 0.026 UniRef50_Q96S59 Cluster: Ran-binding protein 9; n=51; Euteleosto... 42 0.026 UniRef50_Q92794 Cluster: Histone acetyltransferase MYST3; n=28; ... 42 0.026 UniRef50_P0C5C7 Cluster: Glycine-rich cell wall structural prote... 42 0.026 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 42 0.034 UniRef50_UPI00015B5BCF Cluster: PREDICTED: similar to FTP3; n=1;... 42 0.034 UniRef50_UPI0000F2EA00 Cluster: PREDICTED: similar to Jmy-pendin... 42 0.034 UniRef50_UPI0000F2123D Cluster: PREDICTED: hypothetical protein;... 42 0.034 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 42 0.034 UniRef50_UPI0000E46B62 Cluster: PREDICTED: hypothetical protein;... 42 0.034 UniRef50_UPI0000DB6D77 Cluster: PREDICTED: similar to CG5913-PA;... 42 0.034 UniRef50_UPI0000D57944 Cluster: PREDICTED: hypothetical protein;... 42 0.034 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 42 0.034 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 42 0.034 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 42 0.034 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 42 0.034 UniRef50_O73808 Cluster: Putative uncharacterized protein; n=2; ... 42 0.034 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 42 0.034 UniRef50_Q2JEI9 Cluster: Putative uncharacterized protein; n=1; ... 42 0.034 UniRef50_Q1IRK4 Cluster: Putative GAF sensor protein; n=2; cellu... 42 0.034 UniRef50_A2SK16 Cluster: Putative uncharacterized protein; n=1; ... 42 0.034 UniRef50_A1TJK5 Cluster: Putative uncharacterized protein; n=4; ... 42 0.034 UniRef50_Q9SFY8 Cluster: T22C5.16; n=2; Arabidopsis thaliana|Rep... 42 0.034 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 42 0.034 UniRef50_Q9LQZ8 Cluster: F10A5.23; n=1; Arabidopsis thaliana|Rep... 42 0.034 UniRef50_Q7XJP7 Cluster: At2g37830 protein; n=14; Eukaryota|Rep:... 42 0.034 UniRef50_Q3ECN0 Cluster: Uncharacterized protein At1g56530.1; n=... 42 0.034 UniRef50_Q3E939 Cluster: Uncharacterized protein At5g26080.1; n=... 42 0.034 UniRef50_Q1G2Y1 Cluster: Chloroplast polyribonucleotide phosphor... 42 0.034 UniRef50_Q0DLG0 Cluster: Os05g0104000 protein; n=9; Oryza sativa... 42 0.034 UniRef50_Q9VX67 Cluster: CG5172-PA, isoform A; n=2; Drosophila m... 42 0.034 UniRef50_Q9VC76 Cluster: CG13615-PA; n=2; Sophophora|Rep: CG1361... 42 0.034 UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma j... 42 0.034 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 42 0.034 UniRef50_O02402 Cluster: Insoluble protein; n=1; Pinctada fucata... 42 0.034 UniRef50_O02049 Cluster: Putative uncharacterized protein; n=2; ... 42 0.034 UniRef50_A7SMB3 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.034 UniRef50_A7SEJ5 Cluster: Predicted protein; n=2; Nematostella ve... 42 0.034 UniRef50_A7RFM3 Cluster: Predicted protein; n=1; Nematostella ve... 42 0.034 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 42 0.034 UniRef50_O60354 Cluster: Loricrin; n=3; Euarchontoglires|Rep: Lo... 42 0.034 UniRef50_Q2HH46 Cluster: Putative uncharacterized protein; n=2; ... 42 0.034 UniRef50_Q2HCX6 Cluster: Putative uncharacterized protein; n=3; ... 42 0.034 UniRef50_A4R6T5 Cluster: Predicted protein; n=1; Magnaporthe gri... 42 0.034 UniRef50_Q15428 Cluster: Splicing factor 3A subunit 2; n=69; Euk... 42 0.034 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 42 0.034 UniRef50_P23490 Cluster: Loricrin; n=15; cellular organisms|Rep:... 42 0.034 UniRef50_Q6EIY9 Cluster: Keratin, type II cytoskeletal 1; n=6; A... 42 0.034 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 42 0.034 UniRef50_UPI0001553978 Cluster: PREDICTED: hypothetical protein;... 41 0.045 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 41 0.045 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 41 0.045 UniRef50_UPI0000E48D03 Cluster: PREDICTED: hypothetical protein,... 41 0.045 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 41 0.045 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 41 0.045 UniRef50_UPI000069F4A9 Cluster: UPI000069F4A9 related cluster; n... 41 0.045 UniRef50_Q4T6G3 Cluster: Chromosome undetermined SCAF8768, whole... 41 0.045 UniRef50_Q8JKT0 Cluster: Orf31; n=1; Heliothis zea virus 1|Rep: ... 41 0.045 UniRef50_Q98DS7 Cluster: Glycine-rich cell wall protein; n=1; Me... 41 0.045 UniRef50_Q6N0Q5 Cluster: Putative uncharacterized protein precur... 41 0.045 UniRef50_Q46SE8 Cluster: Putative uncharacterized protein; n=6; ... 41 0.045 UniRef50_Q9XDH2 Cluster: Proline-rich mucin homolog; n=2; Mycoba... 41 0.045 UniRef50_Q02AB7 Cluster: RNP-1 like RNA-binding protein; n=2; ce... 41 0.045 UniRef50_A7H6P0 Cluster: TonB family protein precursor; n=1; Ana... 41 0.045 UniRef50_A1W8T6 Cluster: Nuclease; n=1; Acidovorax sp. JS42|Rep:... 41 0.045 UniRef50_A0ZCQ3 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_A0HCD4 Cluster: TonB family protein; n=2; Comamonadacea... 41 0.045 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 41 0.045 UniRef50_Q9M0B4 Cluster: Glycine-rich protein; n=6; Magnoliophyt... 41 0.045 UniRef50_Q9FM47 Cluster: Similarity to RNA binding protein; n=5;... 41 0.045 UniRef50_Q8S9B6 Cluster: PR-1 like protein; n=1; Volvox carteri ... 41 0.045 UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnolio... 41 0.045 UniRef50_Q5QN41 Cluster: Phytocyanin protein-like; n=3; Oryza sa... 41 0.045 UniRef50_Q4U2V9 Cluster: Hydroxyproline-rich glycoprotein GAS30 ... 41 0.045 UniRef50_A5B829 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_A3B5V0 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_Q9W4V1 Cluster: CG3588-PB, isoform B; n=20; melanogaste... 41 0.045 UniRef50_Q9VZC0 Cluster: CG11345-PA; n=1; Drosophila melanogaste... 41 0.045 UniRef50_Q7QFC2 Cluster: ENSANGP00000007476; n=1; Anopheles gamb... 41 0.045 UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putati... 41 0.045 UniRef50_Q4QDL1 Cluster: Fibrillarin, putative; n=3; Leishmania|... 41 0.045 UniRef50_O96853 Cluster: ORF 1; n=1; Schistosoma haematobium|Rep... 41 0.045 UniRef50_Q6KFY0 Cluster: Transcription factor Skn7; n=2; Candida... 41 0.045 UniRef50_Q6FTP1 Cluster: Similar to sp|P37370 Saccharomyces cere... 41 0.045 UniRef50_Q4P459 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 41 0.045 UniRef50_A1DF14 Cluster: Cell wall protein, putative; n=2; Trich... 41 0.045 UniRef50_Q01851 Cluster: POU domain, class 4, transcription fact... 41 0.045 UniRef50_Q9QYX7 Cluster: Protein piccolo; n=22; cellular organis... 41 0.045 UniRef50_P35637 Cluster: RNA-binding protein FUS; n=43; Euteleos... 41 0.045 UniRef50_P22087 Cluster: rRNA 2'-O-methyltransferase fibrillarin... 41 0.045 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 41 0.045 UniRef50_Q9S740 Cluster: Lysine-rich arabinogalactan protein 19 ... 41 0.045 UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-bindi... 41 0.045 UniRef50_UPI00015B52EC Cluster: PREDICTED: similar to ENSANGP000... 41 0.059 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 41 0.059 UniRef50_UPI0000E7FB87 Cluster: PREDICTED: similar to class IV P... 41 0.059 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 41 0.059 UniRef50_UPI0000E4931A Cluster: PREDICTED: hypothetical protein;... 41 0.059 UniRef50_UPI0000E464D4 Cluster: PREDICTED: similar to ENSANGP000... 41 0.059 UniRef50_UPI0000DC00C7 Cluster: UPI0000DC00C7 related cluster; n... 41 0.059 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 41 0.059 UniRef50_Q8R2W2 Cluster: BC053440 protein; n=17; Eutheria|Rep: B... 41 0.059 UniRef50_Q3M5H7 Cluster: VCBS; n=2; Bacteria|Rep: VCBS - Anabaen... 41 0.059 UniRef50_A6GG77 Cluster: Putative uncharacterized protein; n=1; ... 41 0.059 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 58.0 bits (134), Expect = 4e-07 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPP 271 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P PPP P Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSP 277 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P PPP P Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 223 PSPPPPP--PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P P PP PPP PP Sbjct: 211 PPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 224 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PPPP P P P P P P Sbjct: 240 PPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFP 283 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P S PPPP P P PP PPP PP Sbjct: 207 PVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S PPPPPP P PP PP PP PP PP Sbjct: 221 ASPSPPPPPP--PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAP 824 S PPPPPPP P PP PP +P Sbjct: 242 SPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSP 277 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 743 PXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P P PP PPP PP Sbjct: 199 PGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPP 238 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 57.6 bits (133), Expect = 5e-07 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 56.4 bits (130), Expect = 1e-06 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP +P P PP PPP PP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITP 541 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PP P P PP PPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPP P P PP PPP P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P+ P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIP 548 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP P PP PP PP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP P PP PP PP Sbjct: 485 SPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 56.4 bits (130), Expect = 1e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 53.6 bits (123), Expect = 8e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPPA PP Sbjct: 1409 PPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP P PP PP PP PP PP Sbjct: 1407 TAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 743 PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P P PP PPP PP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 56.4 bits (130), Expect = 1e-06 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP +P P PP PPP PP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 56.0 bits (129), Expect = 1e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 56.0 bits (129), Expect = 1e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 677 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 652 PPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPP 706 Score = 55.2 bits (127), Expect = 3e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PPLPP PP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS PPPP P P PP PPP PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 53.6 bits (123), Expect = 8e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PPPP P P PP PPP PP Sbjct: 663 PPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 212 PSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP PPP PP Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP PPP PP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP P Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP+ PP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP P P PP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP PPP PP Sbjct: 238 PPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 239 PLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPP 694 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPP----PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P P PPPP P P PP PPP PP Sbjct: 215 PPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PPPP P P PP PPP PP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP PP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 48.4 bits (110), Expect = 3e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P P P LPP Sbjct: 682 PPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 679 PPPPPPP-----PPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P P PPP+ P Sbjct: 670 PPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVP 714 Score = 40.7 bits (91), Expect = 0.059 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P PP PP PP PP PP Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 283 PPPPPPPPPPPPPPPPP 299 Score = 40.3 bits (90), Expect = 0.078 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP PP PP PP Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 283 PPPPPPPPPPPPPPPPPP 300 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPPPPPP P PP PP P LPP Sbjct: 678 SPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 37.1 bits (82), Expect = 0.73 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 4/81 (4%) Frame = +3 Query: 720 SXPPPPP----PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXX 887 S PPPPP PP P PP PP PP PP PP Sbjct: 213 SPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Query: 888 XXXXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPP 293 Score = 36.7 bits (81), Expect = 0.96 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 4/82 (4%) Frame = +3 Query: 717 SSXPPPP----PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXX 884 S PPPP PPP P PP PP PP PP PP Sbjct: 213 SPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Query: 885 XXXXXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPP 294 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 56.0 bits (129), Expect = 1e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 54.4 bits (125), Expect = 4e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PPPP P P PP PPP PP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP P Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP PPP PP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P PPP PP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 52.4 bits (120), Expect = 2e-05 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 205 PPPPPPP----PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P PPP PP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPP 275 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PPPP P P PP P P+ PP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 50.8 bits (116), Expect = 6e-05 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP+ PP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 50.4 bits (115), Expect = 7e-05 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP +P P P PPP PP Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Score = 50.4 bits (115), Expect = 7e-05 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PS PPPP +P P PP PPPA P Sbjct: 248 PPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP-PPSPPPAPPPFVP 291 Score = 50.0 bits (114), Expect = 1e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP+ PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP-PPPSPSPPPP 267 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P PP PPP PP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPP 266 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP PPP P Sbjct: 242 PPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRP---PLPPPAXXXXPP 859 PPPPPP P P PS PPPP +P P P P PPP PP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPPPPP P PP PP PP PP P Sbjct: 216 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP +PP PP PP Sbjct: 240 SPPPPPPPP-PPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP P PP PP Sbjct: 228 SPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPP 274 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 216 SPPPPPPPPP--PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLP 836 S PPPPPP P PP PP PPF+P Sbjct: 252 SPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVP 291 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 740 PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P P PP PPP+ PP Sbjct: 196 PQNIVVEPQPP-PPPPPPPPPSPPPPPPPPPPPSPPPPPP 234 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P PPLPPP P Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P PP PPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP PP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PLP + PP Sbjct: 259 PPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPP 303 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 737 PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P P PP PPP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P P PP PPP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P P PP PPP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P P PP PPP PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P PP Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPPP P PP P PP PP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 48.0 bits (109), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP P P PP PPP PP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 726 PPP--PPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPP PPPP P PP PP PP PP PP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS PPPP P P PP PPP PP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 53.2 bits (122), Expect = 1e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP +P P PP PPP PP Sbjct: 224 PSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP PPP PP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P P PP PPP PP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP PPP PP Sbjct: 257 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PP P P PP PPP PP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 50.4 bits (115), Expect = 7e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP PPP PP Sbjct: 223 PPSPPPP-PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPP +P P PP PPP PP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP PP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PP P P P PP PPP PP Sbjct: 229 PPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPP P P PP PPP PP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P P PPP PP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PPPP P P PP PPP PP Sbjct: 246 PPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P PP PPP PP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 46.8 bits (106), Expect = 9e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P P PP+ P Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P PPPP P PP PPP PP Sbjct: 247 PSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 252 SPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P PPP P P P PP PPP PP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPP 262 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 237 SPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP--PPPSPPPP 280 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P S PPPP P P PP PPP+ PP Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPP 254 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP PP PP Sbjct: 233 SPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP PP PP Sbjct: 248 SPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P P P PP P P PP PPP+ PP Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPP-PPSPPPSPPPPPP 258 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPPP P PP PP PP PP P Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 37.5 bits (83), Expect = 0.55 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPPPPP P PP P PP PP PP Sbjct: 225 SPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 285 PPPPPPPPPPPPPPPPP 301 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP P PP PP PP Sbjct: 220 SPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPP 279 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 280 PPPPPPPPPPPPPPPPPP 297 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P P Sbjct: 273 PPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP L PPA P Sbjct: 286 PPPPPPP----PPPPPPPPPPVYPDQCSVCIVAKLQPPAIDVRP 325 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 52.4 bits (120), Expect = 2e-05 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P P PP PPP+ Sbjct: 71 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PP PPP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP P P PPPP P P PP PPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PP PPP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P PPPP P P PP PPP PP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 729 PPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PP PPP P PP PP PP PP PP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 55.6 bits (128), Expect = 2e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 6 SLTPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR 820 PPPPPPP P P PPPP P P R Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRR 60 Score = 37.9 bits (84), Expect = 0.42 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA 799 PPPPPPP P P PPPP A Sbjct: 37 PPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPR 840 P P PP PPP PPPP PR Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPR 59 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 55.2 bits (127), Expect = 3e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PS PPPP P P PP PPP P Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP PPP PP Sbjct: 420 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP P P PP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 480 Score = 54.4 bits (125), Expect = 4e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 273 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP-PPSPPPPPPPSPP 316 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 246 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 290 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 342 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P PS PPPP P P PP PPP P Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 300 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PS PPPP P P P PPP+ PP Sbjct: 291 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPP 335 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P P PPP+ P Sbjct: 330 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 374 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P P PPP+ P Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 418 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPPP P P PP PPP PP Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P P PPP+ P Sbjct: 444 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P P PPP+ P Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP P P PP Sbjct: 265 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 309 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP P P PP Sbjct: 322 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 366 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP P P PP Sbjct: 366 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 410 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP P P PP Sbjct: 480 PPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 524 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PS PPPP P P PP PPP PP Sbjct: 239 PPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP-PPSPPPPPPPSPP 282 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PS PPPP P P PP PPP P Sbjct: 281 PPPPPPPSPPPPPPPS-PPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P +P PP PPP PP Sbjct: 338 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 383 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P +P PP PPP PP Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 497 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P +P PP PPP PP Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 541 Score = 50.8 bits (116), Expect = 6e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP P P PP Sbjct: 382 PPPPPPPSPPPPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPP 425 Score = 50.4 bits (115), Expect = 7e-05 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP +P P P PPP PP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP P P PP PPP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 266 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP P P PP PPP P Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P PP PPP PP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P P PPPP P P PP PPP P Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P PP PPP PP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P PPPP P P PP PPP P Sbjct: 505 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 548 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P PP PPP PP Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 277 Score = 49.6 bits (113), Expect = 1e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P P P PP PPP PP Sbjct: 247 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 49.6 bits (113), Expect = 1e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PS PP PP P P PP PPP PP Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP P P PP Sbjct: 332 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 376 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 350 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP P P PP Sbjct: 376 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 420 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP P P PP Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 430 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP PP Sbjct: 396 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP PP Sbjct: 401 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP PPP PP Sbjct: 425 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP P P PP Sbjct: 446 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 490 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 464 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP P P PP Sbjct: 490 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 534 Score = 49.2 bits (112), Expect = 2e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP+ PP Sbjct: 251 PPPSPPPPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPSPPPPPP 294 Score = 49.2 bits (112), Expect = 2e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP+ PP Sbjct: 308 PPPPPPSPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPSPPPPPP 351 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPPP P P PP PPP P Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPPP P P PP PPP P Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPPP P P PP PPP P Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P P P PPP+ PP Sbjct: 234 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 278 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPPP P P PP PPP PP Sbjct: 222 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPP-PPSPPPPPPPSPP 264 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 293 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P +P PP PPP PP Sbjct: 387 PPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 432 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 391 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 437 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP PP Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 546 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PPP PPP P P PPPP +P P PP PPP PP Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P +P PP PPP PP Sbjct: 334 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P P PPP+ PP Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 433 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P +P PP PPP PP Sbjct: 448 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P P PPP+ PP Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP PPP P Sbjct: 205 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP PPP P Sbjct: 210 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP P PP PPP P Sbjct: 285 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 328 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P PP P P PP Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 332 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP +P P P PPP PP Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 357 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P P PPP+ PP Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 379 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP +P P P PPP PP Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 401 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP +P P P PPP PP Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P P PP P P PP PPP P Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P P PPP+ PP Sbjct: 449 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 493 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP +P P P PPP PP Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 515 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P PP P P P PPP+ PP Sbjct: 498 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 542 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP PPP P Sbjct: 510 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 553 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP P P PP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P PP PPP PP Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPP 259 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P PP P P PP P P PP Sbjct: 283 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 327 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP P P PP Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 371 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP P P PP Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 415 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP P P PP PPP+ PP Sbjct: 423 PPPPSPPPPPPPSPP-PPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP P P PP Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 485 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP P P PP Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP P P PP Sbjct: 513 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPPPPSPP 246 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP P P PP Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPP P P P PPP+ PP Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPP P P PP PP PP Sbjct: 227 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 271 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP P P PP Sbjct: 278 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPP P P PP PP PP Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 323 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP+ PP Sbjct: 352 PSPPPPSPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPSPPPPPP 395 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPP P PP PPP+ PP Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP+ PP Sbjct: 406 PSPPPPSPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPSPPPPPP 449 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP+ PP Sbjct: 466 PSPPPPSPPPPSPPPPSPPPP-SPPPPPPPSPPPPPPPSPPPPPP 509 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP P P PP Sbjct: 508 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 552 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPP P +P PP PPP PP Sbjct: 197 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P P PPPP P PP PPP P Sbjct: 325 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 367 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P P PPPP P PP PPP P Sbjct: 369 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 411 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P P PPPP P PP PPP P Sbjct: 483 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P P PP P P PP P P PP Sbjct: 232 PPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 275 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P PP PPP P Sbjct: 515 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPP P PP PPP+ P Sbjct: 207 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P PP PP +PP PP PP Sbjct: 221 SPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 280 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 281 PPPPPPPSPPPPPPPSP 297 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP +PP PP PP Sbjct: 296 SPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341 Score = 41.1 bits (92), Expect = 0.045 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP +PP PP PP Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 477 SPPPPSPPPPSPPPPPPP 494 Score = 39.1 bits (87), Expect = 0.18 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXX 890 S PPPP PPP P PP PP PP PP PP Sbjct: 280 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 339 Query: 891 XXXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 340 PPPPPSPPPPPPPSPPPPSP 359 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPP P PP PP +PP PP PP Sbjct: 389 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPP 432 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PPP P PP PP +PP PP PP Sbjct: 451 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 499 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPPPPP P PP P PP PP PP Sbjct: 288 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 348 PPPPPSPPPPSPPPPSP 364 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/77 (27%), Positives = 22/77 (28%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P P PP +PP PP PP Sbjct: 402 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 462 PPPPPSPPPPSPPPPSP 478 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP +PP P PP Sbjct: 319 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 379 PPSPPPPPPPSPPPPPPP 396 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP +PP P PP Sbjct: 363 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS 422 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 423 PPPPSPPPPPPPSPPPPP 440 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPP P PP PP PP PP P Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 504 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP P PP Sbjct: 262 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP P PP Sbjct: 477 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP P P PP PP +PP P PP Sbjct: 487 SPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP PP PP PP Sbjct: 206 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP PP PP PP Sbjct: 211 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP PP PP PP Sbjct: 231 SPPPPSPPPP-PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 289 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 290 PPPPPPSPPPPSPPPPSP 307 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP PP PP PP Sbjct: 511 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 36.7 bits (81), Expect = 0.96 Identities = 22/79 (27%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +3 Query: 717 SSXPPPPPPP-XXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXX 893 S PP PPPP P PP PP +PP PP PP Sbjct: 201 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 260 Query: 894 XXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 261 PSPPPPSPPPPSPPPPPPP 279 Score = 36.7 bits (81), Expect = 0.96 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P PP PP PP PP PP Sbjct: 216 SPPPPSPPP---PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPS 272 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 273 PPPPPPPSPPPPPPPSP 289 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP PP PP PP Sbjct: 267 SPPPPSPPP--PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 310 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP PP PP PP Sbjct: 402 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 36.3 bits (80), Expect = 1.3 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP +PP PP PP Sbjct: 358 SPPPPSPPPP---SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 415 PPSPPPPSPPPPSPPPPP 432 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PPP P PP PP +PP PP PP Sbjct: 495 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPP 541 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP PP PP Sbjct: 412 SPPPPSPPPP---SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 455 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PPP P P PP +PP PP PP Sbjct: 459 SPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 507 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP PP PP PP Sbjct: 467 SPPPPSPPPPSPPPP----SPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPPS P PP Sbjct: 528 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PS PPPP P P PP P P PP Sbjct: 183 PISTPGIPSPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPP 224 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P PP PP PP PP Sbjct: 191 SPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPP 235 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPPP-XXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP PP PP Sbjct: 196 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPP 241 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 54.8 bits (126), Expect = 3e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPP P P PPPP P P PP PPP PP Sbjct: 202 FPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 54.4 bits (125), Expect = 4e-06 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP+ PP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPPPSP--PPPPPPSPPPPPP 257 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PP PP Sbjct: 2681 PPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPP 2725 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP P P PP Sbjct: 2705 PPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2749 Score = 49.2 bits (112), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P P PPPP P P PP PPP Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P PP PPP PP Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPP 253 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PS PP PP P P PP PPP PP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PPP P P PP PPP PP Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PPPP P P PP P P PP Sbjct: 2270 PSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PPP PPP P P PPPP P P PP PPP+ PP Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPP 2579 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P PP P P PP Sbjct: 2529 PPSPPPPSPPPSPPPS-PPPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P P P PP P P PP PPP P Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PPLPPP PP Sbjct: 1172 PPSPPPPPS---PPPPSPPPPPSPPPPSPP--PPLPPPPSPPPPP 1211 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPP P P PP P P PP Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2715 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PPPP P P PP P P PP Sbjct: 2676 PPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PPPP P P PP P P PP Sbjct: 2700 PPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2744 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PPPP P P PP P P PP Sbjct: 2710 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2754 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 2715 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2759 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PPPP P P PP PP PP Sbjct: 2686 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP 2730 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P +P PP PPP+ P Sbjct: 2677 PPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSP 2722 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPP 2769 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP PP P P+ PP P +P PP PPP P Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPP 2320 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PPP P P PP P P PP Sbjct: 2689 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PPP P P PP P P PP Sbjct: 2694 PPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2739 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP AP P PP PP P Sbjct: 2740 PSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPP 2783 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPP P P P PP PPP+ P Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSP 2302 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPP PPP P P P PP P P PPLPP P+ PP Sbjct: 2728 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPLPPAPSPPPSPP 2772 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP +P P PP PP PP Sbjct: 2264 PPSPPPP---SPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P PPP +P PP PPP P Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPP 2711 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PS PP PP P P P PPP+ PP Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 2718 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P+ PP P P P PP PP PP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPP 2310 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PPP PPP P P P PPP P P PP PPP+ PP Sbjct: 2541 PPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P P PP P P PP P P PP Sbjct: 2667 PPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPP 2710 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPP +P PP PPP P Sbjct: 2693 PPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PP P +P PP PPP P Sbjct: 2698 PPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2740 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP P P P Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPP 2763 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P P PPP+ PP Sbjct: 2738 PPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSP-PPPSPPPSPP 2781 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPP P P PP P P PP Sbjct: 2265 PSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPP 2309 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPP P P PP P P PP Sbjct: 2275 PSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPP 2319 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P P PPPP P P PP PP P Sbjct: 2538 PPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P PP PP PP Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPP 2735 Score = 42.7 bits (96), Expect = 0.015 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P P P PP P P PP P P Sbjct: 2748 PPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSP 2785 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P P PPP P P PP P P PP Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PS PPP P +P P PP PPP+ P Sbjct: 2539 PSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP-PPSPPPSPPPPSP 2583 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP P Sbjct: 2735 PSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSP 2780 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP +PP PP PP Sbjct: 2531 SPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP +PP PP PP Sbjct: 2679 SPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPP 2724 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPPPP P PP PP PP PP PP Sbjct: 200 SDFPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP SP P PP Sbjct: 227 PPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 204 SPPPPPPPP--PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 39.1 bits (87), Expect = 0.18 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP P+ PPP P P PP PP Sbjct: 2749 PPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP +PP PP PP Sbjct: 2540 SPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPP 2585 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP +PP P PP Sbjct: 2669 SPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2714 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP P PP PP PP Sbjct: 2675 SPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P PP PP PP PP PP Sbjct: 2684 SPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP P PP Sbjct: 2702 SPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2748 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP +PP PP PP Sbjct: 2736 SPPPPSPPP---PSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPP 2778 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP PP PP PP Sbjct: 2266 SPPPPSPPPPSPPPPTPPPSPP--PPPPTPPPSPPPPSPPPPSPPP 2309 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S PP PPPP PP PP +PP PP PP Sbjct: 2251 NSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPP--PPPPTPPP 2295 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PP PPPP PP PP +PP PP P Sbjct: 2741 SPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP P PP LPP PP Sbjct: 2726 SPPPPSPPPP---SPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPP 2769 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR 820 PPPP PP P P P PP P P R Sbjct: 2757 PPPPLPPAPSPPPSPPPPSPPPSPPPPSPPDR 2788 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P PP P PP PP PP Sbjct: 2679 SPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPP 2725 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPP P P PP P PP PP PP Sbjct: 2684 SPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP 2730 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP +PP P PP Sbjct: 2692 SPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP +PP P PP Sbjct: 2697 SPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2743 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P PP PP +PP P PP Sbjct: 2707 SPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2753 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPPP P PP PP +PP P PP Sbjct: 2712 SPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP P PP PP PP Sbjct: 2271 SPPPPSPPP-PTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP PP P PP PP PP Sbjct: 2669 SPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2715 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPPP P PP P PP PP PP Sbjct: 2688 SPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPP 2734 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P PP PP PP PP Sbjct: 2716 SPPPPSPPPPSPPPPSPPPPSPPPPSPP-PPSPPPPSPPPPSPPPP 2760 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPP PPP P PP PP +PP PP P Sbjct: 1174 SPPPPPSPPP--PSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIP 1217 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 760 PXPXXXXPPXXXXP-PPXXXPPPPSSPRXPXXP 855 P P PP P PP PPPPS P P P Sbjct: 1182 PPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPPP P PP PP PP P PP Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPP 2298 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 54.8 bits (126), Expect = 3e-06 Identities = 24/46 (52%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPPPP P PS PPPP P P PPLPP PA P Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P PP PPP PP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPP 283 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 242 PPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP PPP PP Sbjct: 222 PPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPP 269 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P PPPP P P PP PPP PP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PPP P P S PPPP +P P P PPP PP Sbjct: 204 YPSPPPVTPAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPP 250 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P S P P P P PP PPP PP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPP 263 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 729 PPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPP P P PP PP LPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPP-PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP PP P PP PP PP PP PP Sbjct: 238 SPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP--PPPPLLPP 283 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S P PPPPP P PP PP PP PP Sbjct: 236 SPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 276 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S PP P P P PP PP PP PP PP Sbjct: 228 ASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS P P PP P PP PP PP PP PP Sbjct: 233 SSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PPPP P P PP PP PP PP PP Sbjct: 220 SSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPP 268 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPP 803 S PPPPPPP P PP PP Sbjct: 265 SPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 54.4 bits (125), Expect = 4e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPP-PPSPPPPPPPPPP 248 Score = 53.6 bits (123), Expect = 8e-06 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPP P P PPLPPP+ P Sbjct: 230 PPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPP 273 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 222 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PPPP P P P PPP+ PP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPP 267 Score = 51.6 bits (118), Expect = 3e-05 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PS PPPP P P PP PPP PP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP PP P P PP PPP PP Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PP PPP PP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P PPPP P P PP PP PP Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 202 SKYPPPPPPPPPSPSP-PPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPPPPP P PP PP P PP PP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PP P PP PP PP PP PP Sbjct: 214 SPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPP 259 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP P PP PP Sbjct: 220 SPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPP 266 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPF 830 S PPPPPPP P PP P +PPF Sbjct: 238 SPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPPF 274 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP 823 PP PPPP P P PPP P RP Sbjct: 248 PPSPPPPPSPPPPSPPLPPPSIPSPPFAFGFRP 280 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPPS P P P Sbjct: 240 PPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 54.4 bits (125), Expect = 4e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPPA PP Sbjct: 815 PPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPP 859 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 791 PPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPP 835 Score = 51.2 bits (117), Expect = 4e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P P PP P P PP PPPA PP Sbjct: 827 PPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPP 871 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P PP PPP PP Sbjct: 797 PSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPP 841 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PS PPPP P P PP PPP+ PP Sbjct: 840 PPPSPSPPPSPPPAPSPPPPPNPP-PAPTPPPPPSPPPSPPPSPP 883 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P PS PP PP P P PP PPP+ P Sbjct: 858 PPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPP 902 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P+ P PP P P P PPP PP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPP 848 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P PS PPPP +P P PP P P PP Sbjct: 866 PTPPPPPSPPPSPPPSPPPPP---SPPPPPSPPPSPSPPPSSNPP 907 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P+ PP P P P PP PP PP Sbjct: 846 PPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPP 890 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/47 (42%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXP--XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P+ P PP +P P PP P P+ PP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPP 851 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PP P P P PP PP PP Sbjct: 803 PSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPP 847 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPP +P P PP P P PP Sbjct: 857 PPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPPPP PP P PS PP P P P P P PPP+ PP Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPP 879 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PPPPP P P PS PPP P P PPL PPP PP Sbjct: 882 PPPPPSPPPPPSPPPSPSPPPSSNPPLSSP--PPLSSPPPLSSPPPP 926 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXP 856 P P PPP P P+ PPPP +P P PP PPP P Sbjct: 852 PAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPP 896 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P PP P PPPP P P PP P P PP Sbjct: 851 PPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895 Score = 41.5 bits (93), Expect = 0.034 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-----XXXPXRP-PLPPPAXXXXPP 859 PPPP PP P P PPPP +P P P P PPP PP Sbjct: 929 PPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPP 979 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP PP PP PP Sbjct: 813 SPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPP 858 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P PS PPPP P P PP PPP P Sbjct: 912 PPLSSPPPLSSPPPPSSPPPPSPPLPPSPPL-PPNPPPPPSPSP 954 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PPPPP P P PS PP P P PPL PPP PP Sbjct: 888 PPPPPSPPPSPSPPPSSNPPLSSPPPLSSP--PPLSSPPPPSSPPPP 932 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P S PPP P P P PPP PP Sbjct: 894 PPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPP 938 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P PPL P PP Sbjct: 874 PPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPP 918 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP PP P P PPLPPP Sbjct: 943 PPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPP 980 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P PP +PP PP PP Sbjct: 843 SPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPP 889 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P P PP PP PP PP Sbjct: 825 SPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPP 870 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P PP PP PP PP Sbjct: 855 SPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPP PPP P PP PP P PP PP Sbjct: 870 PPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPP 913 Score = 36.3 bits (80), Expect = 1.3 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 1/79 (1%) Frame = +3 Query: 717 SSXPPPPPP-PXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXX 893 S PPPPPP P P PP PP PP P PP Sbjct: 804 SPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPP 863 Query: 894 XXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 864 PAPTPPPPPSPPPSPPPSP 882 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPPP--PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPP PP P PP PP PP PP PP Sbjct: 786 SPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPP 834 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P S PPPP P P PP PP PP Sbjct: 906 PPLSSPPPLSSPPPLSSPPPPSSPPPPSPPL-PPSPPLPPNPPPP 949 Score = 35.1 bits (77), Expect = 2.9 Identities = 21/77 (27%), Positives = 21/77 (27%), Gaps = 2/77 (2%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPP--FLPPXXXXPPXXXXXXXXXXXXXX 899 PP PPPP P PP PP PP PP PP Sbjct: 802 PPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPN 861 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 862 PPPAPTPPPPPSPPPSP 878 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P P PP PP PP PP Sbjct: 845 SPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPP 890 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P P PPP P PP P PP PP PP Sbjct: 849 SPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPP-PPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PP PPP P PP PP P LPP PP Sbjct: 903 SSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPP 950 Score = 33.5 bits (73), Expect = 8.9 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PPP PP P PP PP +PP PP PP Sbjct: 813 SPPPPPNPPTPPSPPPPPSPPPPPSSPPP--PSPSPPPSPPPAPSPPPPPNPPPAPTPPP 870 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 871 PPSPPPSPPPSPPPPPSP 888 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 54.0 bits (124), Expect = 6e-06 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 175 PPPPPPPSPPPPPPPS-PPPPSPPPPSPPPPPPPSPPPPPPPSPP 218 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PS PPPP P P PP P P PP Sbjct: 185 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P +P PP PPP PP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPP 246 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP P P PP PPP P Sbjct: 205 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 248 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P PPPP P P PP PPP P Sbjct: 210 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPP 253 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPPP P P P PPP+ P Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 237 Score = 48.0 bits (109), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P P PP P P PP Sbjct: 180 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 224 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP +P PP PPP P Sbjct: 192 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P PP P P PP PPP P Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 225 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P +P PP PPP PP Sbjct: 197 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP P P PP P P PP Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 239 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P P PPP+ PP Sbjct: 198 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P P PP P P PP Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 252 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP P P PP Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P P PP P P PP P P PP Sbjct: 191 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P PP PPP P Sbjct: 215 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPP-PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP PP P PP PP PP PP PP Sbjct: 182 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP P P P PP +PP PP PP Sbjct: 174 SPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPPS P PP Sbjct: 228 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P P PP PP PP Sbjct: 195 SPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPP PPP P PP PP +PP PP Sbjct: 221 SPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP--PP 258 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 53.6 bits (123), Expect = 8e-06 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P AP P PP PPPA P Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 52.0 bits (119), Expect = 2e-05 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP AP P PP PPP PP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPP-PPAPPPPPPAPPP 314 >UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 236 Score = 52.8 bits (121), Expect = 1e-05 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GGGG GGG GG G G GGGGGGGG Sbjct: 73 GGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 77 GGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GGR G GGGG G G GGGGGGG Sbjct: 66 GGVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 80 GRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGGGGGG Sbjct: 77 GGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 122 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GGGGGGG Sbjct: 80 GRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 123 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GGGG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 126 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGG G Sbjct: 83 GGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 126 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 ++GG G GGG G G G GGGGGGGG Sbjct: 64 DKGGVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGG 101 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 +G GGG GG GG G G GGGGGGGG Sbjct: 65 KGGVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGG 104 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GG G GG GG G G GGGGGGGG Sbjct: 67 GVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGG 105 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 853 GXXXXGGRKGGAXXXXXGGXXXXGGXXXXXGXXXXXGGGGGGGXE 719 G GG GG GG GG G GGGGGG E Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGE 127 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 52.8 bits (121), Expect = 1e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 391 PPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPP-PPPGCGPPPP 434 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 360 PPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPP 404 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLP---PPAXXXXPP 859 PPPPPPP P P PP P AP P PPLP PP PP Sbjct: 363 PPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPP 411 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 375 PPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPP 412 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P PP PP PP Sbjct: 377 PPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPP 421 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PPPP P P PP PP Sbjct: 404 PPPPPPPPPPGLPGAGPPPPP--PPPGCGP--PPPPP 436 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPPP P PPPP P P PP+ Sbjct: 406 PPPPPPPPGLPGAGPPPPPPPPGCGP---PPPPPM 437 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP + PPPP P PP PPP Sbjct: 403 PPPPPPPPPPPGLPGAGPPPP----PPPPGCGPPPPPP 436 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP + P PP P P Sbjct: 420 PPPPPPP-----PGCGPPPPPPMGSFGQKPENPPRKPTIEPNCP 458 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 526 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 570 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 532 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 576 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 538 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582 Score = 51.2 bits (117), Expect = 4e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PPPP P P P PPP PP Sbjct: 545 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Score = 50.0 bits (114), Expect = 1e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP PP P P PPPP P P PP PPP Sbjct: 556 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P P PPPP P P PP PPP PP Sbjct: 520 PSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 564 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP----PLPPPAXXXXPP 859 PPP PPP P PS PPPP P P RP P PP PP Sbjct: 563 PPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSPSPP 611 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P P PPPP P P PP PPP PP Sbjct: 515 PRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 558 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +2 Query: 719 FXPPPP--------PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPP PP P P PPPP P P PP PPP PP Sbjct: 498 FVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 552 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP PP P P PPPP +P P PP P P P Sbjct: 562 PPPPSPPPPPSPPPPPSPPPP--PSPRHPPSPPPRPRPPRPQPP 603 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP PP PP PP Sbjct: 524 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP PP PP PP Sbjct: 530 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 575 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP PP PP PP Sbjct: 536 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Score = 41.1 bits (92), Expect = 0.045 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPP SPR P PP Sbjct: 562 PPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP P P PP PPP PP Sbjct: 496 PPFVPPPPSPLLTSPRPPSPRPPRPSPPSPPP--PPSPPPPPSPPPP 540 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPP PP P PP PP PP PP P Sbjct: 554 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPP 598 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPP P P PP PP PP PP P Sbjct: 543 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 585 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPPPP P PP PP PP PP PP Sbjct: 521 SPPSPPPPP---SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 563 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPP-PXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP P P PP PP PP PP PP Sbjct: 521 SPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 568 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPP-PPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPPP P PP PP P PP PP Sbjct: 542 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPP 589 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP PP P PP Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP-SPRHPPSPP 592 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAP----PFLPPXXXXPP 857 S PPP PPP P PP PP P P PP PP Sbjct: 548 SPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPP 598 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 489 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPP 533 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 493 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPP 537 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 497 PPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPP 541 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 501 PPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPP 545 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS P PP P P PP PPP+ PP Sbjct: 505 PPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 549 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPP 526 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 524 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 569 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 528 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 573 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PP+ PP Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPP 529 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS PP PP P P PP PPP+ PP Sbjct: 517 PPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 561 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PS PP PP P P PP PPP+ PP Sbjct: 521 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 565 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P PS PP PP P P PP PPP+ P Sbjct: 532 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPP 576 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P PS PP PP P P PP PPP+ PP Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 522 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P PS PP PP P P PP PPP P Sbjct: 536 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPPHFAP 580 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P P PP PPP+ PP Sbjct: 513 PPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 557 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P PP PP P P PP PPP+ PP Sbjct: 507 PSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 553 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P PS PP PP P P PP PPP+ PP Sbjct: 469 PTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 514 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P PS PP PP P P PP PPP+ PP Sbjct: 473 PTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 518 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPP PPP P PS PP P P P +P Sbjct: 548 PPPSPPPSPPPSPPPSPPPSPPPSPPPPPHFAPFVP 583 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/77 (25%), Positives = 20/77 (25%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PP PPP P P PP PP PP PP Sbjct: 480 SPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPS 539 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 540 PPPSPPPSPPPSPPPSP 556 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S P PPP P P PP PP +PP PP PP Sbjct: 531 SPPPSPPPSPPPSPPPSPPPSPP--PSPPPSPPPSPPPSPPPSPPPP 575 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 52.8 bits (121), Expect = 1e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 152 PPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPP 196 Score = 50.4 bits (115), Expect = 7e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PP PPPP P PS PPPP P P P P PPP PP Sbjct: 158 PPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPP 203 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPPP P P P PPPP P P P P PPPA PP Sbjct: 161 PPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPP 205 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPP PPP P P PPPP +P P PP PPPA Sbjct: 170 PPPSPPPPPPPSPPPPSPPPPSP-SPPPPPASPPPPPPA 207 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 P PPPPP P PS P PP P P PP P PP PP Sbjct: 150 PSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPP 195 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PPP PPP P P PPPP +P PP P PP PP Sbjct: 157 PPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPP 202 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP PP PP Sbjct: 151 SPPPPPPPP-SPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPP 195 Score = 36.3 bits (80), Expect = 1.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP 802 PP PPPP P P+ PPPP P Sbjct: 184 PPSPPPPSPSPPPPPASPPPPPPALP 209 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPP PPP P PP PP PP PP P Sbjct: 168 SPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPP-PPPALPYP 211 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 52.4 bits (120), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP PPP PP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP P P P Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP 306 Score = 50.4 bits (115), Expect = 7e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 260 PPPPPPPP----PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 49.6 bits (113), Expect = 1e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P R P P P+ PP Sbjct: 270 PPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP-PSPSPPVPPP 313 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPP PP Sbjct: 251 PSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P PP PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PS PPPP P P PP PPP PP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPP-PPSPPPPPPPPPP 287 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PP+ P Sbjct: 267 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVP 311 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP +P P PP PPP P Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP--XXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P +PP P P P Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPP 314 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P P PPPP P PP PPP PP Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PS PP +P PP PP Sbjct: 281 PPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPP 317 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP PP P PP Sbjct: 259 SPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP PP PP Sbjct: 247 SPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PS PP P +P PP PPP PP Sbjct: 230 PPSPQPTASSRP-PSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 38.3 bits (85), Expect = 0.31 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +3 Query: 717 SSXPP-PPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXX 893 SS PP PPP P P PP PP PP PP PP Sbjct: 238 SSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 Query: 894 XXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 298 SPPRKPPSPSPPVPPPPSP 316 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PS P PP P P PP PA P Sbjct: 284 PPPPPPP-PPPPPSPSPPRKPPSPSPPVPPPPSPPSVLPAATGFP 327 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P P PPPP +P P PP PPP P Sbjct: 241 PPSPPPS----PRPPSPPPP---SPSPPPPPPPPPPPPPPPPP 276 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P P P P PP PPP PP Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PP PPPP P PP PP P +PP P Sbjct: 275 PPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPP 317 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPPPPP P P PP PP P P Sbjct: 277 SPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPPSVLP 321 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPPPP P P PPPP P P PP PP P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P P PPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPP+ Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPS 419 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 44.0 bits (99), Expect = 0.006 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXP---XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P P PP PPP PP Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP--PP-PPPYVYPPPP 438 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P P P P P PPP PP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PPP P P P PP PP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP +PP PP PP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP--PPPPSPPP 422 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P P PP P P PP Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPP P PP PP P PP PP Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPPP P P PP PP++ P P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPPPPP PP P PP++ P PP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 52.0 bits (119), Expect = 2e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P P PP PPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 48.0 bits (109), Expect = 4e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P P PPPP P P PP PPP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 48.0 bits (109), Expect = 4e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPPP P P PP PPP Sbjct: 61 PLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 63 PPPPPP-----PPPPPPPPPPPPPPPPPP--PPSPPPPPPPPPP 99 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PP P P P PP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 729 PPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPP PP P PP PP +PP PP PP Sbjct: 59 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPP--PPPPPPPP 99 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 51.6 bits (118), Expect = 3e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PPPPPPP P P PPPP P P PP P PP PP Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP P P PP Sbjct: 90 PPPPPPP---PPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 131 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PP P P P PP P Sbjct: 100 PPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTP 144 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPP SP P PP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPPPSPPP 116 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P P P+ P Sbjct: 107 PSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTPSMHPIQP 151 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 51.6 bits (118), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP P PA PP Sbjct: 80 PPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPP 124 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR---PPLPPPA 841 PPPPPPP P P P P P + PP PPPA Sbjct: 130 PPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPPPA 171 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP---LPPP 838 PPPP PP S PP P P P PP LPPP Sbjct: 92 PPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPP 132 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/54 (37%), Positives = 22/54 (40%), Gaps = 10/54 (18%) Frame = +2 Query: 728 PPPPPPXXXXXP-------XPSXPPPPXXXAPXXXPXR---PPLPPPAXXXXPP 859 PPPPPP P P+ PPP P P + PP PPP PP Sbjct: 90 PPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPPQQNVLPP 143 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +2 Query: 725 PPP-----PPPPXXXXXPXPSXPPPPXXXAPXXXPXR----PPLPPPAXXXXPP 859 PPP PPPP P P PP P P + PP PPP PP Sbjct: 113 PPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPP 166 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +2 Query: 725 PPPPP----PPXXXXXPXPSXPPPPXXXA-PXXXPXR--PPLPPP 838 PPPPP PP P PPPP + P P + PP PPP Sbjct: 91 PPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPP 135 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP P P PP P P + LPPP Sbjct: 109 PPNPPPPKPASQPPP--PPVQNLPPPPPPPQQNVLPPP 144 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P + PPPP P PP P P PP Sbjct: 112 PPPPKPASQPPPPPVQNLPPPP---PPPQQNVLPPPPKPQQNVMPP 154 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 51.2 bits (117), Expect = 4e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGGR Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 232 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G GGGGGGG + Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 232 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222 Score = 46.0 bits (104), Expect = 0.002 Identities = 24/49 (48%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG--GGGGGR 717 GG G G GGGG GGG GG G G GGG GGGGGR Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGR 239 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG G Sbjct: 195 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGG--GGGGXK 718 GG GGG GG G G GGGG G G GGG GGGG + Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGR 239 >UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein; n=3; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 170 Score = 51.2 bits (117), Expect = 4e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGGR Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 100 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G GGGGGGG + Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 100 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G GGGGGGG + Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 49 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 52 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 48.0 bits (109), Expect = 4e-04 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGG R Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 E G GG GGG GG G G GGGGGGGG Sbjct: 33 ESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +G G GG G G GGGG G G GGGGGGG Sbjct: 34 SGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 72 >UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 270 Score = 51.2 bits (117), Expect = 4e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGGR Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 209 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/49 (44%), Positives = 24/49 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG GG G G GGGG G G GGGGGGG + + Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGR 211 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 RG GGGG GGG GG G G GGGGGGGG Sbjct: 151 RGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 150 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 42.7 bits (96), Expect = 0.015 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGG GR Sbjct: 169 GGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGGGGGGGGGGGRGR 211 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G G G G G + Sbjct: 172 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGRGRGRR 218 >UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 388 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 90 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 135 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 94 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 139 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 98 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPP 143 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 110 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPP 155 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 114 PPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPP 159 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 118 PPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPP 163 Score = 51.2 bits (117), Expect = 4e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 122 PPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSPP 167 Score = 50.8 bits (116), Expect = 6e-05 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP+ PP Sbjct: 106 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPP 151 Score = 50.0 bits (114), Expect = 1e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PPP PP Sbjct: 102 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPP 147 Score = 44.0 bits (99), Expect = 0.006 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPP PPP P PS PP P P P PP+P Sbjct: 134 PPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPSPPVP 169 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PS PP PP P P PP PPP+ PP Sbjct: 88 PSPPPSP--PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 131 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 50.8 bits (116), Expect = 6e-05 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P PP PPP+ P Sbjct: 55 PPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSP 99 Score = 50.8 bits (116), Expect = 6e-05 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP PP P P PPPP AP P PP PPP Sbjct: 132 PPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPP 169 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P P PPPP P P PP PPP Sbjct: 115 PPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPP 152 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP PP P P PPPP P P PP P P P Sbjct: 82 PPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPP 125 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PP P +P P PPLPPP+ P Sbjct: 29 PPSPPPPSPPPLPPPLPPPSPPPPSPPPSPP-PPLPPPSPSPPSP 72 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PPPP P P PP P P PP Sbjct: 77 PPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 121 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P P PP P P PP PP PP Sbjct: 58 PPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPP 102 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP---LPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP+ PP Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPP 147 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP PP+ P Sbjct: 195 PTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPP 237 Score = 44.4 bits (100), Expect = 0.005 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PP PPPP P P PPPP +P P P PP Sbjct: 208 PPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPP 244 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PS PPP P +P P PP P P PP Sbjct: 61 PLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP 106 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PP P +P PP PPP PP Sbjct: 47 PSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP 91 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P PP P P P PPP+ PP Sbjct: 80 PSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPP 124 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P P PPPP P P PP PP P Sbjct: 87 PPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P P P P+ PP Sbjct: 90 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPP 134 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP P P P Sbjct: 92 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P+ PP P R P PPP P Sbjct: 219 PPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPP 262 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PPP P P PP P P PP Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP PS PP P +P PP PPP P Sbjct: 74 PPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 117 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P P P P PP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPP 139 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP---PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PPP P P PP P P PP Sbjct: 37 PPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPP 84 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P P PP P P PP PP PP Sbjct: 63 PPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPP 107 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P PS PPP P +P PP PPP+ P Sbjct: 83 PPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP 127 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PS PPPP P P PPP+ PP Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPP 244 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPP P PP PPP P Sbjct: 23 PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSP 67 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP +P P P PPP+ P Sbjct: 69 PPSPPPP----SPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSP 109 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPP PP P PP PP PP LPP PP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPP 70 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PPPP P PP PP PP Sbjct: 41 PPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPP 85 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXX---PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP AP P PPP+ PP Sbjct: 146 PPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSP---PPPSISPSPP 190 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 P PPPP P PS PPP P P PP PP Sbjct: 195 PTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPP 231 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PP PP P P PP PP P Sbjct: 22 PPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPP 65 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PP +P R PP PP Sbjct: 216 PPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPP 260 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 + PP PPP P P P PP P P PP PP P Sbjct: 16 YATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPP 61 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPP P P PP P P+ PP Sbjct: 32 PPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPP-PSPSPPSPPP 74 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP PP PPP P Sbjct: 97 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPP 140 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PPP+ PP Sbjct: 163 PPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPP 207 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP PS PPP +P P PP A PP Sbjct: 164 PPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPP 208 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PP P +P PP P+ PP Sbjct: 107 PSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPP 151 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPP +P PPP PP Sbjct: 218 PPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPP 262 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PP PPPP P PP PP +PP PP P Sbjct: 53 SPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPP 97 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 P PPPP P + P PPP +P P PP PPP PP Sbjct: 178 PSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPP 225 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PP P P PP P P PP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPP 70 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P PP P PP PP PP Sbjct: 76 SPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 136 SPPPPSISPSPPPPPPP 152 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PP P P P PP P P PP Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPP 61 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP P PP PP PP Sbjct: 71 SPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 116 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPP PPP P PP PP PP PP P Sbjct: 113 SPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAP 157 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPP-PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P S PPP +P P PPP P Sbjct: 161 PSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSP 206 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP P PP PP PP Sbjct: 66 SPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPP 112 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 +S PPPPPP P PP P A P PP P Sbjct: 159 ASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASP 204 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP PP PP P PP PP Sbjct: 93 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPP 139 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP +PPF PP Sbjct: 210 SPPPPSPPPPPPPPPPPPPSPP-SPNPPPSASPSPPFGRSLRSPPP 254 Score = 33.5 bits (73), Expect = 8.9 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PPPP P PP PP +PP P PP Sbjct: 76 SPPPPSPPPPSPPSPP--PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPP 133 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 134 PPSPPPPSISPSPPPPPP 151 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 50.8 bits (116), Expect = 6e-05 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P P P PP PPP+ P Sbjct: 137 PPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSP 183 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P S P PP P P PP PPP+ PP Sbjct: 139 PPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPP 187 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PP P P P PP PPP+ PP Sbjct: 150 PPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPP 195 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP PP+ PP Sbjct: 136 PPPPPPPPPPPSSPPPSPPPP-SSPPSPPPSSPPSSPPSPPPSPP 179 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP PP P P PP PP+ P Sbjct: 174 PPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSP 219 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP PS PP PP P P PP PPP+ P Sbjct: 159 PPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSP 203 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS PP P P P PP PP+ PP Sbjct: 186 PPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPPSSPPSPP 231 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS PP P P P PP PPP+ P Sbjct: 162 PPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSP 207 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PP PP P PS PP P +P P PP PP + PP Sbjct: 167 PPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPP 212 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PS PP P P P PP PP+ P Sbjct: 183 PPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPPSSP 227 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P S P P P P PP PP+ P Sbjct: 191 PPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPPSSPPSPPLQP 234 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P P P PP P P PP PP+ P Sbjct: 178 PPPSSPPSPPPSSPPSPP-PSPPPSSPPSSPPSSPPSSPPSSPPSSP 223 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 SS PP PPPP P P PP + P PP P Sbjct: 147 SSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPP 192 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 50.4 bits (115), Expect = 7e-05 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP + P PP PPPA Sbjct: 394 PPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPPPPA 432 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 393 PPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPPP 430 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP AP PP+PPP Sbjct: 385 PPPPPPP-----PPPPPPPPPAGKAPP-----PPIPPP 412 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP------LPPPAXXXXPP 859 PPPPP P P PPP P P PP PPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPPPP 431 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP----PPPXXXAP--XXXPXRPPLPPP 838 PPPPPP P P P PP P P PPLPPP Sbjct: 449 PPPPPPLSAEAAPLPISPIAPGPPAARSLPKLGNPPPAPPLPPP 492 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 50.4 bits (115), Expect = 7e-05 Identities = 20/47 (42%), Positives = 22/47 (46%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP PPPP P PPPP P P PP PPP+ PP Sbjct: 414 YTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P PP P P P Sbjct: 429 PPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYP 472 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P+P P P Sbjct: 431 PPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVP 474 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P P P P Sbjct: 433 PPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVP 476 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 719 FXPPPPP-PPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PPP P PP P P PPPP P P PP PPP PP Sbjct: 396 YPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPP 446 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P+P P P Sbjct: 445 PPPPPPPP----PSPPPPPPPPCPIPCPEPYPVPVPIPEPYYVP 484 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P PPP P P PP PPP P Sbjct: 427 PCPPPPPPPPPPPCPVPCPPPPPPPPPSPP--PPPPPPCPIPCP 468 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P PPP P P P+P P P Sbjct: 443 PCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVPIPEPYYVPSP 486 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P P PP P P P P PPP P Sbjct: 421 PPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCP 464 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P PPP P P P P P P Sbjct: 434 PPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVPIPEP 480 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP P P PPPP SP P PP Sbjct: 430 PPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPP 462 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 P P P P P P P P P AP P PP PPP P Sbjct: 383 PYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVP 427 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PP PPPP P PP PP PP PP PP Sbjct: 416 PPSPPPPPC---PVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPP 456 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P PP AP P PP P P PP Sbjct: 393 PVPYPPP-----PAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPP 432 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 50.4 bits (115), Expect = 7e-05 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P+ PPPP AP P PP PPP PP Sbjct: 98 PPPPPPKSDAPPPPPARPPPPPPTAP---PATPPPPPPNHPPPPP 139 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP AP P PPP PP Sbjct: 533 PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPP 576 Score = 48.0 bits (109), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P P PPPA PP Sbjct: 533 PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPP 577 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP----PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PPP P PP PPPA PP Sbjct: 522 PPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPP 570 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPPPP PP P P+ PPPP + P P +PPPA PP Sbjct: 116 PPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATPP 163 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P + PPPP P P +PPP PP Sbjct: 109 PPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAAIPP 155 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP-AXXXXPP 859 PP P P PPPP AP P RPP PPP A PP Sbjct: 85 PPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPPATPP 128 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +2 Query: 728 PPPPPPXXXXXPXPS----XPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P P PP PP Sbjct: 127 PPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATPPAAPP 167 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P+ PP P P PP PPP PP Sbjct: 108 PPPPPARPPPPPPTAPP---ATPPPPPPNHPPPPPPKSNDIPP 147 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP AP P PPPA P Sbjct: 544 PPPPPPPPPKGGAPP--PPPPPARAPPPPAGTP--PPPAAAPAP 583 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP----PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P P PPP P PP PPP PP Sbjct: 511 PPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPP 559 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PPPP AP PP PPPA PP Sbjct: 508 PGVPPAPPLPGAGVPPPPPPPGAGAP------PPPPPPAGGAPPP 546 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 50.4 bits (115), Expect = 7e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPPA Sbjct: 105 PPPPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPA 143 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP A P PPP PP Sbjct: 119 PPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPP 163 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PPP PP Sbjct: 117 PPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPP 161 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP + PP PPP PP Sbjct: 120 PPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPP 164 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P PP PPP PP Sbjct: 136 PPPPPPPASSTKSAEAPPPPP--------PPPPPPPPPPVVTSPP 172 >UniRef50_Q127H7 Cluster: Putative uncharacterized protein precursor; n=1; Polaromonas sp. JS666|Rep: Putative uncharacterized protein precursor - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 261 Score = 50.0 bits (114), Expect = 1e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 214 GGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGG + Sbjct: 215 GGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNK 261 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 207 GGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGG 251 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GGGGGGGG Sbjct: 195 GGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGG 240 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGGGGGG Sbjct: 207 GGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 252 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGGGG Sbjct: 208 GNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 253 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GGGGGGGG Sbjct: 211 GGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 256 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG G G GG G G GGGG G G GGGGGGG K Sbjct: 215 GGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGNK 261 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G GGG GG G G GGGGGGGG Sbjct: 202 GAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGG 246 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG GG G G GGGGGGGG Sbjct: 204 GGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 249 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG AGG GG G GGGG G G GGGGGGG Sbjct: 204 GGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGG 248 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGGGGG Sbjct: 214 GGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 258 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG+GG G G GG G G GGGGGGG Sbjct: 187 GGNAAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGG 231 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGR-GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 199 GGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGG 244 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG GG G G GGGGGGGG Sbjct: 194 GGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGG 239 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GGGGGGG Sbjct: 211 GGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 255 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +G G GG G GGGG G G GGGGGGG Sbjct: 195 GGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGG 239 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G +GGG GGG G G G GGGGGGGG Sbjct: 188 GNAAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGG 233 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G GGGG G G GGGGGGG Sbjct: 212 GNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 256 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AGGG G G G GG G G G GGGGGGG Sbjct: 198 GGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGG 241 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGG GGG GG G GGGGGGGG Sbjct: 187 GGNAAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGG 232 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 50.0 bits (114), Expect = 1e-04 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PPAXXXXP 856 PPPPPPP P P PPPP AP P P+P PPA P Sbjct: 265 PPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPPP 310 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPP P P PP P P P Sbjct: 261 PPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPP 304 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPP P P PP P PA P Sbjct: 261 PPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVP 303 Score = 40.7 bits (91), Expect = 0.059 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 P PPPP P P+ PPPP AP P PP PPPA PP Sbjct: 275 PVPPPPIPPPPPVPA-PPPPPEPAP--VPGVPPAADPPPAPSPPPP 317 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P+ P PP P PP PPPA P Sbjct: 282 PPPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPPEPPPADPPTAP 328 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXP--XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P+ PPP P P PP PP P Sbjct: 288 PAPPPPPEPAPVPGVPPAADPPPAPSPPPPEP--PPADPPTAPDRP 331 >UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; Syntrophobacter fumaroxidans MPOB|Rep: Putative uncharacterized protein - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 335 Score = 50.0 bits (114), Expect = 1e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G G GGGG GGG GG G G GGGGGGGGR Sbjct: 290 GHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 335 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG AGGG GG G G GGGG G G GGGGGGG Sbjct: 292 GGPGGSAGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGGGGG Sbjct: 284 GGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG GG G G GGGGGGGG Sbjct: 288 GAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G +G G GG G G GGGG G G GGGGGGG Sbjct: 282 GPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGG 325 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GGG GG G G GGGGGGGG Sbjct: 284 GGPSGA-GHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 328 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GG G G G+ GGGG G G GGGGGGG Sbjct: 278 GSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGG 321 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG GG GG G G GGGGGGGG Sbjct: 282 GPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGG 326 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G G G G GG G G GGGGGGGG Sbjct: 271 GTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGG 316 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GG GG G G GGGGGGGG Sbjct: 275 GAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGG 320 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G R G G G G G G G GGGGGGGG Sbjct: 267 GSRAGTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGG 308 >UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg protein - Ostreococcus tauri Length = 3738 Score = 50.0 bits (114), Expect = 1e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP AP P PP PPP PP Sbjct: 5 PPPPAPPSP---PPPPSPPPPPSPAPPSPPPPPPSPPPPSPPPPP 46 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPP PPP P P PPPP P P PP P Sbjct: 1808 PPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPPPP 1840 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP + P PP PPP+ PP Sbjct: 645 PPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPP 689 Score = 49.6 bits (113), Expect = 1e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP+ PP Sbjct: 662 PPPPPPPSKNGAPPPPPPPPPSRNGAPPPP--PPPPPPSKTGAPP 704 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 676 PPPPPPPSRNGAPPPPPPPPP----PSKTGAPPPPPPPRIGGAPP 716 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPPP P PPP AP P PPL Sbjct: 690 PPPPPPPPSKTGAPPPPPPPRIGGAP---PPPPPL 721 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PS P P PP PPP Sbjct: 688 PPPPPPP-----PPPSKTGAPPPPPPPRIGGAPPPPPP 720 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 50.0 bits (114), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 827 PPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPP 871 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PP A P Sbjct: 843 PPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAP 887 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +2 Query: 719 FXPPPPPPP------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPPP P P PPPP P PP PPP PP Sbjct: 804 FVPPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPP 856 Score = 46.4 bits (105), Expect = 0.001 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP + P PP PPP Sbjct: 842 PPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPP 879 Score = 46.4 bits (105), Expect = 0.001 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP----XXXAPXXXP----XRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP AP P RPP PPP PP Sbjct: 858 PPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPP 910 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 826 PPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPP 863 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 841 PPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPP 878 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP PP PPP P Sbjct: 856 PPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPP 899 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP P PP Sbjct: 844 PPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPP 888 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP PP PPP PP Sbjct: 855 PPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPP 899 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P RPP P Sbjct: 887 PPPPPPPGGPRPPGP--PPPPGGAPPLPPGPRPPGGP 921 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP + PPPP P PP PPP Sbjct: 840 PPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPP 876 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXP-XRPPLPP 835 PPPPPP P PPP P P P PPLPP Sbjct: 874 PPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPP 913 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P P PPP PPPP S P PP Sbjct: 842 PPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPP 874 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP PP PP PP PP PP Sbjct: 838 SAPPPPPPPPPPG--GKGAPPPPPPPPPPGSKTGPP--PPPPPPPP 879 >UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein Pan1, putative; n=9; Fungi/Metazoa group|Rep: Actin cortical patch assembly protein Pan1, putative - Aspergillus fumigatus (Sartorya fumigata) Length = 1467 Score = 50.0 bits (114), Expect = 1e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PPP P P PP PPP PP Sbjct: 1373 PPPPPPPAAVPSYDPSVAPPPPPAPPMAPPAPPPGPPPPPGPLPP 1417 Score = 41.1 bits (92), Expect = 0.045 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPP PP P P PPPP P P P PA Sbjct: 1392 PPPPAPPMAPPAPPPGPPPPPGPLPPPAPPAASGPPTPA 1430 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPX------PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP P P PP Sbjct: 1371 PPPPPPPPPAAVPSYDPSVAPPPPPAPPMAPPAPPPGPPPPPGPLPPPAPP 1421 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P + P PP P P PP PP A P Sbjct: 1391 PPPPPA----PPMAPPAPPPGPPPPPGPLPPPAPPAASGPPTP 1429 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP P PP APP PP PP Sbjct: 1369 AAPPPPPPPP---PAAVPSYDPSVAPPPPPAPPMAPPAPPPGPPPPP 1412 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 580 PPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPP 624 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP + P PP PPP PP Sbjct: 581 PPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P P PP PPP PP Sbjct: 593 PPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPP-PPPGSGPPPP 636 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P P PP PP Sbjct: 597 PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPP 641 Score = 41.5 bits (93), Expect = 0.034 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPP P PPPP P P PP P Sbjct: 609 PPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPP P P PP PPA Sbjct: 609 PPPPPPP-----PPPGGGPPPPPPPPGSGPPPPPGAPPA 642 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 740 PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P PPPP A P PP PP PP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPP 610 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP PP PP APP PP PP Sbjct: 575 AAAPPPPPPPPPLPG-AEAPPPPPPPPPPSGSGGAPP--PPPPPPPP 618 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP PP PP Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPP 368 Score = 49.2 bits (112), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P P PPP PP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 49.2 bits (112), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPPP P P PP PPP Sbjct: 344 PDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 330 PPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPP 375 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PPPP P P RPP PPP P Sbjct: 343 PPDPPPPPDPPPPPPPDPPPPPDPPP---PDRPPPPPPEPPPPP 383 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 335 PPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPP P P P PPP PP Sbjct: 319 PPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPP 363 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P P PPP PP Sbjct: 313 PPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPP 357 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P P PP P P PP PPP P Sbjct: 321 PPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPP 364 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PP P P P P PPP PP Sbjct: 332 PPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPP 376 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PP PP P P PP PPP PP Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPP 355 Score = 44.4 bits (100), Expect = 0.005 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXP---PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P P PPP P P PP PPP PP Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPP 361 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PP P PP PP P PP PP Sbjct: 316 SDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PP PPPP P PP PP PP PP PP Sbjct: 327 PPDPPPP--DPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPP 368 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P PP Sbjct: 353 PPPPPPDPPPPPDPPPPDRPPPP--PPEPPPPP 383 >UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa|Rep: Os04g0438100 protein - Oryza sativa subsp. japonica (Rice) Length = 200 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/47 (48%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGG+ Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQ 158 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 110 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 154 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 111 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 112 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 113 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 42.3 bits (95), Expect = 0.019 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GGGG Sbjct: 118 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGG 163 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GGGG Sbjct: 119 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGG 163 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G GGGG + Sbjct: 120 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGQCGGGGSTR 166 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 49.2 bits (112), Expect = 2e-04 Identities = 21/45 (46%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP +P PP PPP+ PP Sbjct: 957 PPPPPPPPSYGSPPPPPPPPPGYGSPPP----PPPPPPSYGSPPP 997 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP +P PP PPP PP Sbjct: 944 PPPPPPPPSYGSPPPPPPPPPSYGSPPP----PPPPPPGYGSPPP 984 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP AP P P PP PP Sbjct: 1134 PPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGGGPPPPP 1178 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 982 PPPPPPPPPSYGSPPPPPPPPFSHVSSIPP--PPPPPPMHGGAPP 1024 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-----PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP PP P PP PPP PP Sbjct: 1086 PPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPP 1135 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP PP Sbjct: 1122 PPPPPPPMRGGAPPP--PPPPGGRGPGAPP--PPPPPGGRAPGPP 1162 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP+ A PP Sbjct: 1010 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1054 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP+ A PP Sbjct: 1023 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1067 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXP------XRPPLPPPAXXXXPP 859 PPPPPPP P PPPP AP P +PP PPP PP Sbjct: 1036 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPP 1087 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 996 PPPPPPPFSHVSSIPPPPPPPPMHG--GAPPPPP-PPPMHGGAPP 1037 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP +P PP PPP+ PP Sbjct: 918 PPPPPPPPFSNAHSVLSPPPPSYGSPPP----PPPPPPSYGSPPP 958 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPP-----XXXXXPXPS--XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPPP P PP PPP PP Sbjct: 919 PPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPP 970 Score = 41.1 bits (92), Expect = 0.045 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP + PP Sbjct: 969 PPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPP 1013 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP------PPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P P PPP P PP PPP P Sbjct: 1110 PPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAP 1159 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPX-----RPPLPPPAXXXXP 856 PPPPPPP P P PPP AP P PP PPP P Sbjct: 1098 PPPPPPPMRGGAPPPP-PPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGP 1145 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PPPP P PP PPP PP Sbjct: 956 PPPPPP--PPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPP 996 Score = 38.7 bits (86), Expect = 0.24 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXA---PXXXPXR----PPLPPPAXXXXPP 859 PPPPPP P P PPPP P P R PP PPP PP Sbjct: 1075 PPPPPPMRGGAPPP--PPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPP 1123 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP----PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PP P PP PPP PP Sbjct: 1063 PPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPP 1111 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPP P P PPPP P P PP+ Sbjct: 1148 PPPPPPPGGRAPGP--PPPPGPRPPGGGPPPPPM 1179 Score = 36.7 bits (81), Expect = 0.96 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA--PXXXPXR----PPLPPPAXXXXPP 859 PPPPPP P P PPP A P P R PP PPP PP Sbjct: 1051 PPPPPPMHGGAPPPP--PPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPP 1099 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 8/46 (17%) Frame = +2 Query: 725 PPPPPPPXXXXXPX-----PSXPPPPXXXA---PXXXPXRPPLPPP 838 PPPPPPP P P PPPP + P PP PPP Sbjct: 670 PPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPP 715 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP PP PP P + P PP Sbjct: 916 TAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPP 962 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 SS PPPPPPP P PP PP PP PP Sbjct: 1007 SSIPPPPPPP-----PMHGGAPPPPPPPPMHGGAPPPPPPP 1042 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = +2 Query: 725 PPPPPPP-------XXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 649 PPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPP 694 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPF-----LPPXXXXPP 857 S PPPPPPP P PP P PPF +PP PP Sbjct: 968 SPPPPPPPPPGYGSPPPPPPPPPSYGSP-PPPPPPPFSHVSSIPPPPPPPP 1017 >UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structural protein; n=3; Oryza sativa|Rep: Putative glycine-rich cell wall structural protein - Oryza sativa subsp. japonica (Rice) Length = 321 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/46 (45%), Positives = 23/46 (50%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 G +GGG GG G G GGGG G G GGGGGGG + Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 121 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G GGGG GGG GG G G GGGGGGGGR Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 121 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGGGGGG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGGGGGG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GGGGGGG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G GGGGGGG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGGGGGG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GGGG G G GGGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGGGG G Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GGG GG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G GGGG G G GGGG GG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG-----GGGGNGG 150 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G RG GGGG GGG GG G G G G G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G G G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG G G G GG GG+ Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGK 172 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG G G G G GGR Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGR 169 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 856 GGXXXXGGRKGGAXXXXXGGXXXXGGXXXXXGXXXXXGGGGGGGXE 719 GG GG GG GG GG G GGGGG G + Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGD 151 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -2 Query: 856 GGXXXXGGRKGGAXXXXXGGXXXXGGXXXXXGXXXXXGGGGGGGXE 719 GG GG GG GG GG G GGGG GG + Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDD 152 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXG---GGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GG G G GGGGGGG Sbjct: 218 GGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGGGGG 264 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/46 (43%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG + +GGGG GG GG G G GGGGGGGG Sbjct: 228 GGSDNAQSGDGGGGWESSGG----GG----GRGDVSGAGGGGGGGG 265 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 828 RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 RG G GGGG G G GGGGGGG Sbjct: 75 RGWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G G Sbjct: 118 GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDG 162 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXG-XGXXXXXGGGGGGGXKXK 712 GG GGG GG G G G GG G G G G GG K Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGK 172 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG G GG GG GR Sbjct: 128 GGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGR 174 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG----GGGGGR 717 GG +G GG GGG GG GGG GGGGGR Sbjct: 201 GGRGKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGR 251 >UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 134 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 83 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 84 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 86 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 47 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 48 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/38 (50%), Positives = 21/38 (55%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 ++GGGG GGG GG G G GGGGGGGG Sbjct: 30 KQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 67 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 +G GGGG GGG GG G G GGGGGGGG Sbjct: 31 QGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 70 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGG 736 GG GGG GG G G GGGG G G GG Sbjct: 60 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -3 Query: 828 RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 + + G G GGGG G G GGGGGGG Sbjct: 27 QANKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 61 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG 733 GG GGG GG G G GGGG G G GG Sbjct: 59 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 49.2 bits (112), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP AP PP PPP PP Sbjct: 605 PPPPPPPPVKSAPLPPPPPPPKIAAPP-----PPPPPPMKAGPPP 644 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP + PP Sbjct: 630 PPPPPPPPMKAGP-PPPPPPPGVPRPPGGPPPPPPPPGSKAGGPP 673 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P +P P PP Sbjct: 619 PPPPPPPKIAAPPPP--PPPPMKAGPPPPPPPPGVPRPPGGPPPP 661 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 642 PPPPPPPPGVPRP-PGGPPPP-PPPPGSKAGGPPPPPPPGAPQPP 684 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP----------PPAXXXXPP 859 PPPPPPP P PPPP + P PP P PP PP Sbjct: 643 PPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAPP 697 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PPPP AP PP PPP PP Sbjct: 593 PQQPPNAPSLPPPPPPPPPPVKSAPLP----PPPPPPKIAAPPP 632 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP PP PP PP PP PP Sbjct: 601 SLPPPPPPPPPPVKSAPLPPPP---PPPKIAAPPPPPPPPMKAGPP 643 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP----PPXXXAPXXXPXRPPLP 832 PPPPPP P P PP PP AP PP P Sbjct: 660 PPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAPPQP 699 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S+ PPPPPP P PP PP PP PP PP Sbjct: 615 SAPLPPPPPPPKIAAPPPPPPPPMKAGPP------PPPPPPGVPRPP 655 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP------XXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPPA PP Sbjct: 151 PPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPP 201 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPPP P P PPPP P P PP PP PP Sbjct: 135 PPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPP 181 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPP P P PP PPPA PP Sbjct: 199 PPPPPAPQGPPAPPPVEGPPPPK-GPPPPPHSPPGPPPAEGPPPP 242 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP-AXXXXPP 859 PPPPPPP P P PPP P P P PPP A PP Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPP 189 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 PPP PP P P PPP AP P PP PPP PP Sbjct: 174 PPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPP 220 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPP P P P PPPP P P PPP PP Sbjct: 125 FMPPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPP 171 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P + PP P P P PP P P PP Sbjct: 168 PPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPP 212 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PP PP P P+ P PP AP P PP+ PPP PP Sbjct: 180 PPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPP 226 Score = 40.3 bits (90), Expect = 0.078 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPP---PPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P PPPP P P P PPPA PP Sbjct: 233 PPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPP--PHFPPPAEGPPPP 280 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P+ PPP P P P P PPP PP Sbjct: 165 PPGPPPP---HPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPP 209 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP P P P PPPA PP Sbjct: 208 PPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGP-PPPA-KVPPP 248 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPP--PAXXXXPP 859 PP PPPPP P P+ PPPP P P P PP P PP Sbjct: 219 PPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPP 268 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPP---PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P S P PP P PP PP PP Sbjct: 211 PPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPP 258 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPP P P P PPP+ PP Sbjct: 255 PPPPHSPPPHGPPPHFPPPAEGPPPPHGPP-PHSPPPSEGPPPP 297 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P PPPP +P P PPPA P Sbjct: 208 PPAPPPVEGPPPPKGPPPPP--HSPPGPPPAEGPPPPAKVPPP 248 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPPPPP P PP PP PP PP PP Sbjct: 147 PPPPPPP---PPPPPMAGPPPPPGPP-PPHPPPPAGPPPVAGPP 186 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P P PP PP P PP PP PP Sbjct: 246 PPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGPPPHSPPPSEGPPP 296 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 49.2 bits (112), Expect = 2e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 379 GGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGG 424 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G G GGGGGG Sbjct: 400 GGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGG 445 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 GG G G GGGG GGG G G G GGGGGG Sbjct: 369 GGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGG 412 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GG G G G GGGGGGG Sbjct: 349 GGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGG 393 Score = 40.7 bits (91), Expect = 0.059 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXG--GXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG G G G G GGGGGGGG Sbjct: 411 GGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGG 458 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G EGGGG G GG G G GGGGGGG Sbjct: 357 GGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGG 402 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG G G G GGG G G GGGGGG Sbjct: 361 GGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGG 404 Score = 40.3 bits (90), Expect = 0.078 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 386 GGGGGGGGPPGGGG---GGGGGPPGG---GGGGPPGSGGGGGGGGG 425 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G E GGG G GG G G GGGGGGGG Sbjct: 358 GGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGG 403 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G G G GGGGGGG Sbjct: 348 GGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGG 392 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G G G GGGGGGG Sbjct: 349 GGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGG 393 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG--GXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G G GGGGGGG Sbjct: 378 GGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGG 424 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG---GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG GG G GGGGGGG Sbjct: 400 GGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGG 447 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG----GGXXGXGXXXXXGGGGGGG 724 GG +GGG GG G G G GG G G GGGGGGG Sbjct: 410 GGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGG 458 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G GGGGGGG Sbjct: 381 GGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGG 425 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG---GXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG G G G G GGGGGGGG Sbjct: 345 GGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGG 393 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGG G G GGG G Sbjct: 392 GGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDG 435 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG--GXXGXGXXXXXGGGGGG 727 GG GRGG G G GGG G G G GGGGGG Sbjct: 367 GGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGG 412 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G GGGG G Sbjct: 391 GGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDG 435 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG GGG GG G GGGGGGGG Sbjct: 409 GGGGPPGSGGGGGGGGGPPEGG--GGSDGAPGRGGGGGGGGG 448 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGGG GGG G G G GGGG G Sbjct: 391 GGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDG 435 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GGG GG G G GG G G G GGGGG Sbjct: 344 SGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGG 382 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGG----GGGG 724 G GGG G G G GGGG G G GGG GGGG Sbjct: 373 GAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGG 420 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGG----XXGXGXXXXXGGGGGGG 724 GG GG GG G G+ GGGG G G G GGGGG Sbjct: 396 GGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGG 444 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG G GG G G GGGGGG Sbjct: 356 GGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGG 401 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG A GG GG G GGG G G G GGGG Sbjct: 337 GGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGG 381 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG G G G GGGG G Sbjct: 390 GGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDG 435 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXX----GGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GG G GR Sbjct: 389 GGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGR 439 >UniRef50_Q3UQ97 Cluster: 10 days lactation, adult female mammary gland cDNA, RIKEN full-length enriched library, clone:D730033L13 product:hypothetical Proline-rich region profile containing protein, full insert sequence; n=3; Murinae|Rep: 10 days lactation, adult female mammary gland cDNA, RIKEN full-length enriched library, clone:D730033L13 product:hypothetical Proline-rich region profile containing protein, full insert sequence - Mus musculus (Mouse) Length = 254 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PPLPP + PP Sbjct: 35 PPPAPPRPPSPAPPPLPPPPPRPPPPLPLPPPPPLPPTSLVPLPP 79 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P PP P AP P PP PPP PP Sbjct: 22 PKPTIPGSPTILPPPPAPPRPPSPAPPPLPPPPPRPPPPLPLPPP 66 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P PPP P P PPLPPP PP Sbjct: 20 PIPKPTIPGSPTILPPPPAPPRPPSPAP--PPLPPPPPRPPPP 60 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 48.8 bits (111), Expect = 2e-04 Identities = 23/48 (47%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P+ PPPP AP P PP PPP PP Sbjct: 75 PPPPSQAPPPPRRAPPPPALPPPPPRRAPPP-PSMPPPPPPRRAPPPP 121 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P PS PPPP P PP PPP PP Sbjct: 90 PPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPP-PPPRRAPPPP 135 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA--PXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P+ PPPP A P P RPP PP PP Sbjct: 109 PPPPPP--RRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPP 153 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPP P P R P PPPA PP Sbjct: 82 PPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAP-PPPATPPPPP 128 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP----LPPPAXXXXPP 859 PPPP PP P PPPP P PP PPPA PP Sbjct: 51 PPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPP 99 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PP P P R P PPP+ PP Sbjct: 96 PPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAP-PPPSPPIRPP 142 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PPP P PS PPP AP P PP PPP PP Sbjct: 61 PSPPGRAPPPPGRAPPPPSQAPPPPRRAPPP-PALPP-PPPRRAPPPP 106 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPP P P R P PPP+ PP Sbjct: 68 PPPPGRAPPPPSQAPPPPRRAPPPPALPPPP-PRRAP-PPPSMPPPPP 113 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXAPXXX-----PXRPPLPPPAXXXXP 856 PP PPPPP P P+ PPPP AP P PP P P P Sbjct: 105 PPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 155 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXPS----XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P PS PPPP P PL PP PP Sbjct: 119 PPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPP 169 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P P PPPP AP PP P P PP Sbjct: 132 PPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 180 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PP P P P PPP+ PP Sbjct: 118 PPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAP--PPPSHPLAPP 162 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P P PPP PPPP+ P P PP Sbjct: 32 PKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPP 64 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLP-PXXXXPP 857 S PPPPPP P PP PP PP P P PP Sbjct: 107 SMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPP 153 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P + PPP P P P LPPP PP Sbjct: 60 PPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPP 104 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP P P PPPP P P P PP PP Sbjct: 29 PNAPKPPVMP--PRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPP 71 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PP PP P P PPPP AP P PP PPP PP Sbjct: 34 PPVMPPRPQAPPPPQRFPPPP---APPIRPPSPPGRAPPPPGRAPPP 77 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PP P AP P R P PPP+ PP Sbjct: 44 PPPPQRFPPPPAPPIRPPSPPGRAP-PPPGRAP-PPPSQAPPPP 85 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P PS PPP P P PP PPP P Sbjct: 512 PPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPP 555 Score = 48.8 bits (111), Expect = 2e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP PP +P P PP PPP PP Sbjct: 516 PPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPP 562 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPPP +P P PP PPP PP Sbjct: 564 PPPPSPPPPSPPPPSPPPPP---SPPPSPPPPPSPPPPSPPPPP 604 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP P P PP PPP+ PP Sbjct: 547 PPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPP-PPPSPPPSPP 590 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P P PP P P PP PPP PP Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPP 545 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP----XRPPLPPPAXXXXP 856 PP PPPP P PS PPP P P RPP PPP P Sbjct: 525 PPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPP 572 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP P P+ PP Sbjct: 507 PPPSPPP---SPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPP 548 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P PS PP P +P P P PPP+ P Sbjct: 508 PPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPP 551 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPP P P P PP P P PP PPP+ P Sbjct: 550 PPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP 593 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PP P + P PP PP PP Sbjct: 533 PPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPP 577 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PS PP P P PP P P PP Sbjct: 537 PPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPP 581 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P PS PP PP P P PP PPP PP Sbjct: 493 PTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPP 537 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PP PPPP P P PPP P P PP+ Sbjct: 571 PPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPV 605 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPP P P PPP Sbjct: 577 PSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPP 614 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PS PPP P P P PP Sbjct: 579 PPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPP 623 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP P PP PP PP Sbjct: 540 SPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPP 586 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP P P P P PP +PP PP PP Sbjct: 499 SSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPP 544 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP + PP Sbjct: 568 SPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPP 614 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPP 838 P PPPPP P PS PPPP P P PPP Sbjct: 587 PSPPPPP---SPPPPSPPPPPVVVVPSSPPPVLVNDMYPPP 624 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PP P PP PP PP P PP Sbjct: 504 SPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPP 549 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPP PPP P P PP PP PP Sbjct: 563 SPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPP 602 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P P L PP P Sbjct: 16 PPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPPLLSPPQLTQPP 59 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPP P P PPPP P PPL P PP Sbjct: 13 FQIPPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPPLLSPPQLTQPP 59 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PPPP +P P LP P PP Sbjct: 27 PPPPQPPPPPPSLLPQPPPPPPLLSPPQLTQPPVLPQPLPQPLPP 71 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 1039 PPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPP 1076 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP PP Sbjct: 1040 PPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPP 1084 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 1054 PPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPP-PPPGGFGGPP 1097 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPP-------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP A P PP PPP PP Sbjct: 1018 PPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPP 1069 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P A PP Sbjct: 1069 PPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPP 1113 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 1052 PPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPP 1089 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 PPPPPPP P P PPPP P PP Sbjct: 1084 PPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPP 1117 Score = 40.3 bits (90), Expect = 0.078 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 1051 PPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPP 1088 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PP PP PP Sbjct: 1068 PPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPP 1112 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F PPPPPP P PPPP P PP PPP Sbjct: 1080 FGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVP--PPPPPP 1117 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/78 (25%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 ++ PPPPPPP PP PP A PP PP Sbjct: 1013 TAAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPP 1072 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 1073 PPPPPGGFGGPPPPPPPP 1090 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP-LPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP + PA PP Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAPTYLPP 109 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP PS PPPP P PP PPP P Sbjct: 527 PPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYP 570 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P P PPP PP Sbjct: 491 PPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPP 535 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P+ PPPP P P PP PPP P Sbjct: 62 PSPPPPPPPVTYNYPAPPPPPPPPPPPPPP--PPPPPPRVSTPAP 104 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS P PP P P PP PP+ PP Sbjct: 447 PPPSPPSSTPSPSPSTPSPP-PSRPPSTPSLPPSRPPSSPSPPP 489 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P S PP P P PP PPP P Sbjct: 499 PPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYP 541 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPX---PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS P PP P P RPP PPP PP Sbjct: 465 PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPP-RPPPPPPPPSQPPP 511 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP PS PP +P P PP PPP PP Sbjct: 460 PSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPP 504 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = +2 Query: 725 PPPPPPPXXXXXP-----XPSXPPPPXXXAPXXXPXRP-------PLPPPAXXXXPP 859 PPPPPPP P PS P P P P RP P+PP A PP Sbjct: 558 PPPPPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPSRPRPIITPKPIPPRATYLPPP 614 Score = 36.7 bits (81), Expect = 0.96 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAP 802 + PPPPPP P P PPPP P Sbjct: 75 YPAPPPPPPPPPPPPPPPPPPPPRVSTP 102 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL------PPPAXXXXPP 859 P PPPP P PPPP P PP+ PPP PP Sbjct: 485 PSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPP 534 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P L PP P Sbjct: 487 PPPPPPP-----PPPPRPPPP--PPPPSQPPPTSLTPPVTYSYP 523 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 P PPPPP P PP PP AP +LPP Sbjct: 76 PAPPPPP----PPPPPPPPPPPPPPPRVSTPAPTYLPP 109 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXP-XPSXPPPPXXXAPXXXPXRP---PLPPPAXXXXPP 859 PP PP P PS PP P P RP P PPP PP Sbjct: 448 PPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPP 496 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P PP PPP PP Sbjct: 50 PKVPFGLPSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPP 91 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P P P PPPP P P P PPP P Sbjct: 477 PPSRPPSSPSPPP-PPPPPPPPRPPPPPPPPSQPPPTSLTPP 517 Score = 33.9 bits (74), Expect = 6.8 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 5/82 (6%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAP-----PFLPPXXXXPPXXXXXXXXX 884 S P PPPPP P PP PP P P PP PP Sbjct: 483 SSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPS 542 Query: 885 XXXXXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 543 PPPPPSLPVTYNYPSPPPPPPP 564 >UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome virus|Rep: Wsv239 - White spot syndrome virus (WSSV) Length = 127 Score = 48.4 bits (110), Expect = 3e-04 Identities = 22/47 (46%), Positives = 23/47 (48%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PP P PP P PS PPPP P P PP PPP+ PP Sbjct: 31 FPPPFPFPPPFVPPPPPSPPPPPPFVVPEPFPFVPP-PPPSPPPPPP 76 Score = 43.6 bits (98), Expect = 0.008 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPP P P PPPP P P P+PP Sbjct: 71 PPPPPPFVVPVPFPFVPPPPPSPPPPPPPFVVPVPP 106 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 7/51 (13%) Frame = +2 Query: 728 PPPPPPXXXXXPXP-------SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P S PPPP P P PP PPP+ PP Sbjct: 49 PPPPPPFVVPEPFPFVPPPPPSPPPPPPFVVPVPFPFVPP-PPPSPPPPPP 98 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P P P PP PPP PP Sbjct: 65 PPPPPS--PPPPPPFVVPVPFPFVPPPPPSPPPPPPPFVVPVPP 106 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 P PPPPP P PPPP +P P PP P PPA PP Sbjct: 453 PAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PPPPP P P P PP P AP P PP PPP PP Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPPCPP 502 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P PS PPPP P P PP PPPA P Sbjct: 450 PSPPAPPPPPPVPSPSGPPPP-PPPPAPSPPAPPPPPPAPSPPAP 493 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 467 PPPPPPPPAPSPPAP--PPPP----PAPSPPAPPPPPPPCPPAPP 505 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P+ PPPP +P P PP P P+ PP Sbjct: 439 PSPPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPP 483 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPPP P P PPPP AP R PPPA Sbjct: 479 PAPPPPPPAPSPPAPPPPPPPCPPAPPKTRSR-HAPPPA 516 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP P PP PP PP Sbjct: 465 SGPPPPPPPPAPSPPAPPPPPPAPSPPAP-----PPPPPPCPPAPP 505 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPP PP PP P PP PP Sbjct: 451 SPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPP 497 >UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreococcus|Rep: Homology to unknown gene - Ostreococcus tauri Length = 1931 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 1809 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPP--PPSPPPSPPPSPP 1851 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS PP P P P PP PPP+ PP Sbjct: 1813 PPPSPPPSPPPSPPPSPPPSPPPSPPPPSP--PPSPPPSPPPSPP 1855 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPP +P P PP PPP+ PP Sbjct: 1825 PPPSPPPSPPPSPPPPSPPPSPPPSPPPSPP-PPSPPPSPPPSPP 1868 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP--PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PS P PPP P P PP PPP P Sbjct: 1817 PPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSP 1863 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP PPPP P PS PP P +P P PP PPP+ Sbjct: 1834 PPSPPPPSPPPSPPPSPPPSPPPPSPPPSP--PPSPPPS 1870 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P P PP +PP PP PP Sbjct: 1812 SPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPP 1857 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P P PP +PP PP PP Sbjct: 1816 SPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPP 1861 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S P PPP P P PP PP PP PP P Sbjct: 1812 SPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPP 1857 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S P PPP P P PP PP PP PP P Sbjct: 1816 SPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPP 1861 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PS PPPP P P PP P P PP Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2122 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P PS PPPP P P PP PP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPP 121 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PS PPPP P P PP P P PP Sbjct: 2084 PPPPSPPPPSPPPPPS-PPPPSPPPPSPPPPSPPPPSPPPPSPPP 2127 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PPPP P P PP PPP P Sbjct: 2072 PPSPPPPSPPPSPPPPSPPPPSPPPPPSPP--PPSPPPPSPPPP 2113 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PPP P P PP P P PP Sbjct: 2073 PSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPP 2117 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPP P P P PPP P P PP PP A Sbjct: 88 PPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPGA 126 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PP P +P P PP PP PP Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPP P P PPPP P P PP P Sbjct: 2094 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P PPPP P P PP PPP Sbjct: 1869 PPPSPPP-------PPSPPPPSPPPPSPPPPSPPPPPP 1899 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA 799 PPPP PP P PS PPPP A Sbjct: 1674 PPPPSPPPSPPPPSPSPPPPPPGKA 1698 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P P P PP PP PP Sbjct: 2083 SPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP +PP PP PP Sbjct: 83 SPPPSPPPP--PSPPPPPSPPPPPSPPPPSPPPSPP--PPSPPPPP 124 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXA 799 PPPP P P PS PPPP A Sbjct: 1879 PPPPSPPPPSPPPPSPPPPPPGKA 1902 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP PP PP PP PP PP Sbjct: 2074 SPPPPSPPPSPPPPSPPPPSPPPPPSPP-PPSPPPPSPPPPSPPPP 2118 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA 799 P PPPP P PS PPPP A Sbjct: 104 PSPPPPSPPPSPPPPSPPPPPGAGA 128 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PP P P P PP Sbjct: 1869 PPPSPPPPPSPPPPSPPPPSPPPPSPPPPPP 1899 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 48.4 bits (110), Expect = 3e-04 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP AP P PP PPPA PP Sbjct: 526 PPPPPPPPPPKAPPPKGPPP--KVAPPPPP--PPPPPPAPGKLPP 566 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P + PPPP + P PPP P Sbjct: 368 PPPPPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPP 411 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP P PPP PP Sbjct: 368 PPPPPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPP 411 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PPPP P P + PPP PP Sbjct: 517 PAPPQKGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPPPPP 559 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PPPPPPP P PP P P PP PP Sbjct: 365 SGLPPPPPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPPIKAPPPMPSLPGAAATKGL 424 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 425 PIGNAPPAPPPPPPPPPP 442 Score = 37.1 bits (82), Expect = 0.73 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP 823 PPPPPPP PPPP AP P P Sbjct: 384 PPPPPPPPPMFAGKMKAPPPPPIKAPPPMPSLP 416 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPP------PXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P PS P P AP P PP PPP P Sbjct: 401 PPPPPIKAPPPMPSLPGAAATKGLPIGNAPPAPPPPPPPPPPGQAKAP 448 >UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17; n=2; Caenorhabditis|Rep: Putative uncharacterized protein grl-17 - Caenorhabditis elegans Length = 393 Score = 48.4 bits (110), Expect = 3e-04 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 87 GGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGG 132 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGGGGGG Sbjct: 88 GGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGG 133 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGGGGG Sbjct: 88 GGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGG 132 Score = 43.2 bits (97), Expect = 0.011 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 93 GGCGGGGGGCGGGGGCGGGG----GGGCGGGGGGGCGGGGGGGGGG 134 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GGG G G G GGGG G G GGGGGGG Sbjct: 85 SGGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGG 123 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G G GGGGG Sbjct: 86 GGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGG 129 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G GGGG G G GGGGGGG Sbjct: 87 GGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGG 131 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GGGGGGG Sbjct: 92 GGGCGGGGGGCGG--GGGCGGGGGGGCGGGGGGGCGGGGGGGGGG 134 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG G G G G GG G G GGGGGG Sbjct: 91 GGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGG 134 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 830 EGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 + GGG GGG GG G G GGG GGGG Sbjct: 84 QSGGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGG 120 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GG GGG GG G G GGGGGGG Sbjct: 86 GGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGG 123 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG 729 GG G G GGGG GGG G G G GG GG Sbjct: 100 GGCGGGGGCGGGGGGGCGGGGGGGCGGGGGGGGGGYASGGSGG 142 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 429 PPPPPPPGMGGAPPPPPPPPPGMGG---GPPPPPPPPPGPGGGPP 470 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP PP Sbjct: 443 PPPPPPPGMGGGPPPPPPPPP---GPGGGPPPPPPPPGGGPPGPP 484 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPP P P PPPP P PP PPP PP Sbjct: 413 FSGPPPPPPPPGGVPPPPPPPPPGMGG---APPPPPPPPPGMGGGPP 456 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P P PP Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPP 472 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P P P PP Sbjct: 455 PPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPPPAQLPP 492 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP----XRPPLPPPAXXXXPP 859 PPPPPP P P PPP P P PP PPP PP Sbjct: 444 PPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPPPAQLPP 492 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFL---PPXXXXPP 857 S PPPPPPP P PP P PP + PP PP Sbjct: 414 SGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPP 462 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P PPPP P P + P Sbjct: 469 PPPPPPPPGGGPPGP--PPPPAQLPPGFAPKKKYKP 502 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP P P PP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPP--PPEPEPQPAPPPP 84 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P PPPP AP P P +P A Sbjct: 1950 PPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTPLMPTSA 1988 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P P PPPP P P P PP P Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQP 92 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP P P PP PPPA PP Sbjct: 1942 PPRPPTLA--PPPPPPPPP----PTEDPPPPPPPPPAEAPPPP 1978 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPP P + L P Sbjct: 63 PPPPPPPPPPPEPEPQPAPPPPETPSQSQPQQSLLQP 99 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPP P PP PP P PP P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPP +P P P Sbjct: 1950 PPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PPPP AP P PP PPP P Sbjct: 786 PPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEP 829 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPAXXXXPP 859 PP PPP P P PPPP AP P PP P PA PP Sbjct: 760 PPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPP 804 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P+ P PP AP P PP PPPA PP Sbjct: 760 PPAPPPP---PAPAPAPPAPPPPPAPAPAPPAPP-PPPAPAPAPP 800 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P+ PPPP P PP P PA PP Sbjct: 773 PPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPP 817 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P P P P P PP Sbjct: 800 PAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPP 844 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P P P PP+PPP PP Sbjct: 817 PPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPP 862 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXX-PXRPPLPPPAXXXXPP 859 P PP P P P PPPP AP P PP P PA PP Sbjct: 747 PSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPP 791 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PP P P P P P PA PP Sbjct: 776 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPP 819 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P+ PPP P P P P P P Sbjct: 799 PPAPPPPPA---PAPAPAPPPPPPPPPPRPELEPEPEPEPEPEP 839 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 7/51 (13%) Frame = +2 Query: 725 PPPPPP-------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P PP P P +P PPP P Sbjct: 818 PPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQPPPPPPEQKP 868 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P P +PP P P PP Sbjct: 812 PAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPP 855 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 48.4 bits (110), Expect = 3e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 54 PPPPPPP--PPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPP 96 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP PP PPP PP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPP 97 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP PPPP P P PPL PA Sbjct: 67 PPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKPA 105 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPP----PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPPP P P P + P PP Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPP-PQIEPDKFEEAPP 85 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P P PPP P P PP PPP PP Sbjct: 26 PCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPP 73 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P PPP P +PP PPP PP Sbjct: 22 PCPCPCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPP 66 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPPPPP P PP P PP PP PP Sbjct: 58 PPPPPPP-----PPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPP 96 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 48.4 bits (110), Expect = 3e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P PP PPP PP Sbjct: 590 PPPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPP 634 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 743 PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P PPLPPPA PP Sbjct: 581 PSLSGGPPPPPPPPPPITGSCPPPPPPPLPPPATGSCPP 619 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP S PPPP P PP PP A Sbjct: 602 PPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPPPLA 639 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P PPPP P PPL P Sbjct: 604 PPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPPPLAAP 641 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPPPPPP PP PP PP PP Sbjct: 584 SGGPPPPPPPPPPITGSCPPPPPPPLPPPATGSCPPPPPPP 624 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPPPPPP PP PP PP PP Sbjct: 600 SCPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPPP--PP 637 >UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - Bovine herpesvirus 1 Length = 3247 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P P+ P PP AP P PPLPPPA PP Sbjct: 2623 PAPPLPPPAPPLPPPAPPLPPP--APPLPPPAPPLPPPAPPLPPP 2665 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P P PP AP P PPLPPPA P Sbjct: 2628 PPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPSTAP 2671 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPP AP P PPLPPPA PP Sbjct: 2613 PPVPPGPRLPPAPPLPPP----APPLPPPAPPLPPPAPPLPPP 2651 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P P PP AP P PPLPPPA PP Sbjct: 2614 PVPPGPRLPPAPPLPPPAPPLPPPAPPLPPPAPPLPPPAPPLPPP 2658 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 737 PPPXXXXXPXPSXPPPPXXX-APXXXPXRPPLPPPAXXXXPP 859 PPP P PP P AP P PPLPPPA PP Sbjct: 2603 PPPASLVSAAPPVPPGPRLPPAPPLPPPAPPLPPPAPPLPPP 2644 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP PPP P P PPP AP PPLPPPA Sbjct: 2646 PPLPPPAPPLPPPAPPLPPPAPSTAPV---PAPPLPPPA 2681 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP PPP P P+ P PP P P P P PA Sbjct: 2660 PPLPPPAPSTAPVPAPPLPPPALTPALTPAPTPAPTPA 2697 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPX----PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P+ PP P AP P RP PP PP Sbjct: 2833 PAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPERPAPP 2881 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P + P P P P P P PA PP Sbjct: 2656 PPPAPPLPPPAPSTAPVPAPPLPPPALTPALTPAPTPAPTPAPP 2699 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +2 Query: 725 PPPPPPPXXXXXPX----PSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPP P P P+ PP P AP P R P PPPA Sbjct: 2842 PAPPPAPERPAPPPAPERPAPPPAPERPAPPPAPER-PAPPPA 2883 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P+ PP P AP P RP PP PP Sbjct: 2820 PLPPSRVQAPVDAPAPPPAPERPAPPPAPERPAPPPAPERPAPP 2863 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P PPP A P P P P P Sbjct: 2661 PLPPPAPSTAPVPAPPLPPPALTPALTPAPTPAPTPAPPLPLPAP 2705 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 48.0 bits (109), Expect = 4e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP PP P PS PP P P P PP PPP Sbjct: 490 PPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPP 527 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P P PP +P P PP PPP PP Sbjct: 1683 PPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPP 1727 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS PPP +P P PP P PA PP Sbjct: 204 PPPPPPSPFPPSPPPSPAPPP--PSPLPPPPLPPPPSPAPSPPPP 246 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXP 856 PPPP PP P PS PPPP P P PP+P PP P Sbjct: 501 PPPPSPPPSPFLPPPSLPPPPPPSPP--PPSAPPIPLPPGYWQTP 543 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P P PPPP P P PP PPP Sbjct: 693 PPPSPPPPSPPSPPPPSPPPPPSPPP---PSLPPSPPP 727 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PP P P P P PPP+ PP Sbjct: 201 PPSPPPPPPSPFP-PSPPPSPAPPPPSPLPPPPLPPPPSPAPSPP 244 Score = 42.7 bits (96), Expect = 0.015 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPP P PPPP P P PP PPP Sbjct: 213 PPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPPP 249 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP---PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PPP P P PP PP PP Sbjct: 1226 PPPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLP--PPSSPPPSPNPPP 1271 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P PPPP P P P P P PP Sbjct: 1230 PPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPP 1274 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPP P P P PP PP Sbjct: 1235 PPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPP 1279 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPP P +P P PP PPP P Sbjct: 1236 PSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPP 1281 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PPPP P P LPPP PP Sbjct: 488 PSPPPPT----PPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPP 527 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP SP P PP Sbjct: 500 PPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPP 532 Score = 39.9 bits (89), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PP PPPP P P PPP P P P PP Sbjct: 496 PPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPP 532 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PP PPPP P P+ PPPP P P PPL Sbjct: 846 PPSPPPPLPPPPPPPNSPPPPYDPPP---PPSPPL 877 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPP 838 P P PPP P PS PP PP P P PP PPP Sbjct: 1441 PSPSPPPSPPPSPPPSPPPLQPPPSPPPPLLP--PPFPPP 1478 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-PPLP--PP 838 PPP PPP P PPPP P P PPLP PP Sbjct: 1449 PPPSPPPSPPPLQPPPSPPPPLLPPPFPPPPNSPPLPSFPP 1489 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXX--PXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP P PS PPP P P PP P P Sbjct: 1244 PPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPPLP 1283 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPP PPP P PP PP PP PP P Sbjct: 495 PPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPPIPLPP 537 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PP PPP P P PPPP P P PP PP Sbjct: 846 PPSPPP-----PLPPPPPPPNSPPPPYDPPPPPSPP 876 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP P P PP PP PP PP PP Sbjct: 486 SEPSPPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPP 532 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPP 838 PP PPPP P P+ PP PP +P P P PPP Sbjct: 1694 PPSPPPP---SPPPPASPPLLPPAPPSPPPPPDPAPPPPP 1730 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPP +P P PP Sbjct: 216 PPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP SP P PP Sbjct: 692 PPPPSPPPPSPPSPPPPS-PPPPPSPPPPSLPP 723 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXA--PPFLPPXXXXPP 857 S PP PPPP P PP PP + PP PP PP Sbjct: 1233 SPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPP 1280 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPP P P PP Sbjct: 846 PPSPPPPLPPPPPPPNSPPPPYDPPPPPSPP 876 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F P PPP P PS PP P P P P LPPP Sbjct: 1440 FPSPSPPP-----SPPPSPPPSPPPLQPPPSPPPPLLPPP 1474 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 760 PXPXXXXPPXXXXPP--PXXXPPPPSSPRXPXXPP 858 P P PP PP P PPPP+SP P PP Sbjct: 1455 PSPPPLQPPPSPPPPLLPPPFPPPPNSPPLPSFPP 1489 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPP-PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP PP P PP PP PP PP PP Sbjct: 1225 SPPPPPPPSPPPSPPPPSPPPTPPPPLSPP--PSLPPPSSPPPSPNPP 1270 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP LPP P Sbjct: 199 SKPPSPPPPPPSPFP---PSPPPSPAPPPPSPLPPPPLPPPPSPAP 241 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPP P PP P P P PP P P Sbjct: 1695 PSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPPPPGP 1732 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPP P P PP PP P P PP Sbjct: 203 SPPPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPP PPP P PP PP +PP PP Sbjct: 691 SPPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPP--PP 728 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P PP PPP P Sbjct: 692 PPPPSPPP----PSPPSPPPPS-------PPPPPSPPPPSLPPSP 725 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPP SP P PP Sbjct: 685 PLSRSPSPPPPSPPPPSPPSPPPPSPPPPPSPP 717 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXP 855 P P P PPP PPPPS P P P Sbjct: 697 PPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPP 728 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSP 837 P P PP PPP PPPP SP Sbjct: 850 PPPLPPPPPPPNSPPPPYDPPPPPSP 875 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PP PPPP P PP PP PP P Sbjct: 691 SPPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 761 PXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PS PP PP P P +PP PP PP Sbjct: 1441 PSPSPPPSPPPSPPPSPPPLQPPPSPPPPLLPPP 1474 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 48.0 bits (109), Expect = 4e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 F PPPPPPP P P PPPP P P +PP Sbjct: 230 FAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR 820 PPPPPPP P P PPPP P P R Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPFQPPR 266 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P PP Sbjct: 233 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQPP 265 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P P Sbjct: 232 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPFQP 264 >UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Rickettsia bellii|Rep: Cell surface antigen Sca2-6 - Rickettsia bellii Length = 909 Score = 48.0 bits (109), Expect = 4e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P P PP+ P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PP 838 PPPPPP P P PPPP P P PPLP PP Sbjct: 44 PPPPPP-----PPPPPPPPPPPPPPPPTPPPPPLPKTPP 77 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P+ P P Sbjct: 48 PPPPPPPPPPPPPPPPPPTPPPPPLPKTPPVDP 80 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 761 PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPPP P P PP PPP P Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTP 76 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PP P P P PP Sbjct: 45 PPPPPPPPPPPPPPPPPPPPPTPPPPPLPKTPP 77 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P P PP PPP PP Sbjct: 180 PPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPP 225 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P PPPP P PP PPPA PP Sbjct: 164 PEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPP-PPPAPEPPPP 207 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX-PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P PP P P PPPP P P P PPPA PP Sbjct: 170 PPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPP 215 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P P PP P P P PPP PP Sbjct: 169 PPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPP 213 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P P PP AP P P PPP P Sbjct: 178 PEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKP 220 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P P PP P P P PPP PP Sbjct: 161 PPEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPP 205 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPP 838 PPPP P P P PPPP P P +P P PPP Sbjct: 189 PPPPGP-EPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPP 226 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P PP P PP PPP PP Sbjct: 157 PDNPPPEPEPAPPPPEPAPPTPEPPPPPGPEPP-PPPGPEPPPP 199 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP +P P PP P P PP Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPP-----PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P PPP +P P PP PPPA PP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPP P P S PPPP P P PPPA Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPA 121 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-----XPPPPXXXAPXXXPXRPPLPPP 838 PP PPP P P PPPP + P PPLPPP Sbjct: 49 PPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPP 91 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPPS + PP Sbjct: 87 PLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP 802 PPPPPP P S PPPP +P Sbjct: 99 PPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 +S PPPPP P P PP PP + P PP Sbjct: 80 TSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 48.0 bits (109), Expect = 4e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PPLPPP P Sbjct: 192 PPPPPPPPGARPGPPPPPPP----PGGRPSAPPLPPPGGRASAP 231 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-----PPLPPPAXXXXPP 859 PPPPPPP PS PPPP P P PP PPP PP Sbjct: 157 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPP 206 Score = 47.2 bits (107), Expect = 7e-04 Identities = 26/81 (32%), Positives = 28/81 (34%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP + FS L PPPPPPP + PPPP Sbjct: 80 PPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSN---APPPPPLPA 136 Query: 797 APXXXPXRPPLPPPAXXXXPP 859 A P PP PP PP Sbjct: 137 ARFNAPPPPPPPPTTHFNAPP 157 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P P PP Sbjct: 142 PPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPP 186 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP PP Sbjct: 179 PPPPPPP-PGARPGPPPPPPPPGARPGPPP--PPPPPGGRPSAPP 220 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPX--PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP P PP PPP PP Sbjct: 44 PAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPP 90 Score = 42.7 bits (96), Expect = 0.015 Identities = 24/81 (29%), Positives = 26/81 (32%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP + S F PPPPPP PPPP Sbjct: 105 PPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPI 164 Query: 797 APXXXPXRPPLPPPAXXXXPP 859 P PP PPP+ PP Sbjct: 165 TRSGAPPSPP-PPPSPPPPPP 184 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 8/55 (14%) Frame = +2 Query: 719 FXPPPPPPP--------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPP P PS PPPP P PP PP A PP Sbjct: 153 FNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPP 207 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP PP P PPP P P PP PPP Sbjct: 174 PPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPP 211 Score = 41.1 bits (92), Expect = 0.045 Identities = 30/102 (29%), Positives = 32/102 (31%), Gaps = 11/102 (10%) Frame = +2 Query: 587 GXATLFXXXXPPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPP---XXXX 757 G T PPPP +S G + PPPPPPP Sbjct: 17 GAQTRTFVPPPPPPPPPPRSGVGGNTPP--APPPPPLRSTVPAISPPPPPPPPPLKPSSG 74 Query: 758 XPXPSXPPPPXXXAPXXXPXR--------PPLPPPAXXXXPP 859 P P PPPP P P PP PPP PP Sbjct: 75 APCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPP 116 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP------PXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPP P P PP PPP Sbjct: 193 PPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPP 236 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-------PPLPPPAXXXXPP 859 PPPPPP P P PP AP P PP PPP PP Sbjct: 232 PPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAPPP 283 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-------XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PPPP P PP PP + PP Sbjct: 79 PPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPP 130 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPP PP P PP PP PP PP P Sbjct: 172 SPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP 216 Score = 37.5 bits (83), Expect = 0.55 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXP----SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P S PPPP + PP PP A PP Sbjct: 207 PPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPP 258 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P PPPP AP P P PPP Sbjct: 257 PPPPPAPGGRLGGPPPPPPPGGRAP-PPPRGPGAPPP 292 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 ++ PPPPPPP PP PP APP PP PP Sbjct: 140 NAPPPPPPPP-----TTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPP 194 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 195 PPPPPGARPGPPPPPPPP 212 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP A P PP P PP Sbjct: 231 PPPPPPPSTRLG---APPPPPPPGAGGRAPPPPPAPGGRLGGPPP 272 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 PPPPPPP P PP PP APP PP Sbjct: 192 PPPPPPP-----PGARPGPPPPPPPPGGRPSAPPLPPP 224 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PP P P PP PP PP Sbjct: 205 PPPPPPPPGG---RPSAPPLPPPGGRASAPPPPP-PPSTRLGAPP 245 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 48.0 bits (109), Expect = 4e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P P PP P P PP Sbjct: 951 PPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPP 995 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP PP P PS PPP P AP PP+PPP P Sbjct: 962 PPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPP 1006 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PS PPPP P PP PP PP Sbjct: 1008 PPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPLPVNNVPP 1052 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP PPPA PP Sbjct: 976 PSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPP 1022 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P PP PPP PP Sbjct: 989 PPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPP 1033 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PP P P PP PPP PP Sbjct: 998 PPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPP 1041 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP P P PP Sbjct: 974 PPPSPPP---PSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPP 1015 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPP A P PP PPP P Sbjct: 993 PPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPP 1035 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P P PP P P PP Sbjct: 962 PPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPP 1005 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PPP P P PPP+ PP Sbjct: 984 PPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPP 1029 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P PPP P P PP P P PP Sbjct: 956 PPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPP 1000 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PPP PP Sbjct: 991 PSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPP 1035 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PP P PP P P+ PP Sbjct: 777 PPPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNPSPPPPPP 819 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPP 838 PPPP P P PS PP PP P P P PPP Sbjct: 778 PPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNPSPPP 816 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P P+ PP +P +PP PP PP Sbjct: 295 PSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAPP 339 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPP P P P P PP P P PPPA Sbjct: 583 PSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPA 621 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 P PPP P P PP P P P PP PP PA PP Sbjct: 576 PLSPPPSPSPPPSPPQPPSP-PPVPPSPPSPPPSPPSPANPSPPP 619 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRP--PLPPP 838 PPP P P PS PP PP +P P P P PPP Sbjct: 579 PPPSPSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPP 619 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PP PP P PPP +P PP PP A Sbjct: 587 PSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPPAA 625 Score = 35.9 bits (79), Expect = 1.7 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PP PP P P PP PP APP P PP Sbjct: 953 SPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPS 1012 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 1013 PPPAAASPPPSPPPPPPP 1030 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P PP P PLPP PP Sbjct: 288 PPSPPLPPSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPP 331 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPP----PPSSPRXPXXPP 858 P P PP PPP PP PP SP P PP Sbjct: 949 PLPPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPP 985 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLP-PXXXXPP 857 S PPP PPP P PP PP PP+ P P PP Sbjct: 1007 SPPPPSPPP-AAASPPPSPPPPPPPSPPPPVARLPPWPPLPVNNVPP 1052 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPP PPP P P PPPP P P PPA Sbjct: 1020 PPPSPPP-----PPPPSPPPPVARLPPWPPLPVNNVPPA 1053 >UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000000741 - Anopheles gambiae str. PEST Length = 421 Score = 48.0 bits (109), Expect = 4e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 167 GGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGG 211 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G RG GGGG GGG GG G GGGGGGG Sbjct: 158 GAAQGGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGG 202 Score = 44.4 bits (100), Expect = 0.005 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGGGG Sbjct: 169 GGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGM---GGGGGGGG 211 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GG GG G G GGGGGGG Sbjct: 167 GGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGG 211 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGG G Sbjct: 170 GGYGGGGG--GGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGYG 213 Score = 41.1 bits (92), Expect = 0.045 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG----GGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GGG G G GGGGGGG Sbjct: 162 GGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGG 210 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG-GXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G G GGGGG G Sbjct: 168 GGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGYG 213 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G A GGRG G G G GGGG G G GG GGGG Sbjct: 154 GSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGG 199 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRX-GXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G +GG GG G G GGGG G G GGG GGG Sbjct: 142 GSGAGQSGGSSGGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGG 187 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG A G GR G GGGG G G GGGG GG Sbjct: 153 GGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGG 197 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G+ GG G G GG G G GGGGGGGG Sbjct: 140 GGGSGA-GQSGGSSGGSGTGAAQ-GGRGRGGGGGYGGGGGGGGGGG 183 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGG-XXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G +GG G GGG GG G G GGGG GGG Sbjct: 153 GGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGG 198 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGG--GGGGGGR 717 G G G GG GGG G G G GG GGGGGGR Sbjct: 42 GGGGPPMMRGRGGMMRGGGPPRGMGGPPRGGGPPMSRGGPYGGGGGGR 89 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GG G G GG G G GGG GGGG Sbjct: 150 GSSGGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGGG 188 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G G GG G G GGGGG G Sbjct: 141 GGSGAGQSGGSSGGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYG 185 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 48.0 bits (109), Expect = 4e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPP P P R P PPP Sbjct: 587 PPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPP---XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 553 PPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPP 600 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P PP PPP PP Sbjct: 569 PPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPP 613 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS--XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P S PPPP P PP PPP PP Sbjct: 566 PPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPP 612 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPP----XXXXXPXPSXPPPPXXXAPXXXPXRP---PLPPPAXXXXPP 859 PPPPPPP P P PPPP P P P P PPP PP Sbjct: 570 PPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPP 621 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPP--XXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PPPP AP P PP PPP P Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAP 585 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP PP PP PP PP P Sbjct: 564 TAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMP 610 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P + PPPP P P P Sbjct: 600 PPPPPPPGGMPPPPPMPGRAPPPPPGAAKPGKQKCNPTKP 639 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PP PPPP R P PP Sbjct: 592 PPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P PPP P P PP+P A P Sbjct: 585 PPPPPP----PPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPP 624 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP A P PP PPP PP Sbjct: 322 PPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPP-PPPGGLSIPP 365 Score = 46.8 bits (106), Expect = 9e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P P PPPP A P PP PPP Sbjct: 305 PPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPP 342 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP--AXXXXPP 859 PPPP P P P PPPP P PP PPP A PP Sbjct: 306 PPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPP 352 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S+ PPPPPPP PP PP A P PP Sbjct: 315 SAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPP 355 Score = 34.7 bits (76), Expect(2) = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPPP S PPPP P P L Sbjct: 335 PPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPGL 369 Score = 20.6 bits (41), Expect(2) = 1.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 587 GXATLFXXXXPPPP 628 G A LF PPPP Sbjct: 327 GPAGLFSPPPPPPP 340 >UniRef50_UPI0000DB75B1 Cluster: PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2); n=1; Apis mellifera|Rep: PREDICTED: similar to One cut domain family member 2 (Transcription factor ONECUT-2) (OC-2) - Apis mellifera Length = 770 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGGGGGG Sbjct: 172 GGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGG 217 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G GGGGGGG Sbjct: 171 GGGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGG 215 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GGGG GGG GG G G GGGGGGGG Sbjct: 166 GSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGG 204 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGG GGGG Sbjct: 179 GGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSGGGG 224 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G GGGGGGGG Sbjct: 173 GCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGG 218 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG G G GG G G GGGG GGG Sbjct: 178 GGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSGGG 223 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G GGGG GGG GG G G GGGGGGG Sbjct: 164 GSGSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGG 204 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GG GG G G GGGG G G GGGGG G Sbjct: 294 SGGSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGGGGGAG 332 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GGGG GG Sbjct: 178 GGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSGG 222 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGG---GGGGGG 720 G G G GGGG GGG GG G G GG GGGGGG Sbjct: 166 GSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGG 213 Score = 39.1 bits (87), Expect = 0.18 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXG----GXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG G G G G GGGGGGGG Sbjct: 166 GSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGG 215 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG A GG GG G G GGGG G G GGG GGG + Sbjct: 295 GGSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGG-----GGGAGGGSR 336 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG 733 GG GGG G G G GGGG G G GGGG Sbjct: 184 GGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSGGGGG 225 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG G G+ GGGG G GGGGGG Sbjct: 176 GGGGGSGGGGGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGG 219 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GGG GG GG G G GGGGG GG Sbjct: 295 GGSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGGGGGAGG 333 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G GGGG G G GGGGGGG Sbjct: 164 GSGSSGGGGGCGG-----GGGGSGGGGGSVGGGGGVGSGGGGGGG 203 Score = 36.7 bits (81), Expect = 0.96 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGX---GXXXXXGGGGGGG 724 GG +GGG GG G G GGGG G G GGGGG G Sbjct: 175 GGGGGGSGGG-GGSVGGGGGVGSGGGGGGGGSNIGGGGGGGGGGGGSG 221 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG--GGG 724 GGG G G+ GGGG G G GGGG GGG Sbjct: 152 GGGSNGNSNSSIGSGSSGGGGGCGGGGGGSGGGGGSVGGG 191 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GGG GG G G GGG G GG Sbjct: 153 GGSNGNSNSSIGSGSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGG 198 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 825 GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G GGGG G G GGGGGGG Sbjct: 241 GGSSSSGVGGGGGGGGGSGGGGGGSGGGGGGGGG 274 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GG GGG GG G G GGGG GGG Sbjct: 296 GSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGGGGGAGGG 334 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GGGGGGGG Sbjct: 211 GGGGGGGGGSGGGGGSSSSSSSSSSSSSSVGGSSSSGVGGGGGGGG 256 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GGGGGGGG Sbjct: 212 GGGGGGGGSGGGGGSSSSSSSSSSSSSSVGGSSSSGVGGGGGGGGG 257 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G GGG GGG GG G G GGG GGG R Sbjct: 295 GGSGGGAVGGAGGGNGNGGGGGGGGGGGGGGGG-----GGGAGGGSR 336 Score = 34.7 bits (76), Expect = 3.9 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGG----GXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGG G G G GGGGGGG Sbjct: 169 GGGGGCGGGGGGSGGG--GGSVGGGGGVGSGGGGGGGGSNIGGGGGGG 214 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G G G G GGG GGGG Sbjct: 144 GSSGGSGNGGGSNGNSNSSIGSGSSGGGGGCGGGGGGSGGGG 185 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G G G G G G GGG G G GGGGG Sbjct: 157 GNSNSSIGSGSSGGGGGCGGGGGGSGGGGGSVGGGGGVGSGGGGG 201 >UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01070.1 - Gibberella zeae PH-1 Length = 217 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPPP P PPPP P P P PPP P Sbjct: 60 FYPPPPPPPVIEVPCSPPPPPPPPVEKPKPKPVPKPSPPPVIEEPRP 106 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 + PP PPPP P P PPPP P P PP PPP P Sbjct: 48 YRPPLPPPPPPQFYPPP--PPPPVIEVPCSPP--PPPPPPVEKPKP 89 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAP-----XXXPXRPPLPPPAXXXXP 856 PPPPPP P P PPP P P PP PPP P Sbjct: 40 PPPPPPVIYRPPLPPPPPPQFYPPPPPPPVIEVPCSPPPPPPPPVEKP 87 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P P P P RP PPP Sbjct: 77 PPPPPPPVEKPKPKPVPKPSP---PPVIEEPRPCSPPP 111 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP P PP PPP+ PP Sbjct: 598 PPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPP 641 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PPLP PP Sbjct: 626 PPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPP 670 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP A P PP PP A PP Sbjct: 598 PPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPP 642 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PP PPP PP Sbjct: 609 PPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPP 653 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP P A PP Sbjct: 612 PPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPP 656 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP PPP PP Sbjct: 640 PPPPPPPL----PGAGPPPPPPPPLPGAGPPPPP-PPPLSGAGPP 679 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP A P PPLP PP Sbjct: 613 PPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPP 657 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP + P PP P P PP Sbjct: 611 PPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPP 655 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P PPP P P PP+P Sbjct: 653 PPPPPPPLPGAGPPPPPPPPLSGAGP---PPPPPMP 685 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 8/47 (17%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXP------SXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P P S PPPP P PP PPPA Sbjct: 573 PPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPA 619 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP----LPPPAXXXXPP 859 PPPPPPP P + P P P PP +PPP PP Sbjct: 569 PPPPPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPP 617 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +2 Query: 707 LXXXFXPPPPPPPXXXXXPXPSXPPPPXXXAP----XXXPXRPPLPPP 838 L F PPPPPPP P P PPP +P P PPLPPP Sbjct: 184 LFPLFPPPPPPPPPPPFSPPPPPSPPPSLFSPPPFFSPPPSFPPLPPP 231 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = +2 Query: 707 LXXXFXPPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 L + PPPP PPP P PPPP P P PP PPP+ PP Sbjct: 166 LSPPYFPPPPPLPPPPFPLFPL-FPPPPPPPPPPPFSPPPPPSPPPSLFSPPP 217 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP P P PP PPP PP Sbjct: 161 PPSPPLSPPYFPPPPPLPPPPFPLFPLFPPPPPPPPPPPFSPPPP 205 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPPP P PP P PP PP P Sbjct: 190 PPPPPPPPPPFSPPPPPSPPPSLFSPPPFFSPPPSFPPLPPPP 232 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 719 FXPPPPP-PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 F PPPPP PP P P PPP P PLP P P Sbjct: 200 FSPPPPPSPPPSLFSPPPFFSPPPSFPPLPPPPYFSPLPLPPFFLLP 246 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP+ PP Sbjct: 189 PPPPPP---PPPPPFSPPPPPSPPPSLFSP-PPFFSPPPSFPPLPP 230 >UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|Rep: Formin 1,2/cappuccino - Aedes aegypti (Yellowfever mosquito) Length = 891 Score = 47.6 bits (108), Expect = 5e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P PPLPPP PP Sbjct: 297 PPPPPLPPPLPPPHP-PPPPPMFKTAVAPPGPPPLPPPPPPPPPP 340 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P S PP P PP PPP Sbjct: 331 PPPPPPPPPPPPISSVSIPPSTSGGPPAPPLPPPPPP 367 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP S PP P P PP PPP Sbjct: 332 PPPPPPPPPPPISSVSI-PPSTSGGPPAPPLPPPPPPP 368 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 11/49 (22%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-----------XPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP AP PP PPP Sbjct: 335 PPPPPPPPISSVSIPPSTSGGPPAPPLPPPPPPPTAPLAVGSGPPAPPP 383 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP PP P P P PP PP + PP Sbjct: 307 PPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPP-PPISSVSIPP 350 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP---XXXPXRPPLPPPAXXXXPP 859 PP PPP P P PP P P PPLPPP P Sbjct: 324 PPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPPAPPLPPPPPPPTAP 371 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX---PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PP P P P PP P A PP Sbjct: 336 PPPPPPPISSVSIPPSTSGGPPAP----PLPPPPPPPTAPLAVGSGPP 379 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPP P P PP+ PP Sbjct: 311 PPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPP 357 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PP PP PPPP P P PP PP Sbjct: 281 PPQAPPLVSSAVEAETPPPPPLPPPLPPPHPPPPPP 316 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 47.6 bits (108), Expect = 5e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP A P PP PPP PP Sbjct: 254 PPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPP 298 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 283 PPPPPPP----PPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP P P P PPP PP Sbjct: 271 PPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVP-PPPRGPPPPP 314 Score = 40.7 bits (91), Expect = 0.059 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPPP P P PPP P P + P+ Sbjct: 286 PPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPI 320 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXP 855 P P PP PPP PPPP P P P Sbjct: 285 PPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXP 846 P P PP PPP PPPP P+ P Sbjct: 291 PPPPPPPPPPKGVPPPPRGPPPPPPPKAP 319 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 ++ PPPPPPP PP P APP PP PP Sbjct: 250 TAPPPPPPPPPSKQQQQQQVVPP--PPAPSAKGGAPPPPPPPPPPPP 294 >UniRef50_Q2GUA6 Cluster: Predicted protein; n=2; Pezizomycotina|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 302 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGGGGGG Sbjct: 67 GGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGGGGGGGGG 112 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGGGGGG Sbjct: 66 GGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGGGGGGGG 111 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GGGG G G GGGGGGG Sbjct: 66 GGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGGGGGGG 110 Score = 43.6 bits (98), Expect = 0.008 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 72 GGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGG----GGGGGGG 112 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 R GGGG GGG GG G G GG GGGGG Sbjct: 60 RHHTGGGGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGG 99 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G G GGGG G G GGGGGG Sbjct: 64 GGGGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGGGGGG 109 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGG----GGGGGG 720 G G GGGG GGG GG G G GG GGGGGG Sbjct: 64 GGGGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNKGVGGGGGG 109 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G GGGGGGG Sbjct: 71 GGGAGNGGGGGNGGGGGNGGGGGNGGGG----GNKGVGGGGGGGG 111 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 825 GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG G G GGGG G G GGG GGG K Sbjct: 64 GGGGGGGGGGAGNGGGGGNGGGGGNGGGGGNGGGGGNK 101 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 47.6 bits (108), Expect = 5e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P P P L PP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPP--------PPPPPPPPPPPSLLPP 93 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P PPPP P P PP PPP P Sbjct: 56 PPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 44.0 bits (99), Expect = 0.006 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 11/58 (18%) Frame = +2 Query: 719 FXPPPPPPPXXXXXP-----------XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPPP P S PPPP P P PP PPP PP Sbjct: 27 FSPPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 84 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 11/56 (19%) Frame = +2 Query: 725 PPPPPPPXXXXX-----------PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PPP PP Sbjct: 33 PPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 F PPPPP P P PPPP P P PP PPP+ Sbjct: 52 FMASPPPPPP---PPPPPPPPPPPPPPPPPPPPPPPPPPPS 89 Score = 41.5 bits (93), Expect = 0.034 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P PPPP P P P Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSLLPPHSDAP 98 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 +S PPPPPPP P PP PP P LPP P Sbjct: 54 ASPPPPPPPP-PPPPPPPPPPPPPPPPPPPPPPPPPSLLPPHSDAP 98 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP 823 PPPPPPP P P PPP P +P Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSLLPPHSDAPFQP 101 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P PP AP R P Sbjct: 73 PPPPPPPPPPPPPPPPSLLPPHSDAPFQPEERVSSP 108 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP RPP PPPA PP Sbjct: 248 PPPPPPPPSSSLPPPPPPPPPSST-------RPPPPPPAQTTPPP 285 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS---XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS PPPP P PP PPP+ PP Sbjct: 228 PPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPP 275 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PP PPPPSS R P PP Sbjct: 246 PAPPPPPPPPSSSLPPPPPPPPPSSTRPPPPPP 278 Score = 36.3 bits (80), Expect = 1.3 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPP-----PXXXXXPXPSXPPPPXXXAPXXXPXR---PPLPPPAXXXXPP 859 PPPPPP P P P PPP A P R LPPP+ PP Sbjct: 176 PPPPPPSHTPKPPPSHSPKPPPPPPISHSAAASLPRRTLPSRLPPPSHTPSPP 228 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP S P P P P PP PPP+ PP Sbjct: 193 PKPPPPPPISHSAAASLPRRTLPSRLPPPSHTPSPPPPPPPSHTPAPP 240 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P + PPP P P PP PPP PP Sbjct: 227 PPPPPP-----PSHTPAPPP----PSHTPAPPPPPPPPSSSLPP 261 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 47.6 bits (108), Expect = 5e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPP----XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP A P PP PPP PP Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPP 535 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP + P PP P PP Sbjct: 506 PPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPP 550 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P + PPP P PP PPPA Sbjct: 501 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA 540 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP AP P PP A PP Sbjct: 500 PPPPPPP-----PPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPP AP P PPP P Sbjct: 520 PPPPPPP----PPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP 559 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPA 841 PPPPPP PPPP +P P PLP PA Sbjct: 534 PPPPPPAPIEGGGGIPPPPPPMSASPSKTTISPAPLPDPA 573 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 47.2 bits (107), Expect = 7e-04 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP--PAXXXXPP 859 PPPPPPP P PPPP A P PPLPP PA PP Sbjct: 612 PPPPPPPIPGMMTGPPSPPPPPLVATVVGPP-PPLPPGGPAALPLPP 657 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P P PP Sbjct: 583 PPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPP 627 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P A PP Sbjct: 598 PPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPP 642 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP P PP P P PP Sbjct: 570 PPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPP 613 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P P PP Sbjct: 556 PPPPPPPPMPGIMQP--PPPPPMPGMMSGPPPPPPPMPEMMSGPP 598 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-------SXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P P S PPPP P PP PPP Sbjct: 559 PPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPP 603 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PPPP P PP+P PP Sbjct: 542 PPSPPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPP 586 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPP---LPPPAXXXXPP 859 PPP PPP P PS PP PP +P P PP +PPP+ PP Sbjct: 148 PPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPP 196 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P PS PPP P P P PPLPPP P Sbjct: 132 PSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDP 176 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXP---PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PPP PPP P P P PPP P P PP PP+ PP Sbjct: 185 YMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPP 234 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P PS PPPP AP P PP+PPP P Sbjct: 118 PPNVPPSIPSPSPVPSPPPPPSPFAPEPSPP-PPMPPPPTPPPP 160 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PPPP P P PP P PP Sbjct: 33 PPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPP 77 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P PP P P P PPP+ PP Sbjct: 145 PSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPP 189 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P P P P PPP P Sbjct: 164 PPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQP 208 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPP P P P +PP PPP P Sbjct: 196 PNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSP 242 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPP PPP PS PP P P P P+P PP Sbjct: 211 FSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPP 257 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PS PPPP P PP PPP PP Sbjct: 162 PSPPPLPPPPWSPDPSPPPPPSPYMP------PPSPPPHPPNQPP 200 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P PS PPP P P P PPP P Sbjct: 40 PPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPPTTPSP 83 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPP--LPPPAXXXXPP 859 P PPPP P PS PP PP P P +PP PPP+ P Sbjct: 176 PSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSP 222 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXX--PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PS PPPP P P P PPP+ PP Sbjct: 21 PPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPP 66 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX-PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P S PPPP +P P PP PP+ P Sbjct: 57 PPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSP 102 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P P PPP P PP PP+ P Sbjct: 85 PPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSP 130 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPP P PS PP P +P P PPL PP P Sbjct: 252 PSAPPPTQPPPSPVPSTPPSPQPVSPPPSP-EPPLQPPPNVPYP 294 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/50 (42%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPP--PPXXXAPXXXPXRPP-LPPPAXXXXPP 859 PPP PP P P PS PP PP P P PP +P P+ PP Sbjct: 86 PPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPP 135 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PP P P PPP P P PP PPP Sbjct: 21 PPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPP 58 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 729 PPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPP P PP PP PPF PP P Sbjct: 178 PPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPP 219 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P PP P P PP +P P PP PP P Sbjct: 159 PPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPP 202 Score = 36.7 bits (81), Expect = 0.96 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPP----PPPXXXXXPXPSXPP--PPXXXAPXXXPXRPP--LPPPAXXXXPP 859 PPPP PPP P PP PP P P PP PPP+ PP Sbjct: 179 PPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPP 231 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PPP P P P P PP PP Sbjct: 73 PSPPPPTT---PSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPP 114 Score = 35.9 bits (79), Expect = 1.7 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPP--XXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPP-AXXXXPP 859 PP P PP P PS PP PP +P P PP P P A PP Sbjct: 99 PPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPP 148 Score = 35.9 bits (79), Expect = 1.7 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPX---PSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPP PP P PS PPP P AP P P PPP+ P Sbjct: 220 FSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPP-PTQPPPSPVPSTP 269 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPX--PSXPPPPXXXAPXXXPXRPP-LPPPAXXXXPP 859 PPPP P P P PP P +P P PP +PPP+ P Sbjct: 75 PPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVP 122 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP PS PPP P P PP P P P Sbjct: 238 PPSSPPPSPVPSAPPSAPPPTQPP-PSPVPSTPPSPQPVSPPPSP 281 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP--PAXXXXPP 859 PPPP P P P P PPP P P PP PP P PP Sbjct: 168 PPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPP-PPYPPSQPPPFSPPP 215 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P PP PP P P PP PP P Sbjct: 217 PPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPTQPPP 262 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPP 838 + P PPP P P PPP P P P PP PP Sbjct: 203 YPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPP 243 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXX-----PXPSXPPPPXXXAPXXXPXR-PPLPPPAXXXXPP 859 PPPP PP P P P P P P R PP P P PP Sbjct: 56 PPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPP 106 >UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep: TonB-like - Caulobacter sp. K31 Length = 245 Score = 47.2 bits (107), Expect = 7e-04 Identities = 23/49 (46%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP----XRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP AP P RPP+ PP PP Sbjct: 69 PPPPPPP----PPPPPPPPPPPTNAPPPPPAVVQPRPPIAPPPDVTPPP 113 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS--XPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P+ P PP P P PPLP P Sbjct: 80 PPPPPPPTNAPPPPPAVVQPRPPIAPPPDVTPP-PPLPIP 118 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPPPPPP P P PP PP PP PP Sbjct: 74 PPPPPPPPPPPPPTNAPPP-----PPAVVQPRPPIAPPPDVTPP 112 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPP---PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P PPP P P PP+ PP Sbjct: 84 PPPTNAPPPPPAVVQPRPPIAPPPDVTPPPPLPI-PPVKERVEQTAPP 130 >UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; Magnoliophyta|Rep: Extensin-like protein precursor - Zea mays (Maize) Length = 1188 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/46 (45%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP-LPPPAXXXXPP 859 PPPP P P S PPP +P P +PP LPPPA PP Sbjct: 1092 PPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPSLPPPAPVSSPP 1137 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PP PPPA PP Sbjct: 623 PPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPP 667 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP A P + P PPPA PP Sbjct: 566 PPPPAPVASPPPPVKSPPPPTLVASPPPPVKSP-PPPAPVASPP 608 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP A P + P PPP PP Sbjct: 550 PPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSP-PPPTLVASPP 592 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP + P + P PPPA PP Sbjct: 1028 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSP-PPPAPISSPP 1070 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP + P + P PPPA PP Sbjct: 1060 PPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSP-PPPAPVSSPP 1102 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP + P + P PPPA PP Sbjct: 1076 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSP-PPPAPVSSPP 1118 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P + P PPPA PP Sbjct: 532 PSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSP-PPPAPVASPP 576 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPP---PPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P PPPP A P + P PPP PP Sbjct: 576 PPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSP-PPPTPVASPP 624 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PP P P PP Sbjct: 1012 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPP 1056 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PP P P PP Sbjct: 1044 PPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPP 1088 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P P PP + PP Sbjct: 639 PPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPP 682 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PP P P PP Sbjct: 1028 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPP 1072 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PP P P PP Sbjct: 1060 PPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPP 1104 Score = 38.3 bits (85), Expect = 0.31 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPP-----PPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P S PPPP P P P PPP PP Sbjct: 996 PPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSP-PPPVKSPPPP 1047 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPPP P P P PPP PP Sbjct: 1021 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSP-PPPVKSPPPP 1063 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPPP P P P PPP PP Sbjct: 1037 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSP-PPPVKSPPPP 1079 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPPP P P P PPP PP Sbjct: 1053 PPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSP-PPPVKSPPPP 1095 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P P LPPP PP Sbjct: 655 PPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPP 697 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPPP P P P PPP PP Sbjct: 1069 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSP-PPPIKSPPPP 1111 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P + PPPP A P + P PPP PP Sbjct: 607 PPPPVKSPPPPTPVASPPPPAPVASSPPPMKSP-PPPTPVSSPP 649 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P P P PPP PP Sbjct: 543 PPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASP-PPPVKSPPPP 585 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PPP + P PPPA PP Sbjct: 980 PPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPP 1022 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPP +P PPP PP Sbjct: 598 PPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPMKSPPPP 642 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPP +P P PPP PP Sbjct: 633 PPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPP 674 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P S PPPP +P PPP PP Sbjct: 988 PPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPP 1031 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P S PP P P PP P P PP Sbjct: 980 PPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPP 1024 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 731 PPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P + P PPPA PP Sbjct: 516 PPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSP-PPPAPVGSPP 560 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P S PPP P PP P P PP Sbjct: 591 PPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPP 635 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P PPP LPPPA PP Sbjct: 1118 PPAPVKPPSLPPPAPVSSPPPVVTPAPPKKEEQSLPPPAESQPPP 1162 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPP +P PPP PP Sbjct: 559 PPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPP 601 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P PPP P P S PPP +P P P PP PP Sbjct: 965 PPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPP 1015 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P S PPP +P P P P P PP Sbjct: 960 PKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPP 1007 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PPP PPP P PS PPP +P P PP PPP PP Sbjct: 332 PPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPP 378 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P S PPPP P P PP PP PP Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPP-PPATAAANPP 409 Score = 44.0 bits (99), Expect = 0.006 Identities = 22/48 (45%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP P P P PP P P+ PP Sbjct: 310 PPPPPPPR----PSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPP 353 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPP + P RPP P P PP Sbjct: 357 PSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPP 401 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXAPXXXPXRP---PLPPPAXXXXP 856 PPPPPPP P P S PPPP P P P P PPP P Sbjct: 289 PPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP 339 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P S PPPP P P P PPPA PP Sbjct: 341 PPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPP 386 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P S PPPP +P P P PPP P Sbjct: 348 PSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSP 394 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P P P P P PP PP PP Sbjct: 301 PPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPP 344 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PS PPP +P P PPP PP Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPP 369 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P P PP PPP PP Sbjct: 279 PPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPP 323 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPP-----PXXXXXPXPSXPPPPXXXAPXXXPXRPP---LPPPAXXXXPP 859 P PPPP P P PS PPP +P P PP PPP PP Sbjct: 299 PSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPP 351 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPP-----PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P P P PP P P P PP + PP Sbjct: 312 PPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPP 361 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPPPP P P PP P P P RP P PPP P Sbjct: 289 PPPPPPPRVSPSP-PPPQPVSSPPPPPPPRPSPSPPPPRSSPSP 331 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PP P P PP P P PP Sbjct: 272 PPPPPRVPPSPPPPVASPPPPPPPRVSPSPPP-PQPVSSPPPP 313 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP PS P RPP PPP PP Sbjct: 395 PPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPP 439 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P + PP +P P PP PPP PP Sbjct: 242 PPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPP 291 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPP-PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P P P P PP P P+ PP Sbjct: 280 PSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPP 325 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP P P P PP PP PP PP Sbjct: 298 SPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPP 343 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P P P PP P PP Sbjct: 308 SSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPP 353 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P S PPP +P P R P P PP Sbjct: 220 PSPPPPPRVSTSPPPPARVSSSPPPATRSP--PPRRITSPSPVLTASPP 266 Score = 33.5 bits (73), Expect = 8.9 Identities = 24/111 (21%), Positives = 26/111 (23%) Frame = +3 Query: 618 PPPPKXKKNXXRGGXXXXFXXXXXXXXXXXXXXSSXPPPPPPPXXXXXPXXXXXPPXXXX 797 PPPP+ + SS PPPP P PP Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPAS 381 Query: 798 PPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXPPPXP 950 P PP PP PP PPP P Sbjct: 382 SPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPPPPP 432 >UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 442 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P+ PP PP P P PP P P+ PP Sbjct: 168 PPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPP 213 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P+ PP PP +P P P PPP+ PP Sbjct: 172 PPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPP 217 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PPP PPP P P+ PP P P P PP PPP PP Sbjct: 164 PPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPP 210 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P PPPP P P PP PP P Sbjct: 184 PPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSLPPP 227 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR---PPLPPPAXXXXPP 859 P PPP P P P PPP P P PP PPP+ PP Sbjct: 174 PNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPP 221 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PS PP PP P P PP PPP+ P Sbjct: 159 PPLSPPPPS---PPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNP 201 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPA 841 P P PP P PS PP PP P P PP PPP+ Sbjct: 155 PCPSPPLSP--PPPSPPPSPPPNPPPNPPPNPPPNPPPS 191 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 761 PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P PP PPP PP Sbjct: 157 PSPPLSPPPPSPPPSPPPNPPPNPPPNPPPNPP 189 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPP PPP P PP P +PP PP P Sbjct: 180 PPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPP 222 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPP-PXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPP P P PP P +PP PP PP Sbjct: 162 SPPPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPP 209 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PPP P P P PPP+ PP Sbjct: 782 PPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPP 827 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PS PPP P P PP PPP PP Sbjct: 808 PPLPPPPSPFPPPSPSPSPPPPSPPPPSPP--PPSPPPPSPFPPP 850 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPP P P PPPP P P PP PPPA Sbjct: 824 PSPPPPSPPPPSPPPPSPPPPSPFPPPAPP--PPSPPPA 860 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P PP P P PP Sbjct: 794 PSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPP 838 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P PP +P P PP P P PP Sbjct: 799 PSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPP 843 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPPP P P P PPPA P Sbjct: 811 PPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPP-SPFPPPAPPPPSP 857 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F PP P P P P PPPP P P PP PPP Sbjct: 817 FPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFP--PPAPPP 854 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PP P P P P PPP+ P Sbjct: 802 PPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSP 846 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP +P PPLPPP PP Sbjct: 781 PPPSPPPPNPPPLPSPPPP---SPPPPSPTPPLPPPPSPFPPP 820 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P PS PP P +P P P PPP P Sbjct: 790 PPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPP 834 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P+ P PPP P P P PP PP Sbjct: 792 PLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPP 837 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPP P PP PP PP PP PP Sbjct: 795 SPPPPSPPPPSPTPP--LPPPPSPFPPPSPSPSPPPPSPPPPSPPP 838 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PP PPPP P PP PP PP PP PP Sbjct: 805 SPTPPLPPPPSPFPPPSPSPSPPPPSPPP--PSPPPPSPPPPSPFPP 849 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PP PPPP P PP PP PP PP PP Sbjct: 779 SSPPPSPPPP---NPPPLPSPPPPSPPPPSPTPPLPP--PPSPFPPP 820 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPP---PPSSPRXPXXPP 858 P P PP PPP PP PP +P P PP Sbjct: 824 PSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPPP 859 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 500 PPPPPPPSKSSGPPPPPPPPPKSSGP------PPPPPPKSSPPPP 538 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P PPP P P + PPPA Sbjct: 501 PPPPPPSKSSGPPPPPPPPPKSSGPPPPPPPKSSPPPPA 539 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P + P PPP PP Sbjct: 488 PPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPP 532 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P P PP PPP Sbjct: 530 PPPPPPGGKGAPPPP-PPPPGKLGPGGGPPPPPPPPP 565 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-PPLPPPAXXXXPP 859 PPPPPPP P P PPPP P + PP PPP PP Sbjct: 499 PPPPPPPPGGKLPPP--PPPPGKAPPPPPGGKLPPPPPPGGKGAPP 542 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP----XRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 467 PPPPPPAAERLPAP--PPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPP 512 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 511 PPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPP--PPPPPP 548 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PP P PP PPP PP Sbjct: 480 PPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPGKAPPPP 524 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PP PP P PP PPP PP Sbjct: 467 PPPPPP-AAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPP 513 Score = 34.3 bits (75), Expect = 5.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP 787 PPPPPPP P PPPP Sbjct: 541 PPPPPPPPGKLGPGGGPPPPP 561 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXP---PXXXXPPXXXXXAPPFLPPXXXXPP 857 S+ PPPPPP P P P PP PP PP PP Sbjct: 463 SATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPP 512 >UniRef50_A0EFA7 Cluster: Chromosome undetermined scaffold_93, whole genome shotgun sequence; n=3; cellular organisms|Rep: Chromosome undetermined scaffold_93, whole genome shotgun sequence - Paramecium tetraurelia Length = 1566 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPX--PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P +PP+ PP PP Sbjct: 299 PPPPPPPSTQEQPQVPPQIPPQPPAQPPSEVPSQPPVQPPPPPIEPP 345 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP PP PS PP PP P P PP+ PP PP Sbjct: 314 PPQIPPQPPAQPPSEVPSQPPVQPPPPPIEPPKPPVEPPVQPPPPPAEPP 363 Score = 39.1 bits (87), Expect = 0.18 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PP P P +PP+ P PP Sbjct: 333 PPVQPPPPPIEPPKPPVEPPVQPPPPPAEPPKPPIDQPQPPVQPP 377 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P PPPP P +PP+ PP PP Sbjct: 337 PPPPPIEPPKPPVEPPVQPPPPPAEPPKPPIDQPQPPVQPPQPPVQPP 384 Score = 39.1 bits (87), Expect = 0.18 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PP P P +PP+ PP PP Sbjct: 372 PPVQPPQPPVQPPQPPAEPPQPPVKPPVEPPKPPVEPPQPPTEPP 416 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P +PP PP PP Sbjct: 355 PPPPPAEPPKPPIDQPQPPVQPPQPPVQPPQPPAEPPQPPVKPP 398 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PP P P PP PP PP Sbjct: 356 PPPPAEPPKPPIDQPQPPVQPPQPPVQPPQPPAEPPQPPVKPPVEPP 402 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P S PP P P +PP+ PP PP Sbjct: 471 PPKPPVEPPQQPIDSPKPPVEPPQPPTEPPKPPVEPPKPPSEPP 514 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXX--PXRPPLPPPAXXXXPP 859 P PP P P P+ PP P P P +PP+ PP PP Sbjct: 345 PKPPVEPPVQPPPPPAEPPKPPIDQPQPPVQPPQPPVQPPQPPAEPP 391 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PP P P +PP PP PP Sbjct: 379 PPVQPPQPPAEPPQPPVKPPVEPPKPPVEPPQPPTEPPKPPAEPP 423 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPP-----PPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P P PP P P +PP+ PP PP Sbjct: 355 PPPPPAEPPKPPIDQPQPPVQPPQPPVQPPQPPAEPPQPPVKPPVEPPKPP 405 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP---PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P PP P P +PP+ PP PP Sbjct: 362 PPKPPIDQPQPPVQPPQPPVQPPQPPAEPPQPPVKPPVEPPKPPVEPP 409 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PP PP PP P P PP P P +PP+ PP PP Sbjct: 425 PPVQPPQPPVDPPQPPTEPPKPPVEPPQPPVEPPKPPVEPPQPPTEPP 472 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PP PP PP P P PP P P +PP+ PP PP Sbjct: 397 PPVEPPKPPVEPPQPPTEPPKPPAEPPQPPVQPPQPPVDPPQPPTEPP 444 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PP P P +PP+ PP PP Sbjct: 415 PPKPPAEPPQPPVQPPQPPVDPPQPPTEPPKPPVEPPQPPVEPP 458 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P P P P +PP PPA PP Sbjct: 351 PPVQPPPPPAEPPKPPIDQPQPPVQPPQPPVQPP-QPPAEPPQPP 394 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PP PP PP P P PP P P +PP+ PP PP Sbjct: 390 PPQPPVKPPVEPPKPPVEPPQPPTEPPKPPAEPPQPPVQPPQPPVDPP 437 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PP P P +PP+ PP PP Sbjct: 422 PPQPPVQPPQPPVDPPQPPTEPPKPPVEPPQPPVEPPKPPVEPP 465 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PP PP PP P P PP P P +PP PP PP Sbjct: 383 PPQPPAEPPQPPVKPPVEPPKPPVEPPQPPTEPPKPPAEPPQPPVQPP 430 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 PP PP PP P P PP P P +PP PP PP Sbjct: 404 PPVEPPQPPTEPPKPPAEPPQPPVQPPQPPVDPPQPPTEPPKPPVEPP 451 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PP P P +PP PP PP Sbjct: 436 PPQPPTEPPKPPVEPPQPPVEPPKPPVEPPQPPTEPPKPPVEPP 479 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P P PP P P PP PP P Sbjct: 432 PPVDPPQPPTEPPKPPVEPPQPPVEPPKPPVEPPQPPTEPPKPP 475 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P P PP P P PP PP P Sbjct: 474 PPVEPPQQPIDSPKPPVEPPQPPTEPPKPPVEPPKPPSEPPKPP 517 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P P PP P P PP PP P Sbjct: 488 PPVEPPQPPTEPPKPPVEPPKPPSEPPKPPAEPPQPPTEPPKSP 531 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXX----APXXXPXRPPLPPPAXXXXPP 859 P PP P P PPPP P P +PP PP+ P Sbjct: 287 PQPPQNQPSIPNPPPPPPPSTQEQPQVPPQIPPQPPAQPPSEVPSQP 333 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 47.2 bits (107), Expect = 7e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PPLP A PP Sbjct: 330 PPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPP 374 Score = 46.4 bits (105), Expect = 0.001 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 312 PPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPP 349 Score = 46.0 bits (104), Expect = 0.002 Identities = 26/78 (33%), Positives = 29/78 (37%), Gaps = 4/78 (5%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP +++ L PPPPPPP P P PPPP Sbjct: 334 PPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAP-PPPPPPPGSK 392 Query: 797 APXXXP----XRPPLPPP 838 P P RPP PPP Sbjct: 393 IPGPPPPPGGPRPPGPPP 410 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP P Sbjct: 314 PPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAP 358 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P PP PP PP Sbjct: 315 PPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPP 359 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P P PPP PP Sbjct: 292 PPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPP 336 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P PP P P PP Sbjct: 328 PPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPP 372 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 344 PPPPPPP---PLPGQQAPPPPPPLPGGARPPPPP-PPPFGNAPPP 384 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPPP------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 291 PPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPP 334 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP + PPPP P + P PPP PP Sbjct: 293 PPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPP 337 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPPPPPP PP PP APP PP Sbjct: 323 SQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPP 363 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P P PP P A Sbjct: 382 PPPPPPPPGSKIPGP--PPPPGGPRP---PGPPPPPGQA 415 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXP----XXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP PP PP APP PP PP Sbjct: 287 SPPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPP 337 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPX-PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP AP PP PPP PP Sbjct: 109 PPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPP 154 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PPPPPPP + PPPP P P PP P P+ PP Sbjct: 123 YPPPPPPPPPPAPTTSKAAPPPP-PPPPPPPPPAPPAPKPSKPAPPP 168 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P P P AP P PP PPPA Sbjct: 99 PPPPPPP---PPPPPPPPAPTTTQAPQYPPPPPPPPPPA 134 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P PP P A P PP PPP P Sbjct: 72 PPPVPTTMYKAPPPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAP 115 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P P P P P P P P Sbjct: 142 PPPPPPPPPPPPPAPPAPKPSKPAPPPQPPTELPDP 177 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PPPP P PPP PP Sbjct: 89 PPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPP 133 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P PPPP AP PP PP P Sbjct: 142 PPPPPP------PPPPPPPAPPAPKPSKPAPPPQPPTELPDP 177 >UniRef50_Q2HEQ9 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 438 Score = 47.2 bits (107), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GGR G G GGGG G G GGGGG G Sbjct: 367 GGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGRGGGGGGRG 411 Score = 46.8 bits (106), Expect = 9e-04 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G RG GGGG GGG GG G G G GGGGGGR Sbjct: 365 GGGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGG-GRGGGGGGR 410 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGG G Sbjct: 366 GGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGRGGGGGGRG 411 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGG-GGGGGGR 717 RG GGGG GGG G G G GG GGGGGGR Sbjct: 362 RGGGGGGGGRGGGGGGGGRGGGGGGRGGGGGGGGRGGGGGGR 403 >UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 47.2 bits (107), Expect = 7e-04 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPPP P P P PPP PP Sbjct: 403 PPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPP 449 Score = 47.2 bits (107), Expect = 7e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P P PPP PP Sbjct: 417 PPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPP 461 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PP PP PP Sbjct: 380 PPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPP 424 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P+ PPPP P P PPP PP Sbjct: 397 PPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPP 443 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P P+ PPP P P P PPP PP Sbjct: 409 PPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPP 455 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P+ PPPP P P P PPP PP Sbjct: 423 PPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPP 467 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPP P P RPP P PP Sbjct: 195 PPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPPPGRPP 239 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP P P P PPP PP Sbjct: 368 PPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPP 412 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P PP PP PP Sbjct: 386 PPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPP 430 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PS PPPP P PP P PP Sbjct: 392 PPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPP 436 Score = 41.1 bits (92), Expect = 0.045 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP P P PS PPPP P P P PPP Sbjct: 321 PPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNPPP 357 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P PPP P P P PPP PP Sbjct: 385 PPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPP 431 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P P PPPP P P PP PPA P Sbjct: 435 PPPNEPPPPDAPPPPDAPPPPDAPPPPDEPP-PPGEPPALEGPP 477 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P PPPP P P P PP PP Sbjct: 391 PPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPP 437 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PPAXXXXPP 859 PP PP P P PP P P +PP P PPA PP Sbjct: 554 PPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPPAPPKPPP 598 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPP---PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 P PPP PP P P PP P P P PP PP P PP Sbjct: 546 PKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPPAPP 594 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP--XXXPXRPPLPPPAXXXXPP 859 PPP PP P P P P P P RPP PPA PP Sbjct: 189 PPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPPP 235 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P P+ PPPP P PPP+ P Sbjct: 177 PPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPP 220 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPP--PP----PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP PP P + PPPP P P P PPP PP Sbjct: 356 PPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPP 406 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPP-PAXXXXPP 859 PP PPP P P PP AP P +PP PP P PP Sbjct: 545 PPKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPP 591 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPP-PAXXXXPP 859 P PP PP P P PPP P P +PP PP P PP Sbjct: 555 PAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPKPPAPPKPPPFGKPP 603 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPP P P PP Sbjct: 441 PPPDAPPPPDAPPPPDAPPPPDEPPPPGEPP 471 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PP P P PPP PP Sbjct: 344 PPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPP 388 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPP-PPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S+ PPPP PP P PP PP PP PP PP Sbjct: 376 SARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPP 423 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P+ P PP P P PP P PP Sbjct: 542 PPAPPKPPPFGEP-PAPPRPPAPPRPPAPPKPPPFGKPPAPPKPP 585 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P PPA PP Sbjct: 338 PPPVRPPPPGEPPLPDNPPPP-DEPPVSGKPPPGDEPPASARPPP 381 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXP 856 PP PPP P P PP AP P +PP PP P Sbjct: 569 PPKPPPFGKPPAPPKPPAPPKPPAPPKPPPFGKPPGPPEPGKPPP 613 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---------PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPP P +P PP+ PPA PP Sbjct: 38 PPPPVRPPADNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPP 91 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P P PP Sbjct: 326 PPPGGRPPPSN--PPPPVRPPPPGEPPLPDNPP 356 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 717 SSXPPPP--PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PPP P PP PP PP PP PP Sbjct: 407 SEPPPPPNEPPPPDEPPPPNESPPP--DAPPPPNEPPPPDAPPPPDAPP 453 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PP P P PP P P P PPP Sbjct: 332 PPPSNPPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPP 369 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 734 PPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P P P PPP PP Sbjct: 379 PPPPDR---PPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPP 418 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 P P PP P PP P P P PP PP P PP Sbjct: 525 PRPGNPPALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPP 570 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P PP P P P PP+ PPA PP Sbjct: 10 PPPPGKPPPSKLEGFGKPPAPASPPPNRPP--PPVRPPADNPPPP 52 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P P P+ P PP P P PP P P Sbjct: 566 PPAPPKPPPFGKP-PAPPKPPAPPKPPAPPKPPPFGKPPGPPEP 608 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP P P PP PP PP PP PP Sbjct: 364 SGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPP 410 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 9/54 (16%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---------PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPP P +P PP+ PP PP Sbjct: 138 PPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPP 191 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PPPP P PP PP PP Sbjct: 326 PPPGGRPPPSNPPPPVRPPPP-GEPPLPDNPPPPDEPPVSGKPPP 369 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PP P +P P PP Sbjct: 332 PPPSNPPPPVRPPPPGEPPLPDNPPPPDEPP 362 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 729 PPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PPP P P PP PP PP PP PP Sbjct: 429 PPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPP 471 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPP PP P P PPPP P PP Sbjct: 447 PPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGKPP 483 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPP----PXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PP 838 PP PPP P P P PP P P P PP P PP Sbjct: 569 PPKPPPFGKPPAPPKPPAPPKPPAPPKPPPFGKPPGPPEPGKPP 612 >UniRef50_UPI00015B5EB5 Cluster: PREDICTED: similar to CG3606-PB; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to CG3606-PB - Nasonia vitripennis Length = 407 Score = 46.8 bits (106), Expect = 9e-04 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGGR Sbjct: 232 GGGGGGGGGGGGGGGRGGGGGGRGGG--RGGSGGYGGGGGGGGGGGR 276 Score = 44.8 bits (101), Expect = 0.004 Identities = 23/48 (47%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXG---GGGGGG 724 GG GGG GGR G G+ GGGG G G G GGGGGG Sbjct: 241 GGGGGGRGGGGGGRGGGRGGSGGYGGGGGGGGGGGRDRGDRNGGGGGG 288 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G RG GGGG GGG GG G G G GGGGGG Sbjct: 229 GSRGGGGGGGGGGGGGGGRGGGGGGRGGGRGGSGGYGGGGGG 270 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/49 (44%), Positives = 24/49 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG GGR G G GGG G G GGGGGGG + + Sbjct: 234 GGGGGGGGGGGGGRGGGGGGR----GGGRGGSGGYGGGGGGGGGGGRDR 278 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G GGGG G GGGGGGG Sbjct: 248 GGGGGGRGGGRGGSGGYGGGG---GGGGGGGRDRGDRNGGGGGGG 289 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G G GG G GGGGGGG Sbjct: 229 GSRGGGGGGGGGGGGGGGRGGGGGGRGGGRGGSGGYGGGGGGGGG 273 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 GG GGG GG G G G GG G G GGGGG Sbjct: 233 GGGGGGGGGGGGGGRGGGGGGRGGGRGGSGGYGGGGGGGGGGG 275 Score = 39.5 bits (88), Expect = 0.14 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXG---GGGGGGG 720 GG G RG GGG GG GG G G G GGGGGGG Sbjct: 241 GGGGGGRGGGGGGRGGGRGGSGGYGGGGGGGGGGGRDRGDRNGGGGGGG 289 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GGG GG G G GGGG G G GGG GG + Sbjct: 328 GGGGGGGGGRGGGGGGRGGGGRGGGGGFRGDRGGGRGGDR 367 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G GGGG GGG GG G G GGG GG R Sbjct: 325 GMGGGGGGGGGGRGGGGGGRGGGGRGGGGGFRGDRGGGRGGDR 367 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGGRGG G G GG G G GGGG G + + Sbjct: 353 GGFRGDRGGGRGGDRGSRGGFRGGDRGGGRGGGRGGPMRGGGGRGDRDR 401 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G GGGGGG G Sbjct: 249 GGGGGRGGGRGGSGGYGGGGGGGGGGGRDRG---DRNGGGGGGGAG 291 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGGRGG G G GGGG G GGG GG Sbjct: 327 GGGGGGGGGGRGGGGGGRGGGGRGGGGGFRG-----DRGGGRGG 365 Score = 35.5 bits (78), Expect = 2.2 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G RG G GG GGG GG G GGGGG G R Sbjct: 252 GGRGGGRG--GSGGYGGGGG---GGGGGGRDRGDRNGGGGGGGAGSR 293 Score = 34.7 bits (76), Expect = 3.9 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGX-----GXXXXXGGGGGGGGR 717 GG G G GGGG GGG G G G GGG GGGR Sbjct: 335 GGRGGGGGGRGGGGRGGGGGFRGDRGGGRGGDRGSRGGFRGGDRGGGRGGGR 386 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 G G G G GGG G G GGGGGG Sbjct: 86 GANNGSSSGNNYGGSSYGGGNTGGSGGGGGGGGGGGG 122 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GG R Sbjct: 328 GGGGGGGGGRGGGGGGRGGGGRGGGGGFRGDRGGGRGGDRGSRGGFR 374 Score = 33.9 bits (74), Expect = 6.8 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG---GGGGR 717 GG G RG+ GGG GG GG G G GG GGGGR Sbjct: 350 GGGGGFRGDRGGG---RGGDRGSRGGFRGGDRGGGRGGGRGGPMRGGGGR 396 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG + GG GG GG G GGGGGGG Sbjct: 74 GGYNQSSYGGSGGANNGSSSGNNYGGSSYGGGNTGGSGGGGGGGG 118 >UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 143 Score = 46.8 bits (106), Expect = 9e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGG 56 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 11 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSG 55 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGG GGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGG 47 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G G GGGG G G GGGGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGG 39 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGG 53 Score = 44.4 bits (100), Expect = 0.005 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGG GGGR Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGR 48 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG GG G G G GGGGG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGG 53 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GGG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRG 49 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GGG GG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGG 50 Score = 42.3 bits (95), Expect = 0.019 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGG GGGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGG 52 Score = 42.3 bits (95), Expect = 0.019 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GGG G Sbjct: 17 GGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIG 62 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GG GGG Sbjct: 26 GGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGG 69 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GGG G G G GGGGG GG Sbjct: 46 GGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGGGGAGG 91 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GGGG G G GGG GG + Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGR 48 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGG GGG Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGG 51 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GG GGG G Sbjct: 26 GGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAG 71 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GGG GG G Sbjct: 13 GGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDG 58 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGG G G GG GGG Sbjct: 17 GGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGG 60 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GGG GGG Sbjct: 28 GGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGG 73 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGG GGG Sbjct: 25 GGGGGGVGGGGGGGGIGGGDGGGRGGGGGSG-GDGGGIGGGGTGGG 69 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG--GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG GG G G GGG GGG Sbjct: 18 GGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGG 64 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGG GGGG Sbjct: 22 GGGGGGGGGVGGGG--GGGGIGGGDGGGRGGGGGSGGDGGGIGGGG 65 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXG-GXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG G G G G GGG GG G Sbjct: 32 GGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDG 78 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G+ GGG G G GGG GG Sbjct: 34 GGGGGGIGGGDGGGRGGGGGS-GGDGGGIGGGGTGGGAGGGSGG 76 Score = 35.1 bits (77), Expect = 2.9 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXG--------XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G GGG G G GGGGG G Sbjct: 38 GGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGGGGAG 90 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG--GGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G G GGG G GGGG GG Sbjct: 22 GGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGG 68 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P P PP PPP P Sbjct: 534 PPPPPPP-----PPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 572 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPPP P P PPPP A P PP PP A Sbjct: 532 PSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGA 570 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P PP P P PPLP A Sbjct: 539 PPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPGSA 577 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 743 PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PPPP P P P PP PP Sbjct: 528 PVSAPSPPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 566 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 46.8 bits (106), Expect = 9e-04 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P P P PP Sbjct: 1080 PPPPPPPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPP 1116 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP + PPPP AP P PP PPP PP Sbjct: 1063 PEFPPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPP 1107 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP----XXXPXRPPLPP 835 PPPPP P P P PPPP P P PPLPP Sbjct: 1082 PPPPPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPPAPPLPP 1122 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPP P+ PPPP P P P P PP Sbjct: 1076 FIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPAPVTGPTPPAPPLPP 1122 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP PP P PP Sbjct: 951 PPPPPPPP----PPPPPPPPPQQQFQLPSQFPPPPPTARIFLRPP 991 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P PPPP P PP PPP P Sbjct: 1066 PPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPAP 1109 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP PS PPP A P LP Sbjct: 960 PPPPPPPPQQQFQLPSQFPPPPPTARIFLRPPPTLP 995 Score = 34.7 bits (76), Expect = 3.9 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 PPPPPPP P+ P PP P + P Sbjct: 1099 PPPPPPPPPAPVTGPTPPAPPLPPGSLGSPTKKP 1132 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS P P A P PPA PP Sbjct: 840 PPPPPP----PPPPSMPTPGSAMAVLRLGPPSPAAPPAFIPPPP 879 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP P P P P PPPP PPP Sbjct: 943 PPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLPSQFPPP 980 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-------SXPPPPXXXAPXXXPXRPPL-PPPA 841 PPPPPPP P PPP P PPL PPPA Sbjct: 1287 PPPPPPPVPLVSSSPWGKSSLKKTPPPTLGRRSNATPEPPPLSPPPA 1333 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PS PP P +P P P LPPP P Sbjct: 62 PPPPPPP--PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P P PP P P P LPPPA P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP PPP P PS PPP P P PP P P+ Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPS 111 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPX--PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PPPP P P PP P P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P P P PPP P P PP PP PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPP P P PPPP P +P P P Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 P PPP P P P PPP P P P LP Sbjct: 83 PSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class, expressed; n=4; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class, expressed - Oryza sativa subsp. japonica (Rice) Length = 675 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PS PPPP + P PP PPPA PP Sbjct: 21 PPEPPPQSSSASPSPSPPPPPPTPSSPQRP--PPPPPPATPPPPP 63 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/45 (35%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P+ P A PP+ P+ PP Sbjct: 50 PPPPPPPATPPPPPPASPGKNQSPASPSQDSPPPVASPSVSSPPP 94 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPPP P PPPP P PP PPPA Sbjct: 35 PSPPPPPPTPSSPQRPPPPPP--------PATPPPPPPA 65 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PP P P + P PP Sbjct: 38 PPPPPTPSSPQRPPPPPPPATPPPPPPASPGKNQSPASPSQDSPP 82 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P+ PP P P PP PPP PP Sbjct: 81 PPPVASPSVSSPPPAPTTPPSPPPPSKSPP-PPSPPPTTSSTPP 123 >UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 17 contig 1, DNA sequence - Ostreococcus tauri Length = 281 Score = 46.8 bits (106), Expect = 9e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 719 FXPPPP-PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F PPPP PPP P P PPPP P P PP P P Sbjct: 111 FQPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSP 151 Score = 46.4 bits (105), Expect = 0.001 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPP PPP P P PPPP P P PP PP Sbjct: 119 PPPSPPPPSPPSPPPPSPPPPSPPPPSPPPPSPPPPP 155 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPP-PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPP PPP P PP PP +PP PP PP Sbjct: 110 SFQPPPPSPPPPSPPPPSPPSPPPPSPPPPSPPPPSPP--PPSPPPPP 155 >UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: KIAA1856 protein - Homo sapiens (Human) Length = 1134 Score = 46.8 bits (106), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP P P PP Sbjct: 956 PPPPPPPPHPPLPPPPLPPPP---LPLRLPPLPPPPLPRPHPPPP 997 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P P PPLP P PP Sbjct: 957 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPP--PPLPRPHPPPPPP 999 Score = 43.6 bits (98), Expect = 0.008 Identities = 22/39 (56%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-PPLPPP 838 PPPPPPP P P PPPP P P R PPLPPP Sbjct: 955 PPPPPPP----PPHPPLPPPP--LPPPPLPLRLPPLPPP 987 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P PP P P P P LPPP P Sbjct: 970 PPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPPPQTRTLP 1013 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P P P P PP PPP PP Sbjct: 959 PPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPP 1006 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P P P PPP PP Sbjct: 941 PPPRAPALPSEARAPPPPPPPPPHPPLPPPPLP--PPPLPLRLPP 983 >UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 443 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G+ GGGG G G GGG GGG Sbjct: 184 GGGGSGGGGGGGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSGGG 228 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 ++GGGG GGG GG G GGGGGGGG Sbjct: 182 KDGGGGSGGGGGGGGSGGSGGGSGGGGGGGGGGGGGGG 219 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG GG G G GGGG GGG Sbjct: 184 GGGGSGGGGGGGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSGGG 228 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGG GGG GG G G GGG GGG Sbjct: 184 GGGGSGGGGGGGGSGGSGGGSGGGGGGGGGGGGGGGGGGGGSGGG 228 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP P Sbjct: 2457 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDP 2501 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PP PP Sbjct: 2458 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPP 2502 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PP PP Sbjct: 2329 PPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2373 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 2343 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP P Sbjct: 2344 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2388 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 2359 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2396 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 2376 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2413 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 2392 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2429 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP P Sbjct: 2393 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2437 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 2408 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2445 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 2425 PPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2462 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 2441 PPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2478 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP P Sbjct: 2442 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2486 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP P Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2372 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 2360 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2397 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 2409 PPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2446 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXX--PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP P Sbjct: 2375 PPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2421 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXX--PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP P Sbjct: 2424 PPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDP 2470 Score = 42.7 bits (96), Expect = 0.015 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 2327 PPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPP 2364 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 2356 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2393 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 2389 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2426 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 2405 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2442 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 2438 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP 2475 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPP P PP PPP Sbjct: 2324 PPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPP 2361 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P PP PP PP Sbjct: 2319 PSPPPP-----PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPP 2357 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL-----PPPAXXXXPP 859 PPPPPPP P P PPP P PP PPP PP Sbjct: 2321 PPPPPPP-----PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPP 2365 Score = 36.3 bits (80), Expect = 1.3 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 1/79 (1%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXP-XXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXX 893 S PPPPPPP P PP PP PP PP PP Sbjct: 2320 SPPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPP--PPPPPPPPKVKKVDPPPPPP 2377 Query: 894 XXXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 2378 PPPPKVKKVDPPPPPPPPP 2396 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP P + + P P Sbjct: 2473 PPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKPAPKP 2516 >UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; Chloroflexus|Rep: Putative uncharacterized protein - Chloroflexus aggregans DSM 9485 Length = 600 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P + PPPP AP P P PPP PP Sbjct: 497 PAPPPPPSHHAPPPPHAPAPPPPPHAPAPPPPPHAPAPPPPPHAPAPP 544 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP AP P P PPP PP Sbjct: 492 PPPHAPAPPPPPSHHAPPPPHAPAPPPPPHAPAPPPPPHAPAPP 535 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPX-PSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP P P P+ PPPP AP P P PPP Sbjct: 508 PPPPHAPAPPPPPHAPAPPPPPHAPAPPPPPHAPAPPPP 546 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 595 PSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPP 639 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 620 PSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPP 664 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 610 PSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPP 654 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PPPP P P PP P P PP Sbjct: 600 PSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPP 644 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P PS PPP P +P RPP PPP P Sbjct: 617 PPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPP 660 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P P PP P P PP PPP PP Sbjct: 633 PPPNPPPPSPPPPSPRPPTPPPPSPPPPRP--PPRPPPTRRSPPP 675 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PP P P PP Sbjct: 593 PPPSPPPPS---PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPP 634 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PPPP PP P P PPPP P P PP P PP PP Sbjct: 607 PPPPSPP--PPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPP 650 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P PP P P RPP PP PP Sbjct: 630 PSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPP 674 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PPP P P P PP P P RPP PPP Sbjct: 483 PPPSPPPPRPPPPSPVPPTPPPSPRPPPSP-RPPNPPP 519 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP P P PPPP P P PP P P PP Sbjct: 585 PSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPP 629 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP P P PP P P P Sbjct: 625 PSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPP 668 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL---PPPAXXXXPP 859 PPPP PP P P PPPP P P PP PPP PP Sbjct: 637 PPPPSPP--PPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPPTSSPPPP 682 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PP P P RPP P P P Sbjct: 489 PPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPP 532 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PS PPPP P P PP P P PP Sbjct: 582 PDPPSPDPPSAPPPS-PPPPSPPPPNPPPPSPPPPNPPPPSPPP 624 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPP P P PP PP+ P Sbjct: 485 PSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPP 528 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPPP P P P P P PP Sbjct: 479 PPSPPPPS----PPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPP 519 Score = 40.3 bits (90), Expect = 0.078 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PP PP P P PPP +P P P PPP+ P Sbjct: 512 PRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPP 555 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP P P PPP P P PP P P PP Sbjct: 575 PSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPP 619 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P P PP P RPP P P+ PP Sbjct: 499 PPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPP-PRPSSPRPPP 541 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PP PPP P P PP P P P PP P PP PP Sbjct: 479 PPSPPPPSPPPPRP-PPPSPVPPTPPPSPRPPPSPRPPNPPPRPP 522 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P PP P P P P PPP PP Sbjct: 514 PPNPPPRPPSPRPPPRPPPRPSSPRP---PPPDPSPPPPSPPSPP 555 Score = 37.1 bits (82), Expect = 0.73 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 P P PPP P PPPP P P PP P Sbjct: 522 PSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSP 558 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P P PP P P PP P P PP Sbjct: 572 PDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPP 614 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRP---PLPPPAXXXXPP 859 P PPP P P P PPP P P P RP PPP PP Sbjct: 500 PTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPP 549 Score = 36.3 bits (80), Expect = 1.3 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXP----XPSXPP-PPXXXAPXXXPXRP--PLPPPAXXXXPP 859 P PP PP P P+ PP PP P P RP P PPP PP Sbjct: 497 PVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPP 548 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PP P RPP P P+ P Sbjct: 508 PPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSP 551 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P P +P P P P PA P Sbjct: 526 PPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLP 569 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXP 856 PPP P P P PS PPP P P P P PPP P Sbjct: 493 PPPSPVP---PTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRP 534 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PS P PP P P PP PP + P Sbjct: 517 PPPRPPSPRPPPRPPPRPSSPRPPPPD-PSPPPPSPPSPPTSPSPPDP 563 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 P PP P PS PPP P +P PP PPP P Sbjct: 577 PNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPP 620 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PS PP P +P P RPP P P PP Sbjct: 463 PDECPPLSVLETLPSAPPSPPPPSP--PPPRPPPPSPVPPTPPP 504 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPP-PPSSPRXPXXPP 858 P P PP PPP PP PP P P PP Sbjct: 495 PSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPP 528 Score = 34.3 bits (75), Expect = 5.1 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXXX 899 S PPP PPP P P PP PP PP PP Sbjct: 591 SAPPPSPPPPSPPPPNPPPPSPPPPNPP-PPSPPPPSPPPPSPPPPNPPPPSPPPPSPRP 649 Query: 900 XXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 650 PTPPPPSPPPPRPPPRP 666 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPPP-XXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S+ PP PPPP P PP PP +PP P PP Sbjct: 591 SAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P P P P P P PPP+ P Sbjct: 574 PPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNP 617 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP PS PPPP +P PP PPP PP Sbjct: 918 PSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPP 961 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PPPP P P PP PPP P Sbjct: 930 PPSPPPPPPVPSPPPPSPPPP-SPPPLPPPPPPPSPPPPVDECP 972 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P PS PPPP +P P PP PPP PP Sbjct: 904 PSPSPPPPSPLPPSPS-PPPPSPPSPS--PPSPPPPPPVPSPPPP 945 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PP P P P P PPP+ P Sbjct: 886 PPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSP 930 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P PPPP P P PP P P PP Sbjct: 916 PSPSPPPPSPPSPSPPSPPPP-PPVPSPPPPSPPPPSPPPLPPPP 959 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXP 856 PPPP PP P P P PP P P P P PPP P Sbjct: 884 PPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSP 928 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP P PP P PPPP P P PP PPP+ Sbjct: 925 PPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPS 963 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P P P +P P PPLPPP PP Sbjct: 922 PPSPPSPSPPSPPPPPPVPSPPPPSP-PPPSPPPLPPPPPPPSPP 965 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PS PPP P +P P PP+P P PP Sbjct: 906 PSPPPP--SPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPP 949 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PP P +P P P PPP+ P Sbjct: 908 PPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSP 952 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 P PPPP P P P PP P +PP +P P+ PP Sbjct: 691 PSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPP 736 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P PS PP P P P PP PP PP Sbjct: 742 PSPPPQPPVEVPSPSPPPQPPVEVPSPSP--PPQPPVEVPSPPP 783 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPP PP P P PP P P P PP+ PP Sbjct: 877 FPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPP 923 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP--LPPPAXXXXPP 859 P PPP P PS PPP +P PP +P P+ PP Sbjct: 678 PSPPPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPP 723 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPP--LPPPAXXXXPP 859 P PPP P PS PP P P P +PP +P P+ PP Sbjct: 716 PSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPP 762 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPP--LPPPAXXXXPP 859 P PPP P PS PP P P P +PP +P P+ PP Sbjct: 729 PSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPP 775 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPP--LPPPAXXXXPP 859 P PP P P PS PP P P P +PP +P P+ PP Sbjct: 702 PSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPP 749 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P PS PP P P P PP PP A P Sbjct: 755 PSPPPQPPVEVPSPSPPPQP----PVEVPSPPPPPPVAVPSPSP 794 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXX-APXXXPXRPPLPPPAXXXXPP 859 PPP P P P P+ P P +P P P P P PP Sbjct: 1863 PPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPP 1908 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 720 SXPPPPPP---PXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PP P P PP PP PP PP PP Sbjct: 919 SPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPPP 967 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPP P P PS P P +P P P P P P Sbjct: 1861 PSPPPTPSPTPSPTPSPTPSPTP-SPTPSPTPTPTPSPTPTPTP 1903 >UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05727 - Caenorhabditis briggsae Length = 288 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P RPP PPP PP Sbjct: 115 PPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPP 162 Score = 39.1 bits (87), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P P RPP PPP Sbjct: 82 PPPPPPPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPP 119 Score = 34.7 bits (76), Expect = 3.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP 784 PPPPPPP P P PPP Sbjct: 32 PPPPPPPKGTGSPPPPPPPP 51 Score = 34.7 bits (76), Expect = 3.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP 784 PPPPPPP P P PPP Sbjct: 183 PPPPPPPKGTGGPPPPPPPP 202 Score = 34.3 bits (75), Expect = 5.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP 787 PPPPPPP P PPPP Sbjct: 31 PPPPPPPPKGTGSPPPPPPPP 51 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P P RPP PPP Sbjct: 150 PPPPPPRGTGTPPPPPTGVPEELNEANHASRRPPPPPP 187 Score = 33.9 bits (74), Expect = 6.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP 787 PPPPPPP P PPPP Sbjct: 182 PPPPPPPPKGTGGPPPPPPPP 202 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP PPP PP Sbjct: 586 PPPPPPPPPGASLVPPPPPPPPGAAGLVPP--PPPPPPGAGGIPP 628 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/47 (46%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP--AXXXXPP 859 PPPPPPP P P PPPP P P P +PPP A PP Sbjct: 615 PPPPPPPGAGGIPPP--PPPPGAGIPPPPPGVPGIPPPPGAPGLPPP 659 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP PP A PP Sbjct: 587 PPPPPPPPGASLVPP--PPPPPPGAAGLVPPPPPPPPGAGGIPPP 629 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 600 PPPPPPPPGAAGLVPPPPPPP----PGAGGIPPPPPPPGAGIPPP 640 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP----LPPPAXXXXPP 859 PPPPPPP P P PPP AP P PP L PP PP Sbjct: 549 PPPPPPPGASLVPPP---PPPPPGAPGLVPSPPPGAAGLVPPPPPPPPP 594 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PP A P PP PPP PP Sbjct: 561 PPPPPPPPGAPGLVPSPPP----GAAGLVPPPPPPPPPGASLVPP 601 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP P PP Sbjct: 537 PPPPPPPPGLVPPPP--PPPPGASLVPPPPPPPPGAPGLVPSPPP 579 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP PP A PP Sbjct: 601 PPPPPPPGAAGLVPPPPPPPPG--AGGIPP--PPPPPGAGIPPPP 641 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P P P P PP PPP PP Sbjct: 627 PPPPPPPGAGIP-PPPPGVPGIPPPPGAPGLPP-PPPGVPGIPP 668 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPS------XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PPPP P PP PP A PP Sbjct: 563 PPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPP 615 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPL----PPPAXXXXPP 859 PPPPPP P P P PP AP P P + PPP PP Sbjct: 628 PPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPPGAPGLPP 677 Score = 37.5 bits (83), Expect = 0.55 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXA----PXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PP PP A PP Sbjct: 627 PPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPP-PPGAPGLPPP 678 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP P PP PPP PP Sbjct: 529 PPPPSGTAPPPP--PPPPGLVPP------PPPPPPGASLVPP 562 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP PP PP PP PP PP Sbjct: 597 SLVPPPPPPPPG----AAGLVPPPPPPPPGAGGIPPPPPPPGAGIPP 639 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P P PPPA Sbjct: 367 PPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPPA 405 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P P LPPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPP 403 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P PPPP P PP PPP PP Sbjct: 353 PPPQQQQNKSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXP--SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P PP PPP PP Sbjct: 364 PPPPPP---PPPPPPKGAPPPP---PPPPPPPPPPGPPPPGQLPPP 403 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S+ PPPPPPP P PP PP PP PP PP Sbjct: 362 SAPPPPPPPP---PPPPKGAPPPPPPPPPPPPPPGPP--PPGQLPPP 403 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA 799 PPPPPPP P P PPP A Sbjct: 383 PPPPPPPPPPGPPPPGQLPPPPAGA 407 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPP P P PPPP P R L Sbjct: 379 PPPPPPPPPPPPPPGPPPPGQLPPPPAGARAKL 411 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPP P AP PP PPP PP Sbjct: 910 PPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPP 955 Score = 43.2 bits (97), Expect = 0.011 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P + PPPP P PP P PP Sbjct: 904 PPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPP 948 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA---PXXXPXRPPLPPPAXXXXPP 859 PPPPP P P+ P PP P P PPLPPP+ PP Sbjct: 876 PPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPP 923 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P P PPPP P PP PPP P Sbjct: 890 PAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSP 934 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP P PP PPP P Sbjct: 892 PPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAP 936 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPP P P P PPP AP PP PP Sbjct: 925 PPPPPLPNSPAPPNPGGPPP----APPPPGLAPPPPP 957 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP----PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P PP PPP PP Sbjct: 629 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPP 677 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-----PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP PP P PP PPP PP Sbjct: 605 PPPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPP 654 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-----PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP PP P PP PPP PP Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPP 666 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP--PLPPPAXXXXPP 859 PPPPPPP P P PP P P P P PPP PP Sbjct: 641 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPP 687 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPP P P P +PPP P Sbjct: 653 PPPPPPPGMPGMPPP--PPPGMPGMPPPPPGMPGMPPPPPPGMP 694 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P P P PP PPP PP Sbjct: 654 PPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPP 698 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P P P PP PPP PP Sbjct: 665 PPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPP-PPPGMPGMPP 708 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 SS PPPPPPP P P PP P +PP P Sbjct: 614 SSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 659 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP--PLPPPAXXXXPP 859 PPPPP P P PPP P P P P PPP PP Sbjct: 676 PPPPPGMPGMPPP--PPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 718 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S+ PPPPPPP P P PP P +PP P Sbjct: 602 STMPPPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 647 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P PPP P P P +PPP Sbjct: 686 PPPPPPGMPGMP---PPPPGMPGMPPPPPGMPGMPPP 719 >UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner and outer membranes; n=3; Magnetospirillum|Rep: Periplasmic protein TonB, links inner and outer membranes - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 313 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P+ PPP AP P P P P PP Sbjct: 90 PPPPPTPAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPPPP 134 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P+ PPP P P P P P PP Sbjct: 88 PKPPPPPTPAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPP 132 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P PP P P+ PPPP P P P P P P Sbjct: 82 PPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAPAPIPKPEPKP 125 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P PP P P PPPP AP P P PPP P Sbjct: 73 PKPEPPKPEPPKPEPPKPPPPPTPAPPPPPTPAP-PPPKPEPAP 115 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P P PP P P P PPP P Sbjct: 72 PPKPEPPKPEPPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAP 115 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPP-----PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P P PP P P +PP PPP PP Sbjct: 53 PPPLQDNKPQPEPQKAEPEPPKPEPPKPEPPKPEPPKPP-PPPTPAPPPP 101 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PP P P P P+P P P Sbjct: 87 PPKPPPPPT---PAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEP 127 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P P P P P PPP P Sbjct: 96 PAPPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPPPPPKPEP 139 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P P P P PP P P PP P PA P Sbjct: 77 PPKPEPPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAPAPIP 119 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PP P P PPPP P PP P P P Sbjct: 75 PEPPKPEPPKPEPPKPPPPPTPAPPPPPTPAPPPPKPEPAPAP 117 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPP-XXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P+ P P P P PP P P PP Sbjct: 98 PPPPPTPAPPPPKPEPAPAPIPKPEPKPEPKPEPPPPPKPEPRPEPP 144 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P PP P P P PPP PP Sbjct: 63 PEPQKAEPEPPKPEPPKPEPPKPEPPKPPPPPTPAPPPPPTPAPP 107 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/45 (48%), Positives = 23/45 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P+ PPPP P P PP PPPA PP Sbjct: 1013 PPPPPPPAAR----PAPPPPPPVVRPPPPP--PPPPPPAARPAPP 1051 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP--PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P PP P P PP PPP PP Sbjct: 992 PPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPP-PPPVVRPPPP 1037 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 P PPPPP P P PPP AP P PP PPPA PP Sbjct: 981 PAPPPPPPVVRPPPP--PPPAARPAPPPPPPVVRPPPPPPPAARPAPP 1026 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 P PPPPP P P PPP AP RP P PPP PP Sbjct: 931 PAPPPPP--VVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPP 974 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PPPPPPP P+ PPP AP P + P PPPA PP Sbjct: 941 PPPPPPP---PAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPP 984 Score = 41.5 bits (93), Expect = 0.034 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXP-----XPSXPPPP-XXXAPXXXP-XRPPLPPPAXXXXPP 859 PPPPPPP P P+ PPPP AP P RP PPP PP Sbjct: 942 PPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPP 993 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P P P PP PPPA PP Sbjct: 961 PAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPP 1005 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP----SXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PPPPPP P P PPPP A P PP+ PPP PP Sbjct: 993 PPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPP 1043 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP---PPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P P P P P P PP PPP P Sbjct: 1002 PAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARP 1048 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PP P P PP PPP PP Sbjct: 973 PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPP-PPPVVRPPPP 1016 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP 823 P PPPPP P P PPPP P +P Sbjct: 1023 PAPPPPPPVVRPPPPPPPPPPPAARPAPPAAKP 1055 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P PPPP A P P P P Sbjct: 1023 PAPPPPPPVVRPPPPPPPPPPPAARPAPPAAKPCTLPNGQPCP 1065 Score = 35.1 bits (77), Expect = 2.9 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP----------XRPPLPPPAXXXXPP 859 PPPPPPP PPPP P P RP PPPA PP Sbjct: 884 PPPPPPPAAAR----EAPPPPAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPP 934 >UniRef50_A3Q834 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 314 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP AP P PPP PP Sbjct: 190 PPPPPPPVEAPPPPPPPVEAPPPPAVEAPLPPPPVEAAPPPPEEAAPP 237 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSX----PPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P+ PPPP AP P PP A Sbjct: 200 PPPPPPPVEAPPPPAVEAPLPPPPVEAAPPPPEEAAPPPPVA 241 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP AP PP PPP PP Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPP-----PPPPPPGTQAAPP 563 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP PPP PP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAA--VAPPPPP-PPPGTAAAPP 550 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPP PP + PPPP P PP PPP P Sbjct: 490 FAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAP 536 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP A P PP+ A P Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 8/54 (14%) Frame = +2 Query: 719 FXPPPPPPP-------XXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXP 856 F PPPPPPP P PS PP PP P PP PPP P Sbjct: 415 FPPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMP 468 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP-AXXXXPP 859 PPPPPP PS PP P + P PP P P A PP Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPP 606 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P P + PPP Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPP 494 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP + PPPP A PP PPP Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP P PP PPP P Sbjct: 536 PPPPPPPPGTAAAPPPPPPP----PGTQAAPPPPPPPPMQNRAP 575 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP PP PP A P Sbjct: 605 PPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAARSLRP 649 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P PPPP P PP+P Sbjct: 549 PPPPPPPPGTQAAPPPPPPPP---MQNRAPSPPPMP 581 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +2 Query: 719 FXPPPPPP-PXXXXXPXPSXPPPPXXXA--PXXXPXRPPLPPP 838 F PPPPPP P PPPP A P PP PPP Sbjct: 472 FAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S+ PPPPPPP P PP PP PP PP Sbjct: 506 SAPPPPPPPP----LPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P AP P PP P PP Sbjct: 454 PPPPPPP-----PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPP 493 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR---PPLPPP 838 PPP PP PPPP P P + PP PPP Sbjct: 440 PPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 PPPPPPP P PP P F PP P Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPP 498 >UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza sativa|Rep: Diaphanous homologue-like - Oryza sativa subsp. japonica (Rice) Length = 1391 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPP 838 PPPPPPP P PPPP AP P PP PPP Sbjct: 771 PPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPPP 809 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPP----PXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPP 838 PPPPPP P P P PPP P AP P PP PPP Sbjct: 770 PPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPPPPPPP 813 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP--PLPPP 838 PPPPPP P+ PPPP P P P+PPP Sbjct: 788 PPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPPP 826 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PPPPPPP P S PP P P P P+PPP PP Sbjct: 730 PPPPPPPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPP 777 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXX--PXRPPLPPPAXXXXP 856 PPPPPPP P PPP P P P PP PPP P Sbjct: 734 PPPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIP 780 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P P PP P +PP PP Sbjct: 765 SPVPPPPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPPPPP 811 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 8/49 (16%) Frame = +2 Query: 719 FXPPPPPPP--------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 F PP PPP P P PPPP P PP PPPA Sbjct: 746 FSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPPA 794 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP RP PPP Sbjct: 788 PPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPPPP 827 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPX--PSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P PPPP P P PPP Sbjct: 789 PPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPPPPP 828 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX-PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P+ PPPP P P P PPP PP Sbjct: 88 PPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPP 133 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P+ PPPP P P PP PP PP Sbjct: 114 PRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPP 159 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PPPP P P P PPP PP Sbjct: 82 PPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPP 126 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PPPP P RPP P P PP Sbjct: 100 PPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPP 144 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 P PPPP P P P PP P P RPP PPP PP Sbjct: 79 PRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPP 125 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP PP P PPPP P P P PPP P Sbjct: 71 PPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTP 114 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXP 856 PP PP P P P PPPP P P RPP PPP P Sbjct: 108 PPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTP 153 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P P PPPP P P PP P P P Sbjct: 126 PPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPPEP 169 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PP P P RPP PPP PP Sbjct: 81 PPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPP-PPPTPRPPPP 127 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P+ PPPP P P PPP PP Sbjct: 106 PPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPP 151 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P P PP P P PP PP PP Sbjct: 57 PTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPP 101 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P P PP P P P PPP P Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTP 140 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P P P PP P P PP P P P Sbjct: 118 PPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSP 161 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PPPP PP P P P P P RPP PPP PP Sbjct: 61 PPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPP 107 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS--XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P P PPPP P P P PPP PP Sbjct: 62 PPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPP 108 Score = 40.3 bits (90), Expect = 0.078 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PP P PP PP PP Sbjct: 124 PPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPP 167 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P PPP P P P PPP PP Sbjct: 66 PPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPP 109 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P P PP P P PP P P P Sbjct: 69 PRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPP 112 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP P P PS P P P P PP P P P Sbjct: 134 PPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPPEPTPPTPTPP 177 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PP P P P PP PP PP Sbjct: 59 PRPPPPRPPTPRPPPPRPPTPRPPPPTPRPP-PPRPPTPRPPPPP 102 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P P PP P P RPP PPP PP Sbjct: 94 PTPRPPPPPTPRPPPPRPPTP--RPPPPPTPRPP-PPPTPRPPPP 135 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P P P PP P P P PPP PP Sbjct: 51 PTPPRPP----TPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPP 91 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 P P PP P PPPP P P RPP P PP PP Sbjct: 48 PSRPTPP----RPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPP 89 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXP--XRPPLPPPAXXXXPP 859 PP PP P P+ PPPP P P RPP P P PP Sbjct: 53 PPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPP 100 >UniRef50_Q2V4A1 Cluster: Uncharacterized protein At2g05440.4; n=61; cellular organisms|Rep: Uncharacterized protein At2g05440.4 - Arabidopsis thaliana (Mouse-ear cress) Length = 147 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGG 112 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG--GGGG 720 G G G GGGG GGG GG G G GGGG GGGG Sbjct: 87 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 134 Score = 40.3 bits (90), Expect = 0.078 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG--GGGGG 720 GG G G GGGG GGG GG G G GGG GGGGG Sbjct: 83 GGGGGHYG--GGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 128 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G GGGGG GG Sbjct: 80 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGG 125 Score = 39.5 bits (88), Expect = 0.14 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG---GGGGG 720 GG G G GGGG GGG GG G G GGG GGGGG Sbjct: 76 GGGGGHYG--GGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 122 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 GG G G GGGG GG GG G G GGGGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGG GGGG Sbjct: 74 GYGGGGGHYGGGGGHYGGG----GGHYGGGGGHYGGGGGGHGGGG 114 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GG GG G G GGG G G GGGGGG Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 122 Score = 38.3 bits (85), Expect = 0.31 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGG--GGGGG 724 GG GGG GG G G GGGG G G GG GGGGG Sbjct: 83 GGGGGHYGGG-GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 128 Score = 37.9 bits (84), Expect = 0.42 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 7/53 (13%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXX-----GGGXXXXGGXXXXGXGXXXXXGGG--GGGGG 720 GG G G GGGG GGG GG G G GGG GGGGG Sbjct: 56 GGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGGG G Sbjct: 68 GGHGLDGYGGGGGHYGGG-GGHYGGGGGHYGGGGGHYGGGGGGHG 111 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXG-GXXXXGXGXXXXXGGGG--GGGG 720 GG G G GGGG GG G G G G GGGG GGGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG 729 G G G GGGG GGG GG G G GGG G Sbjct: 94 GHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 136 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 858 GGXXXXAGGGR--GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 GG GGG GG G G GGGG G G GGG G Sbjct: 92 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 136 Score = 34.7 bits (76), Expect = 3.9 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG--GGG 724 GG GGG GG G G GGGG G G GGGG GGG Sbjct: 90 GGGGGHYGGG-GGHYG--GGGGGHGGGGHYGGGGGGYGGGGGHHGGG 133 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG--GGG 720 G G GG G GGG GG G GGGGG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG 85 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PPPP P P PP PP Sbjct: 292 PPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPPPPPP 328 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP PP PPP Sbjct: 291 PPPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPPPPPP 328 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PPPP P P PP PPP PP Sbjct: 265 PPPSTPPRWTRSP---TPPPPPPSPPHATPPPPPPPPPREMVAPP 306 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPP AP P P P PP Sbjct: 280 PPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPP 324 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P + PPPP P PP PPP P Sbjct: 277 PTPPPPP---PSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQP 317 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPP PPPP P PLPP Sbjct: 305 PPPPPPPPYYGQPTLAPPPPPPPPYCGHPTLAPLPP 340 >UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein; n=1; Arabidopsis thaliana|Rep: Putative glycine-rich cell wall protein - Arabidopsis thaliana (Mouse-ear cress) Length = 221 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GGGGGGG Sbjct: 134 GGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGG 178 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GGGGGGG Sbjct: 131 GGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGG 174 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GGGGGGG Sbjct: 132 GGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGG 176 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G GGG GG G G GGGGGGGG Sbjct: 136 GGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 181 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG G G GG G G GGGGGGGG Sbjct: 131 GGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGG 175 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G G G GGGG G G GGGGGGG Sbjct: 136 GGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 180 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G G G GG G G GGGGGGGG Sbjct: 132 GGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGG 177 Score = 43.2 bits (97), Expect = 0.011 Identities = 23/49 (46%), Positives = 24/49 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG +G GRGG G G GGGG G G GGGGGGG K Sbjct: 142 GGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGG-----GGGGGGGSDGK 185 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG GGGG G G GGGGGGG Sbjct: 131 GGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGG 175 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G GG GG G G GGGGGGGG Sbjct: 135 GGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 180 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G G G GG G G GGGGGGGG Sbjct: 134 GGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 179 Score = 41.1 bits (92), Expect = 0.045 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG +G G G GR G G GGGG G G GGGGG K Sbjct: 138 GGGGGGSGNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGK 185 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GGG GG G G+ G G G G GGGGGGG Sbjct: 130 SGGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGGG 168 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GG G G Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGGDGPG 201 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G G GG G Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGGDG 199 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G G GGG G Sbjct: 147 GSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWG 190 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GGG G G Sbjct: 149 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFG 192 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G G G GG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGG 197 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G +G GGGG GG G GGGGGGG Sbjct: 99 GGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGGGGGGGGG 143 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG GGGGGGG Sbjct: 92 GGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGGG 137 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG G GGGGGGGG Sbjct: 93 GGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGGGG 138 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G RG GGGG GGG GG G G GGGGG G+ Sbjct: 145 GNGSGRGRGGGGGGGGGGGGGGGGGGGGGGGG-----GGGGGSDGK 185 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G RG GGGG GGG GG G G G GGG G Sbjct: 147 GSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWG 190 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 + GG GG G G G G G G GGGGGGG Sbjct: 129 SSGGGGGGGGGGGGGSGNGSGRGRGGGGGGGGGGGGGGG 167 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G GGGGGG Sbjct: 91 GGGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGG 136 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 R + GGG GGG G G G GGGGGGGG Sbjct: 126 RNKSSGGGGGGGGGGGGGSGNGS-GRGRGGGGGGGGGGGG 164 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 G GGG GG G G GGGG G G GGG G Sbjct: 147 GSGRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWG 190 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG+ G GG G GGGGGG Sbjct: 92 GGGGGGGGGGGGGQGSGGGGGEGNGGNGKDNSHKRNKSSGGGGGG 136 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG G G G G GG GR Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGGDGPGGNFGR 206 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG G G GG G GG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGGDGPGG 202 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G GG G GG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGSDGKGG--GWGFGFGWGGDGPGG 202 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G G G GG Sbjct: 153 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGSDGKGGGWGFGFGWGG 197 >UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 722 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GGGGGGG Sbjct: 133 GGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGG 176 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G +GG G GG GG G G GGGGGGGG Sbjct: 77 GGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGG 122 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GGG G G GGGGGGG Sbjct: 136 GGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGG 181 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG GG G G GGGGGGGG Sbjct: 70 GGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGG 115 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 G GGG GG G G GGGG G G GGGGGG Sbjct: 84 GGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGG 126 Score = 44.0 bits (99), Expect = 0.006 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GGGGGG Sbjct: 97 GGTGGGTGGNGGGGG-GGGGGGGGGGGGGGGTGGGGTGGNGGGGGG 141 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGGG GG Sbjct: 140 GGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGG 185 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGGG G Sbjct: 98 GTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTG 143 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGG GGG Sbjct: 100 GGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGG 145 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGG GGG Sbjct: 112 GGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGG 157 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGG GGGG Sbjct: 113 GGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGG 158 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG GG G G GGGGGGGG Sbjct: 80 GGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGG 125 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GG GGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGG 153 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GG GGGG Sbjct: 114 GGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGG 158 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GGGG G G GGG GGG Sbjct: 113 GGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGG 157 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGG GG Sbjct: 111 GGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGG 156 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G GGGGGGG Sbjct: 133 GGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGG 177 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG----GXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G G GGGGGGG Sbjct: 66 GGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGG 114 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GG GGGG Sbjct: 94 GGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGG 139 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GGG GGG Sbjct: 101 GGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGG 145 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGG GG Sbjct: 104 GGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGG 148 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G G GG GGG Sbjct: 126 GTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGG 171 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGG GG Sbjct: 90 GGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGG 134 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GG GG GG Sbjct: 107 GGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGG 151 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG G G GG G G GG GGGG Sbjct: 109 GGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGG 153 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG GGG GG G GGGGGGGG Sbjct: 73 GGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGG 118 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G GGGGGGG Sbjct: 73 GGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGG 117 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G G G G G G GGGGGGGG Sbjct: 81 GGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGG 126 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGG GGG GG G G GGGG GG Sbjct: 90 GGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGG 134 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GGG GG G Sbjct: 91 GGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNG 136 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGGG G Sbjct: 111 GGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNG 155 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG G G G GGGGG GG Sbjct: 118 GGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGG 163 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G GGGG GGG Sbjct: 119 GGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGG 164 Score = 40.7 bits (91), Expect = 0.059 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGG-GXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG G GG G G GG GGGGG Sbjct: 128 GGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGG 173 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GG G G G GG GGGG Sbjct: 128 GGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGG 172 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G G GG GG Sbjct: 144 GGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGG 188 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G +GG G GG GG G G GG GGGG Sbjct: 87 GGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGG 131 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G G GG GGG Sbjct: 107 GGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGG 152 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G G GG GG Sbjct: 147 GGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGG 191 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GGG G G GGGGGG Sbjct: 129 GGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGG 174 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G G GG GG Sbjct: 107 GGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGG 151 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GGGG G GGGG GG Sbjct: 112 GGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGG 156 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G G GG G G GGGGG G Sbjct: 140 GGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTG 184 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG GG G G GG GG GG Sbjct: 147 GGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGG 191 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G +GGG GGG GG G GG GG GG Sbjct: 63 GGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGG 108 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G GGG GG G Sbjct: 105 GNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNG 150 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GGGGG G Sbjct: 118 GGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTG 162 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GGG GGG Sbjct: 122 GGGGGTGGGGTGGNGGGGGGTG--GGTGGNGGGGNGGGGGGTGGG 164 Score = 37.9 bits (84), Expect = 0.42 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGG--GRGGRXGXXXGAXXXGGG-GXXGXGXXXXXGGGGGGG 724 GG GG G GG G G GGG G G G GGGGGGG Sbjct: 74 GGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGG 121 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG G G G GGG GG G Sbjct: 52 GGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDG 97 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GG GG G Sbjct: 125 GGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNG 169 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGG G G GG GG Sbjct: 55 GGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGG 98 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G +GGG GGG GG G G GG GGG G Sbjct: 41 GGHGGHGGGQGGGHGGHGGG--HGGGHGGHGGGQGGGHGGHGGGHG 84 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GG GG Sbjct: 44 GGHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGG 88 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGG-GXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG G GG GG G G G GGG GG Sbjct: 59 GGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGG 105 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG+GG G G GG G G GGG GG Sbjct: 62 GGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGG 105 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G G GG G G GG GGG Sbjct: 58 GGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGG 102 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG 733 GG GGG GG G G GGGG G G GG Sbjct: 155 GGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGYPAGG 196 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGG--GGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG GG G G GG G G G GGG GG Sbjct: 48 GGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGG 95 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG G G G G GG G G GG GGG Sbjct: 121 GGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGG 164 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGGG G G GG G G G GG GG Sbjct: 147 GGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGG 191 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GG GG Sbjct: 152 GGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGYPAGG 196 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG+GG G G GG G G G GG GGG Sbjct: 40 GGGHGGHGGGQGGGHG-GHGGGHGGGHGGHGGGQGGGHGGHGGG 82 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G G GGG G G GG GGG Sbjct: 47 GGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGG 92 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G GGG GG Sbjct: 51 GGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGG 95 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG G G G G GG GGG Sbjct: 37 GGQGGGHGGHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGG 82 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG+ G G GGG G G G GG GG Sbjct: 37 GGQGGGHGGHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGG 81 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G GGG GG G GG GG GG Sbjct: 56 GHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGG 101 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-----GGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GG GG G G GGGGGG Sbjct: 63 GGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGG 112 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGG GGG GG G G GG GG Sbjct: 152 GGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGYPAGG 196 >UniRef50_A3BDT4 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 685 Score = 46.0 bits (104), Expect = 0.002 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G EGGGG GGG GG G G GGGGGGGGR Sbjct: 610 GGCEGEGDGEGGGGGGGGGGAGGDGGGGAGGGG----GGGGGGGGGR 652 Score = 39.5 bits (88), Expect = 0.14 Identities = 23/50 (46%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG---GGGR 717 GG G G +GGGG GGG GG G G GGGG GGGR Sbjct: 624 GGGGGGAGGDGGGGAGGGGG---GGGGGGGGRGRGRARGGGGDGATGGGR 670 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/49 (42%), Positives = 23/49 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG G GG G GA GGGG G G GGGGGGG + + Sbjct: 610 GGCEGEGDGEGGGGGGGGGGAGGDGGGGAGGGG----GGGGGGGGGRGR 654 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGGG G Sbjct: 620 GGGGGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGGGDG 664 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 + GG G G GGGG G G GGGGGGG Sbjct: 608 SAGGCEGEGDGEGGGGGGGGGGAGGDGGGGAGGGGGGGG 646 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G G GGG Sbjct: 618 GEGGGGGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGG 661 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG GG G G G GGGG Sbjct: 618 GEGGGGGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGGG 662 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 AGG G G G GGG G GGGGGGG Sbjct: 609 AGGCEGEGDGEGGGGGGGGGGAGGDGGGGAGGGGGGGGG 647 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG--GGG 724 GG GG GG G GGGG G G GG G GGG Sbjct: 623 GGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGGGDGATGGG 669 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGG---GGGG 727 G GGG GG G G GGGG G G G GGGG Sbjct: 616 GDGEGGGGGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGGG 662 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GG GG GG G G GGGG G Sbjct: 620 GGGGGGGGGGAGGDGGGGAGGGGGGGGGGGGGRGRGRARGGGGDG 664 >UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|Rep: CG1520-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 527 Score = 46.0 bits (104), Expect = 0.002 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +2 Query: 737 PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P + PPPP AP P PP PPPA PP Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPP P P PPPP P P PP+P Sbjct: 370 PPPPPVSAPVVAPPPPPPPPPAAVPP---PPPPPMP 402 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 PPPPPPP P P PP P P P Sbjct: 382 PPPPPPPPPAAVPPPPPPPMPVGEIPVITTTHAP 415 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPP-PPPMTGGGPP 693 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 664 PPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPP-PPPMTGGGPP 707 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 680 PPPPPPPMTGGGPPPPPPPPPMTGG---GPPPPP-PPPGGGPPPP 720 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP PP A PP Sbjct: 692 PPPPPPPPPMTGGGPPPPPPP----PGGGPPPPPPPPGAKAGGPP 732 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP A P PP PPP PP Sbjct: 706 PPPPPPPPGGGPP----PPPPPPGAKAGGP--PPPPPPFGKGPPP 744 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP 814 PPPPPPP P PPPP P P Sbjct: 717 PPPPPPPPGAKAGGPPPPPPPFGKGPPPPP 746 Score = 35.5 bits (78), Expect = 2.2 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 6/94 (6%) Frame = +3 Query: 594 PXFXXGXXPPPPKXKKNXXRGGXXXXFXXXXXXXXXXXXXXSSXPPPPPPPXXXXXPXXX 773 P G PPPP GG PPPPPPP P Sbjct: 655 PPMTGGGAPPPPPPPPPMTGGGGPPP-----PPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Query: 774 XXPPXXXXPPXXXXXA------PPFLPPXXXXPP 857 PP PP PP PP PP Sbjct: 710 PPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPP 743 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 46.0 bits (104), Expect = 0.002 Identities = 20/44 (45%), Positives = 22/44 (50%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PP P AP P PP+P P+ PP Sbjct: 471 PPPPPPAP---PAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPP 511 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXX---PXRPPLPPPAXXXXPP 859 PPPPPP P PPPP P P PP PPP PP Sbjct: 492 PPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPPPPGGMPPPP 539 Score = 41.5 bits (93), Expect = 0.034 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPP P P PPPP P P PP+ Sbjct: 512 PPPPPPGGMGGVPPPPPPPPPGGMPPPPAPALPPV 546 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPP P P P P P P PP PP PA PP Sbjct: 449 PPPPPLPATQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPP 494 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPP 838 PP PP P P PPPP P P PP PPP Sbjct: 475 PPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPP 514 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PP PP P PP P AP PP PPP Sbjct: 479 PAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPP 516 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX----PPPPXXXAPXXX---PXRPPLPPPAXXXXPP 859 PPPP PP P P+ PPPP P P PP PPP P Sbjct: 473 PPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVP 524 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PPPP P +PPLPP A PP Sbjct: 384 PPPPPSRSSVP----PPPP----PRNSAAQPPLPPKAPGPAPP 418 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXP-PXXXXXAPPFLPPXXXXPP 857 SS PPPPPP P P P P PP LP PP Sbjct: 391 SSVPPPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPP 438 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = +2 Query: 725 PPPPPP-------PXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P P+ P PP P P R P PP A Sbjct: 394 PPPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQA 440 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P S PPP P PPLP PP Sbjct: 409 PPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPP 453 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P + PPPP A P PPLP + PP Sbjct: 435 PAPPQAPPLPTSNAPPPPPLPATQAPPP-PPLPATSAPPPPP 475 >UniRef50_A6S8L3 Cluster: Predicted protein; n=2; Botryotinia fuckeliana B05.10|Rep: Predicted protein - Botryotinia fuckeliana B05.10 Length = 428 Score = 46.0 bits (104), Expect = 0.002 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G E+GGGG GG GG G G GGGGGGGG Sbjct: 283 GDGDGDEDEDGGGGGDGGGDEDEDGGGGGDGGGDEDEDGGGGGGGG 328 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G E+GGGG GG GG G G GGG G GG Sbjct: 297 GDGGGDEDEDGGGGGDGGGDEDEDGGGGGGGGGGEGEDGGGNGDGG 342 Score = 40.7 bits (91), Expect = 0.059 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G E+GGGG GGG GG G G GGGGGGG Sbjct: 311 GDGGGDEDEDGGGGGGGGGGEGEDGGGNGDGGG-----GGGGGGG 350 Score = 39.1 bits (87), Expect = 0.18 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +E GGG GG GG G G GGGGGGGG Sbjct: 310 GGDGGGDEDEDGGGGGGGG-----GGEGEDGGGNGDGGGGGGGGGG 350 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGX-GXXXXXGGGGGGG 724 GGG GG G GGGG G G GGGGGGG Sbjct: 309 GGGDGGGDEDEDGGGGGGGGGGEGEDGGGNGDGGGGGGG 347 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G +GGG G GG G G GGGGG GG Sbjct: 273 GDGGGDGGGDGDGDGDEDEDGGGGGDGGGDEDEDGGGGGDGG 314 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G GGGG G G G GGGG Sbjct: 300 GGDEDEDGGGGGDGGGDEDEDGGGGGGGGGGEGEDGGGNGDGGGG 344 >UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomycotina|Rep: DUF1720 domain protein - Aspergillus clavatus Length = 1485 Score = 46.0 bits (104), Expect = 0.002 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX-----PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PS PPPP P P PP PPP PP Sbjct: 1386 PPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPPPGPPPP 1435 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPX------PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PS PPP AP P PP PP PP Sbjct: 1384 PPPPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPPPGPPP 1434 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P AP P PP+ PPA PP Sbjct: 1383 PPPPPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPP 1427 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P PP PP A P Sbjct: 1410 PPPPAPPIAPPAPPPGPPPPP-------GPPPPPAPPGAAAPAAP 1447 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 46.0 bits (104), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P PPPP P P PP PPP Sbjct: 367 PPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXP-XPSXPPPPXXXAPXXXPXRPPLPP 835 P PPPPP P P PPPP + P PPLPP Sbjct: 380 PLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S P PPPPP P PP P APP LPP Sbjct: 378 SGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPPP A PP PP A P Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMP 394 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPPSS P PP Sbjct: 384 PPPGAGGPPMPPPPPPP--PPPPSSGNGPAPPP 414 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPP----PXXXXXPXPSXPPPPXXXAPXXXP----XRPPLPPPAXXXXPP 859 PPPP P P P P PP P P PP+PPP PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPP 403 >UniRef50_Q27294 Cluster: RNA-binding protein cabeza; n=5; Endopterygota|Rep: RNA-binding protein cabeza - Drosophila melanogaster (Fruit fly) Length = 399 Score = 46.0 bits (104), Expect = 0.002 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G GGGG G G GGGGGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGG--GGGGGGGGGGGRFDRGGGGGGG 255 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GGGG GGG G G GGGGGGGG Sbjct: 224 GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGG 269 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GGG GGR G GGGG G G GGGGGG + Sbjct: 217 GGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGR 256 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G GGGGGGG Sbjct: 224 GGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGG 268 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G GGGGGGG Sbjct: 221 GGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGG 266 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = -1 Query: 830 EGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 +GGGG GGG GG G G GGGGGGGGR Sbjct: 212 KGGGGGGGGGGRGGFGGRRGGGGG----GGGGGGGGGR 245 Score = 40.3 bits (90), Expect = 0.078 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = -1 Query: 857 GGXXGXRGEEGG--GGXXXGGGXXXXGG---XXXXGXGXXXXXGGGGGGGG 720 GG G RG GG GG GGG GG G G GGGGGGGG Sbjct: 217 GGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGG 267 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GG G GGG GG G G GGGGGGGR Sbjct: 214 GGGGGGGGGRGGFGGRRGGGGGGGGG----GGGGGRFDRGGGGGGGR 256 Score = 37.5 bits (83), Expect = 0.55 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG---GGGXXGXGXXXXXGGGGGGG 724 GG GG RGG G G G GG G G GGGGGGG Sbjct: 220 GGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGG 267 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG GGGGGGGG Sbjct: 312 GGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGG 357 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GGGG GG GG G G GGGGGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGG 254 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG GGGGGGG Sbjct: 311 GGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGG 356 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G + G GG G G GGGGG G Sbjct: 67 GGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSG 111 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG GG G GGGG GGGGGG + + Sbjct: 227 GGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPPP A P P PP P A PP Sbjct: 912 PAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPP 957 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPX-PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP + P PP PP A PP Sbjct: 896 PPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPP 941 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P P PPP A P PP PPP P Sbjct: 926 PPPPPPPPQAALPPPPPPGPPPAPDAALPPP--PPAPPPPGPPLP 968 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPP P P PP P A PP Sbjct: 914 PPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPPP 958 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPP AP P PP P + PP Sbjct: 889 PPPPPP-----PPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPP 927 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P P PP + LPP PP Sbjct: 888 SPPPPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPP 933 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PP P P PPPA P Sbjct: 941 PPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPPPARSNVDP 985 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P + PPPP P P PPLP PP Sbjct: 939 PPPPPGP--PPAPDAALPPPP----PAPPPPGPPLPFDVAGPPPP 977 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPP ++ P PP Sbjct: 291 PCPPPTKPPPTTKPPPTTKPPPTTTKPPPIKPP 323 >UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus virus 1|Rep: EsV-1-144 - Ectocarpus siliculosus virus 1 Length = 698 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGG-GXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GG G GGG GG G G GGGGGGGGR Sbjct: 456 GGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGR 503 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G GA GGGG G GGGGGGG Sbjct: 455 GGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGG 492 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G G GG G G GGGGGGG Sbjct: 455 GGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGG 499 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG +GG GG G G GGGG G G GGGGGG Sbjct: 459 GGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGG 502 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GG G G G GGGGGGG Sbjct: 451 GASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGG 495 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG GGG G G G GGGGGGGG Sbjct: 455 GGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGG 500 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG G GG G G GGGGGGGG Sbjct: 446 GGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGG 491 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG G G G G G GGGGGGGG Sbjct: 443 GGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGG 488 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GG GG G G G G G G GGGGGGG Sbjct: 443 GGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGG 487 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG G G GG G G GGGGGG G Sbjct: 459 GGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGRG 504 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G +GGG GG G G GGGG G G GGGGGGG Sbjct: 463 GASGGASGGGGGGGTGGAGGGGGGGGGGGGGGG-----GGGGGGG 502 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G GA GGGG G GGGGGGG Sbjct: 442 GGGTGGASG---GASGGGGGGGTGGASGGASGGGGGGG 476 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG G GG G GGGGGGGG Sbjct: 447 GASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGG 492 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G G GGG G G G GGGGGGGG Sbjct: 454 GGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGG 498 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG G GG G GGGGGGGG Sbjct: 450 GGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGG 495 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 G GG GG G G G GG G G GG GGGG Sbjct: 440 GTGGGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGG 484 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXG 760 GG AGGG GG G G GGGG G G Sbjct: 474 GGGTGGAGGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GGG G G Sbjct: 466 GGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGG----GGGGRGSG 506 >UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein - Acidiphilium cryptum (strain JF-5) Length = 320 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPP-----PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPPP P P P PPPP AP P PP PP P PP Sbjct: 90 PPPPPPAPHAAPKLPQPPVPPPPPPPPTPAPTPIPTPPPPPPHPPQKQTPP 140 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP----PLPPPAXXXXP 856 PPPPPPP P P+ PPPP P +P PLPP P Sbjct: 110 PPPPPPPTPAPTPIPTPPPPPPHPPQKQTPPKPAKKLPLPPKKTPPAP 157 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PP P P P P P PP Sbjct: 87 PPPPPPPPPAPHAAPKLPQPPVPPPPPPPPTPAPTPIPTPPPPPP 131 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPAXXXXP 856 P P P P P PPP AP P PP PPP P Sbjct: 78 PKPQPKVAPPPPPPPPPPAPHAAPKLPQPPVPPPPPPPPTPAP 120 >UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Rep: At1g02405 - Arabidopsis thaliana (Mouse-ear cress) Length = 134 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPPP P P PPPP + P PP PPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXP 856 PPPPP PPPP P P PLPPP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 PP PPPP P PPPP P PP Sbjct: 66 PPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P + PPP P PP P P PP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 >UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: Tfm5 protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 207 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGG GGG Sbjct: 59 GGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGG 104 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG GG G G GGGGGGGG Sbjct: 66 GSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGG 111 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG GG G G GGGGGGGG Sbjct: 73 GSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGG 118 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG G G G GG G G G GGGGGGG Sbjct: 75 GGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGG 119 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GGGG GGG GG G G GGGGGGG Sbjct: 80 GSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGG 123 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G G GGG GG GG G G GGGGGGGG+ Sbjct: 78 GSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGGQ 124 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/50 (42%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = -3 Query: 858 GGXXXXAGG-GRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GG G GG G GGGG G G GGGGGGG + + Sbjct: 77 GGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGGQVR 126 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG G G G+ G G G G GGGGGGG Sbjct: 68 GGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGG 112 Score = 40.7 bits (91), Expect = 0.059 Identities = 21/48 (43%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG---GGGXXGXGXXXXXGGGGGGG 724 GG +GGG G G G+ G GGG G G GGGGGGG Sbjct: 61 GGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGG 108 Score = 40.7 bits (91), Expect = 0.059 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G G G GG G G GGGGGGG Sbjct: 69 GGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGG 114 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG G G G+ GGG G G GGG G G Sbjct: 45 GGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSG 89 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +G G GG G+ GGG G G GGGG GG Sbjct: 59 GGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGG 103 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGG GGG GG G G GGG G GG Sbjct: 52 GGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGG 97 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG GG G+ GGG G G GGG G G Sbjct: 52 GGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTG 96 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GG GG G G GG G GGG Sbjct: 53 GGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGG 98 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GG G GGG Sbjct: 42 GGSGGGGSGSGGGGSGSGGGG---GGSGSGGGGSGSGGGGSGSGGG 84 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GGG GG G G GGG G GG Sbjct: 45 GGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGG 90 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G GG GG G G GG G GGG Sbjct: 46 GGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGG 91 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GGG GGG GG G G GGGG G Sbjct: 40 GSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSG 80 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GGG G G G+ GGG G G GGG G G Sbjct: 44 SGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSG 82 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGR----GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGGGG G Sbjct: 54 GGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSG 102 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGG GGG G G G GGGG G Sbjct: 43 GSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSG 87 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 827 GGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GG GG GG G G GGGG G G Sbjct: 40 GSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSG 75 >UniRef50_Q2V498 Cluster: Uncharacterized protein At2g05440.7; n=9; Magnoliophyta|Rep: Uncharacterized protein At2g05440.7 - Arabidopsis thaliana (Mouse-ear cress) Length = 133 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGG GGG Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 112 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG--GGGG 720 G G G GGGG GGG GG G G GGGG GGGG Sbjct: 74 GYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 120 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGG GGG Sbjct: 68 GGHGLDGYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 112 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 GG G G GGGG GG GG G G GGGGG Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGG 87 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG G G GGG GGGG Sbjct: 56 GGGHGHGGHNGGGGHGLDG-YGGGGGHYGGGGGHYGGGGGGHGGGG 100 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXG-GXXXXGXGXXXXXGGGG--GGGG 720 GG G G GGGG GG G G G G GGGG GGGG Sbjct: 45 GGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG 729 G G G GGGG GGG GG G G GGG G Sbjct: 80 GHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 122 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 858 GGXXXXAGGGR--GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 GG GGG GG G G GGGG G G GGG G Sbjct: 78 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 122 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGG---XXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GG GGG GG G G GGGGG GG Sbjct: 51 GGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGGHGG 98 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGA-----XXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GGGGG G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGGHG 97 Score = 34.7 bits (76), Expect = 3.9 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG--GGG 724 GG GGG GG G G GGGG G G GGGG GGG Sbjct: 76 GGGGGHYGGG-GGHYG--GGGGGHGGGGHYGGGGGGYGGGGGHHGGG 119 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG--GGG 720 G G GG G GGG GG G GGGGG GGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGG 85 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G GGG G G GGGG GG Sbjct: 54 GGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGGHGG 98 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = +2 Query: 719 FXPPPPP----PPXXXXXPXPSX--PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPP PP P PS PPPP AP P PP PPP PP Sbjct: 32 FAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPPPG-PPGPPPPGPYSPP 83 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PPPP PP P PPP P P PP PPP PP Sbjct: 14 YAPPPPGPPGRPPPPYDPFAPPPPPGPP--GPPGPPGPPPPSWHHPP 58 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 + P PPPP P P P PP P P P PPP+ PP Sbjct: 11 YDPYAPPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPP 59 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PPPP P P PP P P P PPA P Sbjct: 46 PPGPPPPSWHHPPPPDPFAPPPPPGPPGPPPPGPYSPPAPPGPP 89 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP P PP PP PP Sbjct: 7 PPPPYDPYAPPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPP 52 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P PP P P PPP PP Sbjct: 22 PGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPP 66 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PP P P PP PP Sbjct: 25 PPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPP 68 >UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaster|Rep: CG15021-PA - Drosophila melanogaster (Fruit fly) Length = 420 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP PPP P Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQP 253 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP PPP P PS P PP P P PP PPP P Sbjct: 119 YGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTP--PPRPPPQPTPSAP 163 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PP P +PP P P P Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXP--PPPXXXAPXXXPXRPP-LPPPAXXXXPP 859 + PP PP P PS P PPP P P RPP P P+ PP Sbjct: 93 YGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPP----PPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP PPP P PS P PP P P PP P P PP Sbjct: 144 YGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPP 194 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P+ P P P P P RPP P PP Sbjct: 75 PPPPPPP-----PQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPP 115 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P P P PP P P+ PP Sbjct: 75 PPPPPP--PPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXX-PXRPPLPPPAXXXXPP 859 P PP PP P P PP P P PP P P PP Sbjct: 349 PSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P+ PP P P P RP P P P Sbjct: 228 PPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P P PP P P LPPP P Sbjct: 244 PPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTP 287 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PP PP P P P PP AP P +PP PP Sbjct: 332 PPAPPAPAPGPTYQPRPPSPPAPPAPTYQP-QPPAPP 367 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +2 Query: 719 FXPPPP-PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 + PPPP PP P P PP P P P RPP PP Sbjct: 299 YGPPPPAPPAGPTYQPRPPAPPAP-APGPTYQP-RPPAPP 336 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P P P P PP P P PP P P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQP 377 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPA 841 PPPPP P P PS PP P P P P PPP+ Sbjct: 78 PPPPPQP-TPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPS 118 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPP-----PPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP P PP PS P PP P P RP PPP P Sbjct: 167 YGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQP 218 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P P P P PP P P PP Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPP 225 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPA 841 PPP P P P PS PP P P P PPP+ Sbjct: 103 PPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPS 143 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP--XRPPLPPPAXXXXP 856 PPPP P P PP P AP P P PPP P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXX-PXRPPLPPPAXXXXP 856 PPP PP P P PP P P PP P P P Sbjct: 302 PPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQP 346 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPP-PAXXXXPP 859 + P PP PP PP P AP RPP PP P PP Sbjct: 344 YQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPP 392 >UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000013088 - Anopheles gambiae str. PEST Length = 157 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS---XPPPPXXXAPXXXPXRPPL----PPPAXXXXPP 859 PPPPPPP P P PPPP AP P PP PPP PP Sbjct: 106 PPPPPPPRPVYGPPPQQSYGPPPPVHHAPPPPPPPPPRPVYGPPPPVHHAPP 157 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P P PPP PP Sbjct: 62 PPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGP-PPPVHHAPPP 106 Score = 39.5 bits (88), Expect = 0.14 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 11/58 (18%) Frame = +2 Query: 719 FXPPP-----PPPPXXXXXPXPSX--PPPPXXXAPXXXPXRPPL----PPPAXXXXPP 859 + PPP PPPP P P PPPP AP P PP PPP PP Sbjct: 70 YGPPPAPVYGPPPPQSYGPPPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQSYGPP 127 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA--PXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP A P P P PP + PP Sbjct: 45 PPPPPRPVYGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPP 91 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPP----PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P PPP P P PPP PP Sbjct: 89 PPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQSYGP-PPPVHHAPPP 136 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAP---XXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P PP PPP PP Sbjct: 104 PPPPPPPPPRPVYGPPPQQSYGPPPPVHHAPPPPPPPPPRPVYGPP 149 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PP PPP PP Sbjct: 546 PPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPP 590 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP + P PP PPP+ PP Sbjct: 548 PPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPP-PPPSSGGPPP 591 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PP PPP Sbjct: 545 PPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPP 582 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PPPP P PP PPP P Sbjct: 564 PPPPPPPPSSGGGPPPPPPPPSSGGPP-----PPPPPPGGMKKP 602 Score = 38.3 bits (85), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPP P PPPP P P LPP Sbjct: 577 PPPPPPPPSSGGPPPPPPPPGGMKKPGAPAVPNLPP 612 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P PPP + P PP PPP+ PP Sbjct: 537 PSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPP 578 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP P A P Sbjct: 589 PPPPPPPSGGGAPPPPPPPPPSGGKKAGAPGAPPTGPAAIQPNKP 633 Score = 40.3 bits (90), Expect = 0.078 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPP P PPPP + P PP PPP+ Sbjct: 573 PSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPPS 610 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 P PPPP P P PPPP P PP PP Sbjct: 573 PSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPPP 609 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP P P + PPPP P PP PPP Sbjct: 569 PPPSPSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPP 606 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P P PPP P PPPP PP PPP Sbjct: 571 PSPSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPPP 608 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP P PP PPPP P PP PPP Sbjct: 570 PPSPSPPPPISGGGAPPPPPPPPPPPSGGGAPPPPPPP 607 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 761 PXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PS PPPP P PP PPP+ PP Sbjct: 571 PSPS-PPPPISGGGAPPPPPPPPPPPSGGGAPP 602 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXA---PXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP + P P PP P PA PP Sbjct: 263 PPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPP 309 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPPP P P PPP P P PP PPP P Sbjct: 294 PGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYPYP 337 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPP-----LPPPAXXXXPP 859 PP PPPP P P PPPP AP P PP +PPP PP Sbjct: 276 PPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPP 328 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P PPP P P PPPP P PP PPP P Sbjct: 292 PYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYP 335 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P P P P P P PP PPP P Sbjct: 296 PPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYP 339 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPP P P PPPP P P +PP PPP Sbjct: 247 PYPPPPYPNPYPQPPYPPPPPPY-PNPYP-QPPYPPP 281 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 + P PPPP P PPPP P P PP P P P Sbjct: 245 YTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAPCSGPGP 290 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 PPPPPP P P PPPP P P P Sbjct: 308 PPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYPYP 341 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 P PPPPP P PPPP P P P P Sbjct: 306 PYPPPPPPYPEQVPPPPPPPPPPPPPPPYPYPYPYP 341 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPP P P P P P Sbjct: 308 PPPPPPYPEQVPPP---PPPPPPPPPPPPYPYPYPYP 341 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP AP PP PPP PP Sbjct: 548 PPPPPVPGNAPPPPPPPPPPPGAGAP------PPPPPPGPGLAPP 586 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P P PP P PS PPP P +PP+PPP Sbjct: 111 PQPAAPPPAQPAPPPSLPPPQASQPLAPPPAKPPIPPP 148 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP P PP P P PP Sbjct: 548 PPPPPVPGNAPPP--PPPPPPPPGAGAPPPPPPPGPGLAPPPP 588 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PP P P PP P Sbjct: 561 PPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGSSSPPAGGLVKP 604 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P PPPP P PP PPP PP Sbjct: 537 PPPPSA---PGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPP 575 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPP AP PPA P Sbjct: 560 PPPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGSSSPPAGGLVKP 604 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P P P P P P+ P P P P P PPP+ Sbjct: 88 PEPAPQPAPEPAPAPAAPEPAPKPQPAAPPPAQPAPPPS 126 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PPP AP P PP PP A PP Sbjct: 537 PPPPSAPGAGIPP----PPPVPGNAPPPPPPPPP-PPGAGAPPPP 576 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPX----RPPLPPPAXXXXPP 859 P P P P P+ PPP P P +P PPPA PP Sbjct: 100 PAPAAPEPAPKPQPAAPPPAQPAPPPSLPPPQASQPLAPPPAKPPIPP 147 >UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein; n=2; cellular organisms|Rep: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 1449 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = +2 Query: 719 FXPPPPPP-------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPPPPP P P P PPPP P PP PPP PP Sbjct: 1325 FTPPPPPPPSNIPPLPNTSAPPPPPPPPPPMDTPPIPSSSAPPPPPPPPGAAPP 1378 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX-----PPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P PS PPPP AP P PP P Sbjct: 1347 PPPPPPPPMDTPPIPSSSAPPPPPPPPGAAPPLPNASVPPPPRGAPPLP 1395 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP----PPAXXXXPP 859 PPPPPP P S PPPP P PPLP PP PP Sbjct: 1349 PPPPPPMDTPPIPSSSAPPPP----PPPPGAAPPLPNASVPPPPRGAPP 1393 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPP 1124 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPP P PP PPP Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPP 1125 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPPP P PP PPP Sbjct: 1086 PHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPP 1123 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PPPP P P P Sbjct: 1101 PPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHHPSGP 1137 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 P PPPP P P PPPP P PP PPP PP Sbjct: 1086 PHPPPP-----PPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXP------PPPXXXAPXXXPXRPPLPPP 838 F PPPPPPP P P P PPP P P PP PPP Sbjct: 952 FPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PP A PP Sbjct: 953 PPPPPPPPPGVGGPPPPPPPPGMGGPPP----PPPPPGAGPGGPP 993 >UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 454 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP AP P PP PP Sbjct: 171 PPPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPPPARPSPP 215 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXA--PXXXPXRPPLPPPAXXXXP 856 + PPPPPP P PPPP A P P PPPA P Sbjct: 168 YGAPPPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPPPARPSPP 215 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P PPPP A P PP PPPA PP Sbjct: 159 PPPPAHPAAYGAPPP--PPPPASYAA---PPPPP-PPPASYAAPP 197 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPS--XPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P PS PPPP A P PP PPPA PP Sbjct: 141 PSPPVRPAYAVPQPSYGAPPPPAHPAAYGAP--PPPPPPASYAAPP 184 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPP--XXXAPXXXPXRPPLPPPAXXXXPP 859 + PPP PP P P+ P PP P P PP + PP Sbjct: 193 YAAPPPAPPASYAAPPPARPSPPASYNQPPPPATYSQPSPPASYNQSPP 241 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP AP P P PPP Sbjct: 4 PPPPPPP-----PPPPPPPPPPLGAPPPPPLGAPPPPP 36 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PPPP AP P PP PP Sbjct: 7 PPPPPPPPPPPPPPLGAPPPPPLGAPPPPP--PPGPP 41 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 5 PPPPPPP-----PPPPPPPPPLGAPPPPPLGAPPPPPP 37 Score = 42.3 bits (95), Expect = 0.019 Identities = 16/35 (45%), Positives = 18/35 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL 829 PPPPPPP P + PPPP P P PP+ Sbjct: 8 PPPPPPPPPPPPPLGAPPPPPLGAPPPPPPPGPPV 42 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PPP PPPP P PP Sbjct: 5 PPPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPP 37 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P PPPP P P L P Sbjct: 15 PPPPPPLGAPPPPPLGAPPPPPPPGPPVSTDTPSLRKP 52 >UniRef50_UPI0000F2CE07 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 100 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GGG GG G G GGGGGGGG Sbjct: 29 GGVGGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGGGGGG 74 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GGGGGG G Sbjct: 32 GGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGGSG 77 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GG G G GG G G GGGGGGGG Sbjct: 27 GVGGVGGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGGG 71 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 837 GGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG G G G G GGGG G G GGGGGGG Sbjct: 32 GGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGG 70 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G G +GGGG GGG GG G G GGGGG G R Sbjct: 36 GVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGG--GGGGGSGLR 79 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG G G G G G GGGG G G GGGGGG Sbjct: 32 GGGVGVGGVGGGDGGGGGGGGGGGGGGGGGGDGGGGGGGGGGGG 75 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G G GGGG G G GGGGGGG Sbjct: 41 GGGDGGGGGGGGGGGGGGGGGGDGGG-----GGGGGGG 73 >UniRef50_UPI0000F2C6D3 Cluster: PREDICTED: hypothetical protein; n=2; Theria|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 149 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G RG E G G GGG GG G G GGGGGGGG Sbjct: 23 GGRGRERGRGGSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 64 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGGRG G GGGG G G GGGGGGG Sbjct: 16 GGYWFCGGGRGRERGRGGSGGGGGGGGGGGGGGGGGGGGGGGGG 59 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G G G GGGG G G GGGGGGG Sbjct: 23 GGRGRERGRGGSGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGG 64 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G+ GG GGG G G G GGGGGGGG Sbjct: 12 GKRAGGYWFCGGGRGRERGRGGSGGGGGGGGGGGGGGGG 50 >UniRef50_UPI0000E49516 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 108 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/46 (45%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG +GG G G G G G G GGGGGGGG Sbjct: 31 GGGGGGRGGDGGDGGDGGDGGDGGDGGGGGGGGGGGGGGGGGGGGG 76 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G G G GGGG G G GGGGGGG Sbjct: 32 GGGGGRGGDGGDGGDGGDGGDGGDGGGGGGGGGGGGGGGGGGGGG 76 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 R GGGG GG G G G GGGGGGGG Sbjct: 27 RSMVGGGGGGRGGDGGDGGDGGDGGDGGDGGGGGGGGGGG 66 >UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 592 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG GGGG Sbjct: 127 GGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGG 172 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GGGGG Sbjct: 134 GGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGG 179 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 131 GGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLG 175 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGG GGG Sbjct: 119 GGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGG 163 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 +G G GG GGG GG G G GGGGGGGG Sbjct: 108 KGSYGKGGGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGG 147 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGG GGG Sbjct: 126 GGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGG 171 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGGG GG Sbjct: 131 GGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGG 176 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GGGG G G G GGGGG Sbjct: 115 GGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGG 159 Score = 41.1 bits (92), Expect = 0.045 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GG GGGGG Sbjct: 120 GGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGG 165 Score = 41.1 bits (92), Expect = 0.045 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GE GGGG GGG GG G G GG GGG G Sbjct: 244 GGHLGG-GELGGGGGGIGGGGLGGGGAGLGGGGGGGFGGGKGGGFG 288 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGG GG Sbjct: 126 GGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGG 170 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG G G Sbjct: 139 GGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAG 184 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG G GG Sbjct: 140 GGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGG 185 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGG GGG GG G GGGG GGG+ Sbjct: 237 GGSGGYGGGHLGGGELGGGGGGIGGGGLGGGGAGLGGGGGGGFGGGK 283 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GG GGGG Sbjct: 120 GGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGG 164 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGG GG Sbjct: 134 GGGGGGGGGGGGG--GFGGGGGLGGGGGIGGGGGGGFGGGGGLGG 176 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG GG G G GG GGG Sbjct: 145 GGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGG 189 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GG GG GG Sbjct: 256 GGGIGGGGLGGGGAGLGGGGGGGFGGGKGGGFGGEGGYGGSGGLGG 301 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 GG GGG G G G GGGG G G GGGGG Sbjct: 137 GGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGG 179 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G GGG GG G G GGGGG GG Sbjct: 118 GGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGG 162 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G GGGG G G GGGGG G Sbjct: 112 GKGGGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLG 155 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGG GGG GG G G GGG GGGG Sbjct: 119 GGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGG 164 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG+GG G G GGG G G GGG GG Sbjct: 335 GGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGGLGGAGGGYGG 378 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGG--GRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G GG G GA GGG G G GGGG GG Sbjct: 195 GGAGGIGGGYGGAGGLGGGYGGAGGHGGGIEGGGGHGAGLGGGGSGG 241 Score = 38.3 bits (85), Expect = 0.31 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGG-GGXK 718 GG GGG+GG G G GG GG G G G GGG GG K Sbjct: 297 GGLGGGIGGGKGGGFGGAGGIGGSGGYGGSGGLGGGIGGGKGGGFGGGK 345 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGG 727 GG GGG+GG G G GG GG G G GGG GG Sbjct: 327 GGLGGGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGGLGG 371 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG-GGXK 718 GG GGG G G GGGG G G GGGGG GG K Sbjct: 236 GGGSGGYGGGHLGGGELGGGGGGIGGGGLGGGGAGLGGGGGGGFGGGK 283 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG+ G G G GG G G G GGGGG Sbjct: 324 GGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGG 368 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGG-XXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GG GGG Sbjct: 331 GGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGGLGGAGGG 375 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G GGGG G G GGG GGG Sbjct: 114 GGGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGG 157 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG G G GG G G GGGG G G GG GGG Sbjct: 146 GGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGG 189 Score = 37.5 bits (83), Expect = 0.55 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXG--XXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GG GG Sbjct: 152 GGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGGHSGGYGGAGG 199 Score = 37.5 bits (83), Expect = 0.55 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGG--GGGGG 724 GG AGG GG G GGGG G G GG GGGGG Sbjct: 211 GGGYGGAGGHGGGIEGGGGHGAGLGGGGSGGYGGGHLGGGELGGGGG 257 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GG GGG GG G G G GGGGG Sbjct: 231 GAGLGGGGSGGYGGGHLGGGELGGGGGGIGGGGLGGGGAGLGGGGG 276 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXX-XGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGGGG GG Sbjct: 124 GFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGGIGGGGGGGFGG 170 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXG-XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GG GGG Sbjct: 144 GGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGG 189 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG--GGXXGXGXXXXXGGGGGGG 724 GG AGG GG G GA GG GG G G GG GGG Sbjct: 177 GGGHSGAGGIGGGHSGGYGGAGGIGGGYGGAGGLGGGYGGAGGHGGG 223 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GG GG Sbjct: 249 GGELGGGGGGIGG-GGLGGGGAGLGGGGGGGFGGGKGGGFGGEGG 292 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GG GG G G GGG GGG Sbjct: 261 GGGLGGGGAGLGGGGGGGFGGGKGGGFGGEGGYGGSGGLGGGIGGG 306 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G GGG GG Sbjct: 265 GGGGAGLGGGGGGGFGGGKGGGFGGEGGYGGSGGLGGGIGGGKGG 309 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG+GG G G GG GG G G GG GG G Sbjct: 273 GGGGGGFGGGKGGGFGGEGGYGGSGGLGGGIGGGKGGGFGGAGGIG 318 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G GA GGG G G GGG GG Sbjct: 164 GGGGFGGGGGLGG-GGGHSGAGGIGGGHSGGYGGAGGIGGGYGG 206 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GG GG G G GGG G G GGG GGG Sbjct: 243 GGGHLGGGELGGGGGGIGGGGLGGGGAGLGGGGGGGFGGGKGGG 286 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXG-GGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +G GGG G GG GG G G GG GGG G Sbjct: 331 GGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGGLGGAGGGYG 377 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G G G+ G G G GG G G GGGGGGG Sbjct: 107 GKGSYGKGGGIGGGGGAGFGGGFGGGFGGGGGGGGGGG 144 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G G G GG G G GGGGG GG Sbjct: 112 GKGGGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGG 156 Score = 36.3 bits (80), Expect = 1.3 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G EGGGG G G GG G GGGGG GG Sbjct: 218 GGHGG--GIEGGGGHGAGLGGGGSGGYGGGHLGGGELGGGGGGIGG 261 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG GG G G GG GG GG Sbjct: 250 GELGGGGGGIGGGGLGGGGAGLGGGGGGGFGGGKGGGFGGEGGYGG 295 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG+ G GA GG G G G GGG GGG Sbjct: 294 GGSGGLGGGIGGGKGGGFGGAGGIGGSG--GYGGSGGLGGGIGGG 336 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G G GG GG GG G G GGG GGG Sbjct: 318 GGSGGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGG 362 Score = 36.3 bits (80), Expect = 1.3 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGG-GGXXXGGGXXXXGGXXXXGXGXXXXXGGG-GGGGG 720 GG G G GG GG GG GG G G GGG GGGGG Sbjct: 321 GGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGGGGLGGGIGGGGG 368 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGG G G GG G G G GGGGG Sbjct: 115 GGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGGLGGGGG 159 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GGGG G G GG G G Sbjct: 140 GGGGGGGGFGGGGGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAG 184 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GGG GG G Sbjct: 165 GGGFGGGGGLGGGGGHSGAGGI--GGGHSGGYGGAGGIGGGYGGAG 208 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG GG G G GG GGGG Sbjct: 211 GGGYGGAGGHGGGIEGGGGHGAGLGGGGSGGYGGGHLGGGELGGGG 256 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GG GG Sbjct: 254 GGGGGIGGGGLGGGGAGLGGGGGGGFGGGKGGGFGGEGGYGGSGG 298 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG G G G GG GGGGG Sbjct: 109 GSYGKGGGIGGGGGAGFGGGFGGGFGGGGGGGGGGGGGGFGGGGG 153 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G G GG GG Sbjct: 158 GGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGGHSGGYGGAGGIGG 202 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G GG GGG G Sbjct: 161 GGGGGGGFGGGGGLGGGGGHSGAGGIGGGHSGGYGGAGGIGGGYG 205 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +G GGG GGG GG G G GG GG GG Sbjct: 339 GGFGGGKGGGFGGGIGGGGGL---GGGIGGGGGLGGAGGGYGGHGG 381 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G G G GGG Sbjct: 343 GGKGGGFGGGIGGGGGLGGGIGGGGGLGGAGGGYGGHGGEAGFGGG 388 Score = 35.1 bits (77), Expect = 2.9 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGG-GXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGG G GGG GG G G GGG GGG Sbjct: 266 GGGAGLGGGGGGGFGGGKGGGFGGEGGYGGSG-GLGGGIGGGKGGG 310 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GG G G G GGG GGGG Sbjct: 312 GGAGGIGGSGGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGGG 357 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGG-GGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG GG GGG G G G GGG GG G Sbjct: 347 GGFGGGIGGGGGLGGGIGGGGGLGGAGGGYGGHGGEAGFGGGEGGFG 393 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GGGG G G GG GG Sbjct: 152 GGLGGGGGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGGHSGGYGG 196 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GG GG G G G GG GG Sbjct: 277 GGFGGGKGGGFGGEGGYGGSGGLGGGIGGGKGGGFGGAGGIGGSGG 322 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEG--GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G EG GG GGG G G G GG GG GG Sbjct: 281 GGKGGGFGGEGGYGGSGGLGGGIGGGKGGGFGGAGGIGGSGGYGGSGG 328 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G G G G GG G G GGG GGG Sbjct: 312 GGAGGIGGSGGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGG 356 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 824 GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GG GG G G GGGGGGGG Sbjct: 107 GKGSYGKGGGIGGGGGAGFGGGFGGGFGGGGGGGG 141 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G GG GG G G G GGG GG Sbjct: 171 GGGLGGGGGHSGAGGIGGGHSGGYGGAGGIGGGYGGAGGLGGGYGG 216 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GG GG G GGGG G G Sbjct: 188 GGHSGGYGGAGGIGGGYGGAGGLGGGYGGAGGHGGGIEGGGGHGAG 233 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG AG G GG G G GGG G G GG GGGG Sbjct: 226 GGGGHGAGLGGGGSGG--YGGGHLGGGELGGGGGGIGGGGLGGGG 268 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GG G G G G G G GGG GGG Sbjct: 308 GGGFGGAGGIGGSGGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGG 352 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GG G GG GG G G G GGGGG Sbjct: 315 GGIGGSGGYGGSGGLGGGIGGGKGGGFGGGKGGGFGGGIGGGGG 358 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GG GG G GGG GG G Sbjct: 198 GGIGGGYGGAGGLGGGYGGAGGHGGGIEGGGGHGAGLGGGGSGGYG 243 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GGGG GG GG G G G GGGG G Sbjct: 226 GGGGHGAGLGGGGSGGYGGGHLGGGELGGGGGGIGGGGLGGGGAG 270 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGG-XXXXGXGXXXXXGGGGGGG 723 GG G G GG G GGG GG G G GGG GGG Sbjct: 291 GGYGGSGGLGGGIGGGKGGGFGGAGGIGGSGGYGGSGGLGGGIGGG 336 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG G G G G G GGG GG Sbjct: 354 GGGGGLGGGIGGGGGLGGAGGGYGGHGGEAGFGGGEGGFGGGKGG 398 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG G G G GG GGG Sbjct: 158 GGIGGGGGGGFGGGGGLGGGGGHSGAGGIGGGHSGGYGGAGGIGGG 203 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G GA GGG G GGGG G Sbjct: 187 GGGHSGGYGGAGGIGGGYGGAGGLGGGYGGAGGHGGGIEGGGGHG 231 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G G GGG G G GGG GGG Sbjct: 218 GGHGGGIEGGGGHGAGLGGGGSGGYGGGHLGGGELGGGGGGIGGG 262 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 855 GXXXXAGGGR-GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 G GGG GG+ G G GG G G G GGG GG Sbjct: 270 GLGGGGGGGFGGGKGGGFGGEGGYGGSGGLGGGIGGGKGGGFGG 313 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGG 727 GG GGG G G G G GGG G G GGG GG Sbjct: 347 GGFGGGIGGGGGLGGGIGGGGGLGGAGGGYGGHGGEAGFGGGEGG 391 >UniRef50_Q6H3Y0 Cluster: Glycine-rich protein GRP22-like; n=3; Oryza sativa|Rep: Glycine-rich protein GRP22-like - Oryza sativa subsp. japonica (Rice) Length = 214 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G RGE GGGG GGG G G GGGGGGGG Sbjct: 94 GYGGSRGEGGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGG 138 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGG G Sbjct: 131 GGGGGGGG--GGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGGGAG 174 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G A GGG G GGGGGGG Sbjct: 96 GGSRGEGGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGG 140 Score = 37.5 bits (83), Expect = 0.55 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG-----GGGGG 720 GG G G GGGG GGG G G G GGG GGGGG Sbjct: 121 GGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGG 171 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGR----GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G GR GG G G GGGG G G GG GG G Sbjct: 105 GGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIG 153 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG A G GG G G GGGG G G G GG GG Sbjct: 110 GGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIGG 154 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 45.2 bits (102), Expect = 0.003 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP PP PPP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKP 87 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PP P P PP Sbjct: 58 PPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPP 103 Score = 37.1 bits (82), Expect = 0.73 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F PPPPP P P PPPP +PPP Sbjct: 38 FPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPP 77 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP S PPPP P +PP PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPP 118 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 740 PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP P P PPPP P P PP PPPA Sbjct: 35 PPLFPQSPPPPPPPPPPPPPP---PPPPPPPPPA 65 >UniRef50_Q02021 Cluster: Glycine-rich protein; n=3; Eukaryota|Rep: Glycine-rich protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 132 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G GGGG GGG GG G G GG GGGGGR Sbjct: 74 GGGYPGGGYPGGGGYRGGGGRYPGGGGGGRGGGRYSGGGGRGGGGGR 120 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGR G G G GGGG G G GGGGG G Sbjct: 60 GGGGGYPGGGRSGGGGGYPGGGYPGGGGYRGGGGRYPGGGGGGRG 104 Score = 44.0 bits (99), Expect = 0.006 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGG GGR Sbjct: 80 GGYPGGGGYRGGGGRYPGGGGGGRGGGRYSGGG---GRGGGGGRGGR 123 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G GGGG GGG GG G G GGGG GGGR Sbjct: 62 GGGYPGGGRSGGGGGYPGGGYPGGGGYRGGG-GRYPGGGGGGRGGGR 107 Score = 39.1 bits (87), Expect = 0.18 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -3 Query: 858 GGXXXXAGGGR--GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGGR GG G G GGGG G G GG GGGG K Sbjct: 84 GGGGYRGGGGRYPGGGGGGRGGGRYSGGGGRGGGG---GRGGRGGGGRK 129 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGG GGG GG G G G GGGGR Sbjct: 68 GGRSGGGGGYPGGGYPGGGGYRGGGGRYPGGGGGGRGGGRYSGGGGR 114 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 G GGGRGG G G GGGG G GG GGG + Sbjct: 49 GGGGYPGGGRGGGGGGYPGGGRSGGGGGYPGGGYPGGGGYRGGGGR 94 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G G GGGG Sbjct: 49 GGGGYPGGGRGGGGGGYPGGGRSGGGGGYPGGGYPGGGGYRGGGG 93 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGG G G GGGG GG Sbjct: 72 GGGGGYPGGGYPGGGGYRGGGGRYPGGGGGGRGGGRYSGGGGRGG 116 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G GGGG GGG GG G G GGGGG Sbjct: 39 GYPGGGGGYPGGGGYPGGGRGGGGGGYPGGGRSGGGGG 76 Score = 35.9 bits (79), Expect = 1.7 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXG--GGGGGGGR 717 GG G G GG GGG GG G G G GGGGGGR Sbjct: 55 GGGRGGGGGGYPGGGRSGGGGGYPGGGYPGGGGYRGGGGRYPGGGGGGR 103 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G GGGG G G GG GGG Sbjct: 38 GGYPGGGGGYPGGGGYPGGGRGGGGGGYPGGGRSGGGGGYPGGG 81 Score = 35.5 bits (78), Expect = 2.2 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG--GGGGR 717 GG G GGGG GGG GG G GGGG GGGGR Sbjct: 50 GGGYPGGGRGGGGGGYPGGGRSGGGGGYPGGG----YPGGGGYRGGGGR 94 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGG GGG GG G G G GGGG R Sbjct: 45 GGYPGGGGYPGGG--RGGGGGGYPGGGRSGGGGGYPGGGYPGGGGYR 89 >UniRef50_A2YY95 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 164 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PP PPPP P PS PPP P P P PPP+ Sbjct: 103 PPSPPPPDPSLQPSPSPDPPPLPSPPLDPPPPSPSPPPS 141 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 767 PSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PS PPP P P PPLP P PP Sbjct: 104 PSPPPPDPSLQPSPSPDPPPLPSPPLDPPPP 134 >UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.8; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein R04E5.8 - Caenorhabditis elegans Length = 997 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/51 (41%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP------XXXPXRPPLPPPAXXXXPP 859 PPPPPPP S PPPP P P RPP+ PP+ PP Sbjct: 122 PPPPPPPRKSRAGGSSPPPPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPP 172 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P RPP PP+ P Sbjct: 138 PPPPPPPRVPRTPPPRSPPPRRPPMTPPSPQRRPPRTPPSPEPRNP 183 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 127 GGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGG 172 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 135 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGG 180 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGG GGG Sbjct: 63 GGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGG 108 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 127 GGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCG 171 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 135 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 179 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGGG GGG GG G G GGGGGGG Sbjct: 142 GGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGG 185 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXG--XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 139 GGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGG 185 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GGG GG G G GGGG G G GGGGGG Sbjct: 119 GGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGG 155 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGG G Sbjct: 144 GGGGGCGG--GGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCG 187 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G GGGGGG Sbjct: 119 GGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGG 162 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGGG GG Sbjct: 143 GGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCGG 188 Score = 41.1 bits (92), Expect = 0.045 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGGG GG Sbjct: 120 GGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGG 165 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGG GG Sbjct: 63 GGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGG 107 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGGGG G Sbjct: 62 GGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCG 106 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GGGGG G Sbjct: 120 GGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCG 164 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G G GG GGGG Sbjct: 123 GGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGG 167 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGGG GGG GG G GGGGGGG Sbjct: 134 GGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGG 177 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGG GGG Sbjct: 147 GGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGG---GGGGCGGG 189 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGG GGG Sbjct: 66 GGGGGGCGGGGGGCGG--GGGCGGGGGGCGGGGGGCGGGGGCGGG 108 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GGG G G GGGGGG Sbjct: 131 GGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGG 176 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GG GG G G GGGG G G G GGG G K + Sbjct: 147 GGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCGGGCGRKKR 195 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGG Sbjct: 83 GGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGG 128 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G GGGGGG G Sbjct: 119 GGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCG 164 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G GGGGGG G Sbjct: 126 GGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCG 171 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 824 GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GGG GGG GG G G GGG GGGG Sbjct: 62 GGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGG 96 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXG-----XXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG GGGG Sbjct: 76 GGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGG 126 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG-GXXGXGXXXXXGGGGGGG 724 GG GGG GG GGG G G G GGGGGGG Sbjct: 95 GGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGG 140 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G GGGGGG Sbjct: 26 GGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGG 71 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G GG GGGGG Sbjct: 33 GGGCGGGGGCGGGGGC-GGGCAPPPPPPACGGGCGGGGGGCGGGGG 77 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG GGG G G GGG GGG Sbjct: 38 GGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGG 82 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG GG GGGG Sbjct: 82 GGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGG 126 Score = 33.9 bits (74), Expect = 6.8 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGG-------XXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGG GGG GG G G GGGGGGG Sbjct: 89 GGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGG 140 Score = 33.9 bits (74), Expect = 6.8 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 5/51 (9%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG-----GXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGGGGG Sbjct: 90 GGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGG 140 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P PPPP P PP PP Sbjct: 472 PPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPP 508 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P PPPP P PP PPP Sbjct: 471 PPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPP 507 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP PP PPP Sbjct: 471 PPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPPPP 508 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PPPP AP P PP PP PP Sbjct: 462 PSSSPPPRT---PPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPP 503 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 717 SSXPPP---PPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 SS PPP PPPP PP PP APP PP Sbjct: 463 SSSPPPRTPPPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPPPP 506 >UniRef50_O01900 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1621 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP--XXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP AP P P PPP Sbjct: 1342 PPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPPP 1381 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXP-PXXXXPPXXXXXAPPFLPPXXXXPP 857 SS P PPPPP P P P PP AP +P PP Sbjct: 1333 SSSPSPPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVPPPP 1380 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 725 PPPPPPP-----XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P PP P P Sbjct: 1356 PPPPPPPPTMSKAPTGVPLPVPPPPPLFSPSMILPPPPPPLPSEEKKNP 1404 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +2 Query: 725 PPPPPPPXXXXXP----XPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPPP P PLP P Sbjct: 1336 PSPPPPPPPPPPPSDDLTPVPPPPPPPPTMSKAPTGVPLPVP 1377 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 45.2 bits (102), Expect = 0.003 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP PP Sbjct: 383 PPPPPPPPVGGPPP--PPPPIEGRPPSSLGNPPPPPPPGRGAPP 424 Score = 39.9 bits (89), Expect = 0.10 Identities = 24/88 (27%), Positives = 26/88 (29%) Frame = +3 Query: 594 PXFXXGXXPPPPKXKKNXXRGGXXXXFXXXXXXXXXXXXXXSSXPPPPPPPXXXXXPXXX 773 P G PPPP ++ R PPPPPP P Sbjct: 338 PPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP-PP 396 Query: 774 XXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 PP PP PP PP PP Sbjct: 397 PPPPIEGRPPSSLGNPPPPPPPGRGAPP 424 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP---SXPPPP--XXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PP PPP PP Sbjct: 346 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 395 Score = 36.7 bits (81), Expect = 0.96 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 8/52 (15%) Frame = +2 Query: 728 PPPPPPXXXXXPXPS----XPPPPXXXAPXXXPXR----PPLPPPAXXXXPP 859 PPPPP P PS PPP AP P R PP PPP+ P Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRP 358 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXP----XPSXPPPPXXXAPXXXPXRP 823 PPPPPPP P P PPPP AP P P Sbjct: 394 PPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 430 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPP P R PPP+ PP Sbjct: 335 PPPPPARMGTAPPP--PPPSRSSQRPPPPSRGAPPPPSMGMAPP 376 Score = 34.7 bits (76), Expect = 3.9 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPP----PPPPXXXXXPXP---SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPPP P P + PPPP P PP PPP PP Sbjct: 359 PPPSRGAPPPPSMGMAPPPVGGAAPPPP----PPPPVGGPPPPPPPIEGRPP 406 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPP-----PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P P PPPP P P PP + PP Sbjct: 366 PPPPSMGMAPPPVGGAAPPP-PPPPPVGGPPPPPPPIEGRPPSSLGNPPP 414 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP AP P P + P Sbjct: 338 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGP 375 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXP 855 P PP PPP PPPP P P P Sbjct: 338 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPP 367 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP AP P P + P Sbjct: 949 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPPGLPGVDGP 986 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXP 855 P PP PPP PPPP P P P Sbjct: 949 PPPPPPPGGAGPPPPPPPPPPGLPAPPPPP 978 >UniRef50_Q2HDB3 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 174 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GG G GG GG G G GGGGGGGG Sbjct: 86 GGGWGGRGWVGGEGEGEGGEDGEGGGGGGSGYGGGGAGGGGGGGGG 131 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -3 Query: 834 GGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G GGGG G G GGGGGGG Sbjct: 96 GGEGEGEGGEDGEG--GGGGGSGYGGGGAGGGGGGGG 130 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 45.2 bits (102), Expect = 0.003 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P PPPP AP P PP PPPA Sbjct: 1397 PPPPPPAFSAAAPPPPPPPPPVGGAPGGPP--PP-PPPA 1432 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P+ PPPP A PP PPP P Sbjct: 1379 PPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAP 1422 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPP---XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P + PPPP P PP PPP Sbjct: 1377 PPPPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPP 1417 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 S PPPPPPP P PP APP PP Sbjct: 1374 SMPPPPPPPPVPAPFADAPPTAPPPPPPPAFSAAAPPPPPP 1414 >UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria|Rep: Proline-rich protein 12 - Homo sapiens (Human) Length = 1215 Score = 45.2 bits (102), Expect = 0.003 Identities = 22/45 (48%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPAXXXXP 856 PPPPPPP P P+ P PP AP P PPLPPP P Sbjct: 650 PPPPPPP-----PQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMP 689 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P P P P PP PPPA PP Sbjct: 652 PPPPPPQPALPSPPPLVAPTPSSPPP---PPLPPPPPPAMPSPPP 693 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PPP P P PPPP P P PPL P PP Sbjct: 636 PPPTPPPAPT--PQPQPPPPPPPPQP-ALPSPPPLVAPTPSSPPP 677 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PPP P P PPPP P P P P P Sbjct: 677 PPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELP 720 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 7/46 (15%) Frame = +2 Query: 725 PPPPPP-----PXXXXXPXPSXPPPP--XXXAPXXXPXRPPLPPPA 841 PPPPP P P PS PPPP P P PP PPPA Sbjct: 653 PPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPA 698 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P P PPP PPPP+ P P PP Sbjct: 664 PPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPP 696 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PPPP P P+ P PP P P P PA Sbjct: 672 PSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPA 710 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPP PP PPPP AP P P P Sbjct: 676 PPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAAP 712 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 P PP P P+ PP P P P PP PP PA PP Sbjct: 627 PEPPLLEEKPPPTPPPAP---TPQPQPPPPPPPPQPALPSPPP 666 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 45.2 bits (102), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PP P P P PPPP P P PP PPP Sbjct: 575 PPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPP 612 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P P PPPP P PP PPP P Sbjct: 574 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP PP P P PPPP P PP PPP Sbjct: 574 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPP 611 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P + P P P PP PP PP Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPP 586 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP 814 PPPPPPP P PPPP P P Sbjct: 586 PPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 Score = 34.3 bits (75), Expect = 5.1 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPP--XXXXXPXPSXPP--PPXXXAPXXXPXRP---PLPPPAXXXXPP 859 PPPPP P PS PP PP +P P P LPPP PP Sbjct: 543 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPP 594 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PP P P PP PPP P Sbjct: 558 PPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 602 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +2 Query: 725 PPPPPPPXXXXX--PXPSXPPPPXXXAP 802 PPPPPPP P P PPPP P Sbjct: 589 PPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 >UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 153 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G GGGGGGGG Sbjct: 86 GGTDGGNDGGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGG 131 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GG GG G G GGGGGGGG Sbjct: 90 GGNDGGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGGGGGG 135 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 99 GGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGG-----GGGGGGG 138 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GG GG G G GGGG G G GGGGGG Sbjct: 95 GGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGGGGGGGGG 138 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G +GGGG GG G G G GGGGGGGG Sbjct: 94 GGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGGGGGGGGG 138 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G+ GGGG G GG G G GGGGGGG Sbjct: 94 GGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGGGGGGGGG 138 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 96 GGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGG-----GGGGGGG 135 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +GG GGG GG G GGGGGGGG Sbjct: 80 GGGGDGGGTDGGNDGGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGG 125 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +G GGG GG GG G G GGGGG G Sbjct: 96 GGGGGGKGGGGGGSGGTEGGNDGGGGGGGGGGGGGGGGGGGGGNDG 141 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G G GGG G GGGGGGG Sbjct: 82 GGDGGGTDGGNDGGGGGGGGKGGGGGGSGGTEGGNDGGGGGGGGG 126 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G G GG G G GGGG G G GGGG GG Sbjct: 78 GVGGGGDGGGTDGGNDGGGGGGGGKG----GGGGGSGG 111 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P PPPP P PP PPP PP Sbjct: 425 PPPPLPPGVGAPPPPPPPPPPPLPGGSCIP--PPPPPPGMGGAPP 467 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PPLP A PP Sbjct: 454 PPPPPPPGMGGAP----PPPPPPPFPGGVPPPPPLPGGAPPPPPP 494 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P S PPP PP PPP PP Sbjct: 436 PPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPP 480 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PP P P PP Sbjct: 438 PPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPP 482 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P PP P P PP Sbjct: 466 PPPPPPP-----PFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPP 505 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP------SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P + PPPP P PP P PP Sbjct: 467 PPPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PP AP P PP P P PP Sbjct: 420 PPPPPPP---------PPLPPGVGAPPPPPPPPPPPLPGGSCIPP 455 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPP---XXXXPPXXXXXAPPFLPP 839 S PPPPPPP P PP PP APP PP Sbjct: 451 SCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPP 494 >UniRef50_UPI00004D5DA1 Cluster: YLP motif containing protein 1 (Nuclear protein ZAP3) (ZAP113).; n=1; Xenopus tropicalis|Rep: YLP motif containing protein 1 (Nuclear protein ZAP3) (ZAP113). - Xenopus tropicalis Length = 1352 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPPAXXXXP 856 P P PPP P P PPPP P P RPPLP P P Sbjct: 130 PEPAPPPEPAPPPEPDQPPPPEPAQQPPPEPARPPLPDPEKRLQP 174 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P + PPPP +PPLPPP P Sbjct: 527 PPPLPPVTAAPPTEAPPPPPPPLLSTES--QPPLPPPRFGAPP 567 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR---PPLPPPAXXXXPP 859 PPPPPPP P PPP P R PP P PP Sbjct: 542 PPPPPPPLLSTESQPPLPPPRFGAPPAPGQPRAGAPPAPGQPRAGAPP 589 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P+ PP PP AP P +PP P PA P Sbjct: 112 PPPQHHQTNPPLPEPAPPPEPAPPPEPAPPPEPDQPPPPEPAQQPPP 158 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXP--PPP---XXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P P PPP P P PP P P PP Sbjct: 93 PFPPPPFVSSLPPPGYPSYPPPQHHQTNPPLPEPAPPPEPAPPPEPAPP 141 >UniRef50_UPI0000DC2237 Cluster: RIKEN cDNA D030022P06 gene; n=6; Theria|Rep: RIKEN cDNA D030022P06 gene - Rattus norvegicus Length = 2991 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P P+ P PP P P PP+PPP PP Sbjct: 2224 PPAPPPAASPAPAPA-PAPPAPPPPVLPPVLPPVPPPPPAPSPP 2266 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PPPP P P PP P A P Sbjct: 2241 PPAPPPPVLPPVLPPVPPPPPAPSPPAPSPAPPPPAPAASVASAP 2285 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXP-XPSXPPPPXXXAPXXXPXRPPLPPPA 841 P PP PP P P PPPP +P PP P PA Sbjct: 2239 PAPPAPPPPVLPPVLPPVPPPPPAPSPPAPSPAPPPPAPA 2278 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P + P P AP P PP+ PP PP Sbjct: 2216 PRPAPPPAPPAPPPAASPAPAPAPAPPAPP--PPVLPPVLPPVPP 2258 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PPP AP P P PA PP Sbjct: 2203 PPRCSPVRERIPRPRPAPPPAPPAPPPAASPAPAPAPAPPAPPP 2246 >UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n=1; Bos taurus|Rep: UPI0000F30DFE UniRef100 entry - Bos Taurus Length = 591 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PP PPP P PS PPPP +P P PP P PP+ PP Sbjct: 330 PPRPPPPSPQPPPPSPPPPP--SSPSSPPPSPPQPLPPSPPPSPP 372 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P PP P PS P P P P PP PP PP Sbjct: 335 PPSPQPPPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPP 379 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/45 (42%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P PS PP P +P P PPP+ PP Sbjct: 343 PSPPPPPSSPSSPPPS-PPQPLPPSPPPSPPPSLPPPPSSPSSPP 386 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPP PP P P PP PP LPP P Sbjct: 337 SPQPPPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSP 382 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +2 Query: 725 PPPPP-----PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP PP P P PPP + P P PPP+ P Sbjct: 345 PPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSPSSPPPSINAHP 393 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-PPLPPPAXXXXPP 859 PP PPP PS PP P AP P PP PP A P Sbjct: 419 PPRAPPPGAPLPQLPS-PPDPANAAPGAQPPEGPPTPPQALSPPEP 463 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P+ PP P PP PP A P Sbjct: 535 PPPPTPPQALSPPEPADTPP-----GAQAPEGPPTPPQALRPPDP 574 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P PPPP P RPP PP Sbjct: 119 PPPPPPPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPP 155 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/74 (29%), Positives = 24/74 (32%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP ++ L PPPPPPP PPPP Sbjct: 82 PPPPLPPPQTGCASPGFYSPLQEPPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPP 141 Query: 797 APXXXPXRPPLPPP 838 P P P PPP Sbjct: 142 PPPLPPSPRPPPPP 155 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PP Sbjct: 134 PPPPPPPPPPPLPPSPRPPPPPYSYAIKHAGHPAAAPPLSSPSPP 178 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PPPP PP PPP PP Sbjct: 105 PPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPP 147 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P P P PPPP + P PP PPP P Sbjct: 105 PPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPP 147 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PPPP P PP PPP P Sbjct: 105 PPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPPSP 149 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP PPP PP Sbjct: 321 PPPPPPPPGNMGVLP--PPPPPRPGNMGVPPPPPPPPPGNMGVPP 363 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPPP P PP PPP PP Sbjct: 336 PPPPPRPGNMGVPPPPPPPPPGNMG---VPPPPPPPPPGNMCIPP 377 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 6/45 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP------LPPPA 841 PPPPPPP P P PPPP P PP LPPPA Sbjct: 350 PPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPA 394 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P A PP Sbjct: 363 PPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPP 407 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 362 PPPPPPPPPGNMCIPPPPPPPPGYTGSSLP--PPAPPP 397 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPP A P PP PP PP Sbjct: 377 PPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPP-PPLGGKFLPP 420 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P PP P PP Sbjct: 348 PPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPP 392 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPP PPP P PPPP P PP PP Sbjct: 391 PPPAPPPPQNASMAPPPPPPPPLGGKFLPPPPPPPPP 427 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP PPPP PP PPP PP Sbjct: 278 PPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPP 322 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PPPP P PP PP PP Sbjct: 294 PPPPPPP--GTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPP 336 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PPPP P PP P PP Sbjct: 309 PPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPP 351 >UniRef50_Q8YTC9 Cluster: All2793 protein; n=3; Bacteria|Rep: All2793 protein - Anabaena sp. (strain PCC 7120) Length = 681 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G A GGGG G G GGGGGGG Sbjct: 215 GGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGGGGGGGGGG 259 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG G G GGGGGGGG Sbjct: 210 GGFGVGGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGGGGG 254 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG G G GGGGGGGG Sbjct: 210 GGFGVGGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGGGGGG 255 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG G G G G GGGGGGGG Sbjct: 213 GVGGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGGGGGGGG 257 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GG G G GGGGGGGG Sbjct: 215 GGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGGGGGGGGGGG 260 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 G GG GG G G+ G GGG G GGG GGG Sbjct: 177 GGIVPTSGGNGGAAGRIVGSTGLGAGGGVSGSSGGFGVGGGSGGG 221 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G G G GG G GGGGG GG Sbjct: 200 GAGGGVSGSSGGFGVGGGSGGGGGGGAGGAGAFRNATGGGGGGFGG 245 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GG G GGG G G GG GGGGG Sbjct: 207 GSSGGFGVGGGSGGGGGGGAGGAGAFRNATGGGGGGFGGYGGGGG 251 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G G GGGG G GG GG G Sbjct: 240 GGGFGGYGGGGGGGGGGGGGGANVLGGQARPGGAGGLG 277 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GG GG GG Sbjct: 237 GGGGGGFGGYGGGGGGGGGG----GGGGANVLGGQARPGGAGGLGG 278 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGG-XXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G G G GR Sbjct: 241 GGFGGYGGGGGGGGGGGGGGANVLGGQARPGGAGGLGGAAGAFAGAGR 288 >UniRef50_Q3KEU2 Cluster: Putative uncharacterized protein precursor; n=2; Pseudomonas|Rep: Putative uncharacterized protein precursor - Pseudomonas fluorescens (strain PfO-1) Length = 220 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G G GGGGGG Sbjct: 39 GSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGG 84 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GG GGGGG Sbjct: 38 GGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGG 83 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GGG GGG Sbjct: 44 GSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGG 88 Score = 43.2 bits (97), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GG GGGG Sbjct: 38 GGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGG 82 Score = 43.2 bits (97), Expect = 0.011 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG GGGG Sbjct: 46 GGGGGGGGNGGGGGGNGGGG--SGGGGGGNGGGGSGGGGGGNGGGG 89 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG GG G G GG GGG Sbjct: 52 GGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGG 96 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GGG GG Sbjct: 56 GGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGG 99 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G G GG GGG Sbjct: 51 GGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGG 96 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G GGGG GG Sbjct: 43 GGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGG 87 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GG G GGGG GG Sbjct: 48 GGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGG 92 Score = 40.7 bits (91), Expect = 0.059 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G GG GG G Sbjct: 50 GGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNG 94 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG G G Sbjct: 64 GGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSG 109 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G G GG GG G Sbjct: 57 GGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSG 101 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG GG G Sbjct: 58 GGGNGGGGSGGGGGGNGGGGSGGGGGGN--GGGGSGGNGGGHGGSG 101 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGGG GGG GG G G GG GG G Sbjct: 57 GGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSG 101 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G G GGG G G G GGGG Sbjct: 68 GGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGG 112 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 GG G G GGGG GGG GG G G G GGGG Sbjct: 70 GGGNGGGGSGGGGGGNGGGGSGGNGG-GHGGSGSGGNSGSGGGG 112 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G + +EGG G GG GG G G GGGGGG Sbjct: 29 GVSSVQAKEGGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGG 72 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G +GGG GG G G G GG G GG G GG Sbjct: 60 GNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGG 104 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGGG GG GG G G GGGG G Sbjct: 71 GGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSG 115 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG GG G G GG G GG Sbjct: 59 GGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGG 104 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG----GGGG 720 GG G G GGG GGG GG G G GG GGGG Sbjct: 63 GGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGG 112 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G GG G G G GGGG G Sbjct: 71 GGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSG 115 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G+ G G G G G G G Sbjct: 80 GGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSGHSGSDHGSG 124 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP 835 PPPPPPP P P+ PPP AP PP PP Sbjct: 89 PPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPPPPP 125 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-------PLPPPAXXXXPP 859 PP P P P + PPPP AP P P P PPP PP Sbjct: 38 PPAPAEPAPPAAPPAAEPPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPP 89 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-----PPLPPPAXXXXPP 859 PPPPP PS P P AP P PP PPP PP Sbjct: 55 PPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPP 102 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PP P PP P PP Sbjct: 78 PPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPP 121 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 11/56 (19%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP------SXPPPPXXXAPXXXPXRPP-----LPPPAXXXXPP 859 PPPPP P P PPPP P PP PPPA PP Sbjct: 55 PPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPP 110 >UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triticum aestivum|Rep: Cold shock domain protein 3 - Triticum aestivum (Wheat) Length = 231 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GGGG GGG GG G GGGG GGG Sbjct: 86 GGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGGG 131 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 858 GGXXXXAGGG-RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG RGGR G G GGGG G GGGGGG Sbjct: 78 GGSRPGEGGGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGG 122 Score = 42.7 bits (96), Expect = 0.015 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG GG G G GGGGGGGR Sbjct: 93 GGYGGGGGGYGGGGGGYGGG---GGGYGGGGGGYGGGGYGGGGGGGR 136 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 858 GGXXXXAGGGRG----GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGGRG G G GGGG G G GGGGGG Sbjct: 126 GGYGGGGGGGRGCYKCGEDGHISRDCPQGGGGGGGYGGGGYGGGGGGG 173 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G R EGGG GG GG G G GGG GGGG Sbjct: 79 GSRPGEGGGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGG 120 Score = 37.9 bits (84), Expect = 0.42 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 96 GGGGGGYGGGGGGYGGG--GGGYGGGGGGYGGG---GYGGGGGGG 135 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G GGGGG G Sbjct: 93 GGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGGGGGGGRG 137 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -3 Query: 834 GGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGG--GGGGGXK 718 GG GG G G GGGG G G GG GGGGG + Sbjct: 96 GGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGGGGGGGR 136 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G +GG R G G G GGG G G GGGGGG Sbjct: 72 GGGALSGGSRPGEGGGDRGGRGGYGGGGGGYGGGGGGYGGGGGG 115 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGGG G GGGG GG Sbjct: 86 GGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYGG 130 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 824 GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GGG GG GG G G GGG GGGG Sbjct: 72 GGGALSGGSRPGEGGGDRGGRGGYGGGGGGYGGGG 106 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GGGG G Sbjct: 85 GGGDRGGRGGYGGGGGGYGGGGGGYGGGGGGYGGGGGGYGGGGYG 129 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRG----GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGR G G GGGG G GGGGGGG Sbjct: 164 GGYGGGGGGGRECYKCGEEGHISRDCPQGGGGGGYGGGGGRGGGGGGGG 212 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P P PPA Sbjct: 359 PPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPA 397 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPP+ Sbjct: 349 PPPPPPP-----PPPPPPPPPPKLNTAPKPPPPPPPPPS 382 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP 826 P PPPPP PS PP P + P PP Sbjct: 51 PSPPPPPAPDFTSDPSTPPAPDAPSGDFFPPAPP 84 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPP---SSPRXPXXPP 858 P PP PPP PPPP ++P+ P PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 >UniRef50_Q0JA80 Cluster: Os04g0612100 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os04g0612100 protein - Oryza sativa subsp. japonica (Rice) Length = 329 Score = 44.8 bits (101), Expect = 0.004 Identities = 23/45 (51%), Positives = 23/45 (51%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GE GGGG GGG GG G G GGGGGGGG Sbjct: 180 GGGGSGGEGGGGGGSSGGGGSNGGGGSSGGGG---NSGGGGGGGG 221 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 AGGG G G G GGG G G G GGGG Sbjct: 179 AGGGGSGGEGGGGGGSSGGGGSNGGGGSSGGGGNSGGGG 217 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 GG GGG GG G G GGG G G GGGGG Sbjct: 181 GGGSGGEGGGGGGSSGG--GGSNGGGGSSGGGGNSGGGGGGGG 221 >UniRef50_Q0DME4 Cluster: Os03g0813200 protein; n=4; Oryza sativa|Rep: Os03g0813200 protein - Oryza sativa subsp. japonica (Rice) Length = 478 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G G GGGG G G GGGGGGG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGG 78 Score = 42.7 bits (96), Expect = 0.015 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GGGG GGG GG G G GGGGGGG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GGG GG G G GGG GGG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGG 85 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -1 Query: 830 EGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 +GGGG GGG GG G G GGG GGGG Sbjct: 39 DGGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGG 75 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG 732 GG G G GGGG GGG GG G G GGGG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGG 86 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG GG G G G GGGG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGG 86 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGG G G GGG GG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGG 84 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 E GGG GGG GG G G GGG GGG Sbjct: 37 ESDGGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGG 74 >UniRef50_Q015H7 Cluster: Chromosome 07 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 07 contig 1, DNA sequence - Ostreococcus tauri Length = 499 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + P PP PP P PS P PP P P RPP PP A PP Sbjct: 259 YPPYPPYPPYPVAPPRPSPPSPPRPPRPPPAP-RPPRPPRAPRPPPP 304 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP---PLPPPAXXXXPP 859 PP PP P P P PP P P P RP P PPP PP Sbjct: 263 PPYPPYPVAPPRPSPPSPPRPPRPPPAPRPPRPPRAPRPPPPSPRPPP 310 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPA 841 P PP PP P P PP P P P PP PPP+ Sbjct: 278 PSPPRPPRPPPAPRPPRPPRAPRPPPPSPRPPPPPAPPPS 317 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P PP P RPP PPPA P Sbjct: 277 PPSPPRPPRPPPAPRPPRPPRAPRPPPPSPRPP-PPPAPPPSDP 319 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P P PPP P P P PPP+ PP Sbjct: 269 PVAPPRPSPPSPPRPPRPPP--APRPPRPPRAPRPPPPSPRPPPP 311 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P PP P P PP P P P RPP P P P Sbjct: 272 PPRPSPPSPPRPPRP--PPAPRPPRPPRAP-RPPPPSPRPPPPP 312 >UniRef50_Q011U7 Cluster: Myc-regulated DEAD/H box 18 RNA helicase-like; n=9; Eukaryota|Rep: Myc-regulated DEAD/H box 18 RNA helicase-like - Ostreococcus tauri Length = 2729 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 RG GGGG GGG GG G G GGG GGGGR Sbjct: 2671 RGGGGGGGGGGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGR 2711 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXG--GGGGGG 724 GG GGG GGR G G GGGG G G G G GGGG Sbjct: 2678 GGGGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRGGDRGFGGGG 2724 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GGR G G GGGG G G GGGG G Sbjct: 2683 GGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRGGDRGFGGGGRSG 2727 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G GGGG GGG GG G G GGGG GGR Sbjct: 2672 GGGGGGGGGGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGR 2714 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 833 EEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 E GGGG GGG GG G G GGG GGGGR Sbjct: 2670 ERGGGGG--GGGGGGGGGGGSGGRGGGGRGGGGRGGGGR 2706 Score = 38.7 bits (86), Expect = 0.24 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG----GGGGR 717 GG G G GGG GGG GG G G G GG GGGGR Sbjct: 2675 GGGGGGGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRGGDRGFGGGGR 2725 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG-GXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GG G GG G G GGGG G Sbjct: 2682 GGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRGGDRGFGGGGRSG 2727 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GGGG G G GGGG GG Sbjct: 2673 GGGGGGGGGGGGGGGSGGRGGGGRGGGGRGGGG----RGGGGRGG 2713 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GGG GG G Sbjct: 2672 GGGGGGGG--GGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRG 2715 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G GGG G G G GG GG + Sbjct: 2672 GGGGGGGGGGGGGGGGSGGRGGGGRGGGGRGGGGRGGGGRGGRGGDR 2718 >UniRef50_O65530 Cluster: Putative uncharacterized protein F4D11.90; n=5; cellular organisms|Rep: Putative uncharacterized protein F4D11.90 - Arabidopsis thaliana (Mouse-ear cress) Length = 731 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PS PPP P P P LP + PP Sbjct: 156 PPPPSPPRRRSGPKPSFPPPINSSPPNPSPNTPSLPETSPPPKPP 200 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P S PPP +P P P PPP PP Sbjct: 47 PPPLPSPPPLSAPTAS-PPPLPVESPPSPPIESP-PPPLLESPPP 89 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P PPPP +P P P PP P Sbjct: 63 PPPLPVESPPSPPIESPPPPLLESPPPPPLESPSPPSPHVSAP 105 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXP-XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP PPP PP Sbjct: 610 PPPPPPPGMPGMPGMPGMPPPPPPPGMPGMP--PPPPPPGMPGMPP 653 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPP P PP PPP PP Sbjct: 598 PPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPP 641 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P P P PP PPP PP Sbjct: 640 PPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP-PPPGMPGMPP 683 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP--PLPPPAXXXXPP 859 PPPPPP P PPP P P P P PPP PP Sbjct: 628 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP 673 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP PPP PP Sbjct: 628 PPPPPPPGM-----PGMPPPPP---PPGMPGMPP-PPPGMPGMPP 663 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PPPPPPP P PP P PP P PP Sbjct: 607 SSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPP 653 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +2 Query: 728 PPPPPPXXXXXPXP-------SXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P S PPPP P P +PPP Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPP 630 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P P PP PPP PP Sbjct: 652 PPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP-PPPGMPGMPP 693 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXP----PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPP P PP PPP PP Sbjct: 672 PPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPP-PPPGMPGMPP 719 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP P P PPP P P P +PPP Sbjct: 693 PPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPP 730 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PPPPPPP P P P PP P PP Sbjct: 595 SSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPP 641 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 SS PPPPPP P P PP P +P PP Sbjct: 583 SSLAPPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPP 629 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P PPPP P PP PPP Sbjct: 600 PPPPPG----ASSVPPPPPPPGMPGMPGMPGMPPPPPP 633 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P P P P PP PPP P Sbjct: 662 PPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP-PPPGMPGMP 702 >UniRef50_Q5CPV2 Cluster: Large low complexity protein with repeats; n=1; Cryptosporidium parvum Iowa II|Rep: Large low complexity protein with repeats - Cryptosporidium parvum Iowa II Length = 1146 Score = 44.8 bits (101), Expect = 0.004 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GG GG G G GGGGG GG Sbjct: 560 GGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSGGGGGSGG 605 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G G GGGGG Sbjct: 558 GGGGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSGGGGG 602 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G G GGG GG Sbjct: 554 GGGSGGGGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSGG 599 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G GA G GG G G G GGG G Sbjct: 554 GGGSGGGGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSG 598 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AGGG G G G GG G G G GGG GGG Sbjct: 556 GSGGGGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSGGG 600 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G GA G GG G G GGG GG Sbjct: 564 GGGGAGGGGGAGG--GGSGGAGGGGSGGGSGSGGGSGGGGGSGG 605 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G GGG G G GGGGG G Sbjct: 560 GGAGGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSGGGGGSG 604 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AGGG G G GA G GG G G GGGG GG Sbjct: 563 GGGGGAGGGGGAGGGGSGGAGGGGSGGGSGSGGGSG-GGGGSGG 605 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGG G G G GG G Sbjct: 569 GGGGGAGGGGSGGAGGGGSGGGSGSGGGSGGGG-----GSGGAG 607 >UniRef50_A2FA50 Cluster: Proline-rich protein MP-2-related protein; n=5; Trichomonas vaginalis G3|Rep: Proline-rich protein MP-2-related protein - Trichomonas vaginalis G3 Length = 128 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPA 841 PPPPPP P PS PPP P P + PP PPPA Sbjct: 58 PPPPPPQGYGQQPPPSYMPPPQAVPPAPQPQQQTPPPPPPA 98 >UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 560 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P PPPP P PP PPPA PP Sbjct: 441 PSPPPPVAPPPPPMAPPPPPVAPPPPGIGLPPPPPPAFGIPPP 483 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXPP 859 PPP PPPP P P PPPP P P P PPP PP Sbjct: 444 PPPVAPPPPPMAPPPPPVAPPPPGIGLPPPPPPAFGIPPPPPGVGVPPP 492 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S P PPPP P PP PP PP PP PP Sbjct: 437 NSESPSPPPPVAPPPPPMAPPPPPVAPPPPGIGLPPP-PPPAFGIPP 482 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 44.8 bits (101), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PPP P PP PPP PP Sbjct: 594 PPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPP 638 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPPPP P PPP P PP PP P PP Sbjct: 562 PPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPP 607 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPP----XXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 PPPPPPP P P PPPP P PP PP P PP Sbjct: 545 PPPPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPP 594 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP PPPP P PPLP PP Sbjct: 565 PPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPP 609 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/73 (28%), Positives = 23/73 (31%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP +K+ L PPPPPP PPPP Sbjct: 569 PPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPP 628 Query: 797 APXXXPXRPPLPP 835 P PP PP Sbjct: 629 PPPGQKGIPPPPP 641 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP + PPPP P P + +PPP Sbjct: 606 PPPPPPPPLPGQKAGAPPPPP----PPPPPGQKGIPPP 639 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P P P P P PPLP PP Sbjct: 581 PPPPPLPGQKAGPPPPPPLPGQKTGPPPPPP-PPLPGQKAGAPPP 624 Score = 34.3 bits (75), Expect = 5.1 Identities = 22/78 (28%), Positives = 22/78 (28%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPPXXXXXXXXXXXXX 896 S PPPPPPP P P PP PP LP PP Sbjct: 539 SHPPPPPPPPPPPPLPGQHKQTP----PPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPP 594 Query: 897 XXXXXXXXXXXXXPPPXP 950 PPP P Sbjct: 595 PPPPLPGQKTGPPPPPPP 612 >UniRef50_Q5KGJ5 Cluster: Putative uncharacterized protein; n=2; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 498 Score = 44.8 bits (101), Expect = 0.004 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P P+ P PP P P PP PP PP Sbjct: 100 PPAPPAPSRTAPPAPAPPAPPAPAPPAPAPPAPPAPPAPPAPAPP 144 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPP-PAXXXXPP 859 P PP PP P P PP P P PP PP P PP Sbjct: 52 PAPPAPPAPPAPPAPPAPPAPTRHVPPPARATPPAPPAPTSSRAPP 97 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P P PP AP R +PPPA P Sbjct: 252 PPAPPPPA----PAPPAPAPPAPPAPAAPAPRRMIPPPARSIPSP 292 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PP PP AP P PP PP PP Sbjct: 34 PPPPAPSGPPSRTAPPAPPAPPAPPAP-PAPPAPPAPPAPTRHVPP 78 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PS AP P P PPA PP Sbjct: 331 PPPPPSAPPPPPPGPSPASRAAPPAPARAPPAPARAPPAPARAPP 375 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PPAXXXXPP 859 PP PP P PPPP P P PP P P PP Sbjct: 239 PPTPPRRPSSVSAPPAPPPPAPAPPAPAPPAPPAPAAPAPRRMIPP 284 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PP P PP P P P PP A PPLP Sbjct: 124 PPAPAPPAPPAPPAPPAPAPPARNAVHRKEPAPPLP 159 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP 823 PPPPP P PPPP P P RP Sbjct: 181 PPPPPRPSSMTGGRAPPPPPPRPTGPPTLPSRP 213 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPP---PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP---PPAXXXXPP 859 PPP P P P PS PPPP PP P PPA PP Sbjct: 318 PPPLPAGRPASRLPPPPPSAPPPPPPGPSPASRAAPPAPARAPPAPARAPP 368 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAP--XXXPXRPPLPP-PAXXXXPP 859 PP P PS PPPP P P PP PP P PP Sbjct: 19 PPSVPSPRAPSKPSAPPPPAPSGPPSRTAPPAPPAPPAPPAPPAPP 64 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXP--XPSXPPPPXXXA-PXXXPXRPPLP-PPAXXXXPP 859 PP PP P P P PP P A P P PP P PPA P Sbjct: 84 PPAPPAPTSSRAPPRVPPAPPAPSRTAPPAPAPPAPPAPAPPAPAPPAP 132 >UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 477 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXR--PPLPPPA 841 PPPPP P PS PPPP AP P R PP PPPA Sbjct: 265 PPPPPSSASPPPPPSAPPPPPAVAAPRPPPSRSNPPPPPPA 305 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P + PPPP P P PPP+ PP Sbjct: 259 PPPPTAPPPPPSSASPPPPPSAPPPPPAVAAPRPPPSRSNPPP 301 >UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=74; cellular organisms|Rep: Glycine-rich RNA-binding protein 8 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 +GGG GGR G G GGGG G G GGGGGG Sbjct: 87 SGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G GGGG GGG GG G GGGGGGR Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGR 141 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG GG G GGGG G G GGG GG Sbjct: 112 GGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGG 156 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 839 RGEEGGGGXX--XGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 RG GGGG GGG GG G G GGGGGG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG GG G G GGG GGG Sbjct: 112 GGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGG 157 Score = 36.3 bits (80), Expect = 1.3 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGG-GGXXXGGGXXXXGGXXXXGXGXXXXXGG--GGGGGG 720 GG G GG G GGG GG G G GG GGGGGG Sbjct: 120 GGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 34.7 bits (76), Expect = 3.9 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGG---GGGGR 717 GG G G GGGG GGG GG G GGGG GGGGR Sbjct: 104 GGGGGYSG--GGGGGYSGGGG---GGYERRSGGYGSGGGGGGRGYGGGGR 148 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG +GGG GG G G GG G G GGGG Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GG GG G G GGGG GGGGGG Sbjct: 96 GSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 140 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXG------XXXXXGGGGGGGXK 718 GG G G G R G G GGGG G G G GGGGG + Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGR 141 >UniRef50_Q99069 Cluster: Glycine-rich RNA-binding protein 1; n=4; Eukaryota|Rep: Glycine-rich RNA-binding protein 1 - Sorghum bicolor (Sorghum) (Sorghum vulgare) Length = 142 Score = 44.8 bits (101), Expect = 0.004 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GG G GGG GG G G GGG GGGG Sbjct: 75 GGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGG 120 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G +GGGG GGG GG G G GGG GGG R Sbjct: 82 GGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGGYGGGSR 128 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGG-GGGR 717 G GGGG GGG GG G GGGGG GGGR Sbjct: 68 GRGGGGGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGR 108 Score = 39.5 bits (88), Expect = 0.14 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXG----XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G GGGG G G GGG GGG Sbjct: 71 GGGGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGG 119 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGGG GGG GG G G G GGGG Sbjct: 88 GRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGGYGGGSRGGGG 132 Score = 37.1 bits (82), Expect = 0.73 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GGGG G Sbjct: 94 GGGYGGGGGGYGGGRGGYGGGGYGGGGGGYGGG---SRGGGGYG 134 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXG-AXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GG GG G Sbjct: 67 GGRGGGGGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYG 112 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGG---RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GGGG Sbjct: 85 GGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGGYGGGSRGGGG 132 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGG-XXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GG GG GG Sbjct: 67 GGRGGGGGGGYGGGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGG 113 Score = 34.3 bits (75), Expect = 5.1 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = -3 Query: 858 GGXXXXAGGGR--GGRXGXXXGAXXXGGG-GXXGXGXXXXXGGGGGGGXK 718 GG G GR GG G G GGG G G G GGG GGG + Sbjct: 79 GGRGGGGGYGRRDGGGGGYGGGGGGYGGGRGGYGGGGYGGGGGGYGGGSR 128 >UniRef50_P23093 Cluster: Circumsporozoite protein precursor; n=3; Plasmodium berghei|Rep: Circumsporozoite protein precursor - Plasmodium berghei (strain Anka) Length = 347 Score = 44.8 bits (101), Expect = 0.004 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P+ PPPP P P P PPP PP Sbjct: 92 PPPPPNPNDPPPPNPNDPPPPNPNDP--PPPNPNDPPPPNPNDPP 134 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P+ PPPP P P PP A PP Sbjct: 117 PPPPNPNDPPPPNPNDPPPPNANDPPPPNANDPAPPNANDPAPP 160 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P+ PPPP P P P PPP PP Sbjct: 101 PPPPNPNDPPPPNPNDPPPPNPNDP--PPPNPNDPPPPNANDPP 142 Score = 41.9 bits (94), Expect = 0.026 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P+ PPPP P P PP A PP Sbjct: 109 PPPPNPNDPPPPNPNDPPPPNPNDPPPPNANDPPPPNANDPAPP 152 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P + PPPP P P PP A PP Sbjct: 125 PPPPNPNDPPPPNANDPPPPNANDPAPPNANDPAPPNANDPAPP 168 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX--PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P P+ P PP P P PP A PP Sbjct: 130 PNDPPPPNANDPPPPNANDPAPPNANDPAPPNANDPAPPNANDPPPP 176 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PPPPPP P P+ PPPP P RPP PPP P Sbjct: 848 PPPPPPTRPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVAP 894 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP----PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P+ PPP P P P RPP PP PP Sbjct: 477 PPPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPP 524 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P+ PP PP P P RPP PPP PP Sbjct: 824 PPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPPPP 868 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PP P PPPP P P RPP PPP Sbjct: 833 PPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPPPPP 869 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX--PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PP P P RPP PPP PP Sbjct: 611 PPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPP 657 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXA---PXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP + P P RPP PP PP Sbjct: 653 PPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPP 702 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX--PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PP P P RPP PPP PP Sbjct: 814 PPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPP 860 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP PP P PP P P RPP PPP PP Sbjct: 488 PPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPP 532 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PP PPP P P P PPP P P +PP+ PPP PP Sbjct: 731 PPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTRPP 779 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +2 Query: 719 FXPPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 + PP PP PP P P PP P P RPP PPP Sbjct: 742 YLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPP 783 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPP-PPXXXAPXXXPXRPPLPPP 838 PPPP P P P + PP PP P P RPP PPP Sbjct: 494 PPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 533 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXP-XPSXPP-PPXXXAPXXXPXRPPLPPP 838 PPPP P P P+ PP PP P P RPP PPP Sbjct: 558 PPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 597 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPP------PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP PP P PP P P RPP PPP PP Sbjct: 546 PPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPP 596 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPP-PPXXXAPXXXPXRPPLPPP 838 PPPP P P P + PP PP P P RPP PPP Sbjct: 672 PPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPPP 711 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PP P P PP PP PP Sbjct: 520 PPPPPP--TRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPP 561 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P P RPP PP PP Sbjct: 610 PPPPPTR---PPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPP 649 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPP 838 PPP P P+ PP PP P P RPP PPP Sbjct: 621 PPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP 658 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPP--PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P PPPP P P RPP+ PP Sbjct: 752 PPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 798 Score = 38.7 bits (86), Expect = 0.24 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P RPP PP PP Sbjct: 778 PPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 825 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P P RPP PP PP Sbjct: 813 PPPPPTR---PPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPP 852 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPP 838 PPPPPP P P+ PP P P RPP PP Sbjct: 584 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 622 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPP 838 PPPPPP P P+ PP P P RPP PP Sbjct: 698 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 736 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P P RPP PP PP Sbjct: 724 PPPPPTR---PPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPP 763 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PPPP P P RPP+ PP Sbjct: 505 PPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 548 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLP----PPAXXXXPP 859 PPPPPP P + PPPP P P P P PPA PP Sbjct: 528 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPP 577 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PPPP P P RPP+ PP Sbjct: 569 PPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 612 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PPPP P P RPP+ PP Sbjct: 630 PPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 673 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PP P P RPP PPP PP Sbjct: 671 PPPPPTR---PSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPP 710 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P PPPP P P RPP+ PP Sbjct: 683 PPAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 726 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 8/52 (15%) Frame = +2 Query: 728 PPPPPPXXXXXPXPS-XPPPPXXXAPXXXPXRPPL-------PPPAXXXXPP 859 PP PP P P+ PPPP P P RPP+ PPP PP Sbjct: 840 PPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPP 891 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PP PP P P+ PPPP P RPP PP PP Sbjct: 512 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 558 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PP PP P P+ PPPP P RPP PP PP Sbjct: 576 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 622 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRP----PLPPPAXXXXPP 859 PPPPPP P + PPPP P P +P P PP PP Sbjct: 592 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPP 641 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXP---XRPPLPPPAXXXXPP 859 PP PP P P+ PPPP P RPP PP PP Sbjct: 690 PPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPP 736 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P+ PP P P RPP+ PP Sbjct: 770 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPP 815 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP---PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P+ PP P P P PP+ P P Sbjct: 856 PPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPPP 901 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P PPA PP Sbjct: 706 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPP 752 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX--PPPPX---XXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS PP P P P RPP PP PP Sbjct: 725 PPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPP 774 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPP 835 PPPPPP P + PPPP P P P PP Sbjct: 864 PPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPPP 901 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P P PP PP PPPP R P PP Sbjct: 751 PPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPP 783 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPPPP P + PPPP P P +P PPA PP Sbjct: 796 PPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPP 841 Score = 34.7 bits (76), Expect = 3.9 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 11/58 (18%) Frame = +2 Query: 719 FXPPP---PPPPXXXXXPXPSXP--------PPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F PPP PP P PS P PPP P P P PPP PP Sbjct: 175 FLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPP 232 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAP--XXXPXRPPLPPP 838 PP PP P P+ PPPP P P P PPP Sbjct: 762 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 800 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PP P P PP PP Sbjct: 770 PPPPPP---TRPPPPPPTRPPVTQTPYTRPPPPPTRPP 804 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP--PXXXAPXXXP--XRPPLPPPAXXXXPP 859 PP PP P P+ PPP P P P +PP P P PP Sbjct: 165 PPSPPQTTRTFLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPP 213 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPP--PPPPXXXXXPXP----SXPPPPXXXAPXXXPXRP-PLPPPAXXXXPP 859 PPP PPPP P + PPPP P P +P PPA PP Sbjct: 587 PPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPP 638 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-----PPAXXXXPP 859 PPPPPP P P PP P P PP PPA PP Sbjct: 645 PPPPPP--TRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPP 691 >UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 252 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 A GG GG G G GGGG G G GGGGGGG Sbjct: 183 AAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 G AGGG GG G G GGGG G G GGG GG Sbjct: 181 GAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 224 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 839 RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 RG GG GGG GG G G GGGGGGGG Sbjct: 180 RGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GGGG GGG GG G G GGGGGG G Sbjct: 185 GGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSG 223 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G GGGG GGG GG G G GGGGG GG Sbjct: 186 GAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGG 224 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GG GG Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGGSGG 236 Score = 41.1 bits (92), Expect = 0.045 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG GG G G GGGG G G G GG G + + Sbjct: 191 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGGSGGEDR 239 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG GG G G GGGG GG Sbjct: 185 GGAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-----GGGGSGG 224 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GG Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGG 233 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG R R G G GGGG G G GGGGGGG Sbjct: 166 GGRLERRQRRRRRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGG 210 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GG Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGG 233 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXG----XGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GG GG Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGSGGSSSSSGSGGSGG 236 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 Query: 828 RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 R R GA GGGG G G GGGGGGG Sbjct: 177 RRRRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGG 211 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 828 RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 R G G GGGG G G GGGGGGG Sbjct: 179 RRGAAAGGAGGGGGGGGGGGGGGGGGGGGGGGGGG 213 >UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA.; n=1; Bos taurus|Rep: PREDICTED: Bos taurus similar to Formin homology 2 domain containing 1 (LOC787862), mRNA. - Bos Taurus Length = 1125 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P PPPP P PP PPPA Sbjct: 531 PPPPPPPPLLSGSLPPPPPPPPPPLKSPFPPTPP-PPPA 568 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P+ PPPP P P P LP Sbjct: 547 PPPPPPPPLKSPFPPTPPPPPAAPLPHSAPDGPALP 582 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP PPPP P P P PPP P Sbjct: 531 PPPPPPPPLLSGSLPPPPPPPPPPLKSPFPPTPPPPPAAPLP 572 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P PPPP P PP PPP+ PP Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPP 209 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P PPPP P PP PPP Sbjct: 181 PPPPPGPPPAPGPPPPPPP---PPPSGGGAPPAPPP 213 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPPS P PP Sbjct: 182 PPPPGPPPAPGPPPPPPPPPPSGGGAPPAPP 212 Score = 33.9 bits (74), Expect = 6.8 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP 787 PPPPPPP P PPPP Sbjct: 194 PPPPPPPPPSGGGAPPAPPPP 214 >UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae|Rep: Blr0521 protein - Bradyrhizobium japonicum Length = 745 Score = 44.4 bits (100), Expect = 0.005 Identities = 24/80 (30%), Positives = 28/80 (35%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP + + + P PPPP P P+ P PP Sbjct: 98 PPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAA 157 Query: 797 APXXXPXRPPLPPPAXXXXP 856 AP P PP PPPA P Sbjct: 158 APQHAP--PPPPPPAARPTP 175 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P AP P PP PA P Sbjct: 109 PPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAP 153 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPP--PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP PP PP P P+ PPPP PP PPPA P Sbjct: 76 PPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQP 121 Score = 40.3 bits (90), Expect = 0.078 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPP---LPPPAXXXXPP 859 PPPPPPP P P PPP A P P P PPPA P Sbjct: 163 PPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARP 211 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL------PPPAXXXXPP 859 PPPPPPP P P PPP P P P PPPA P Sbjct: 96 PPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARP 146 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP P P PPP P PP PPPA PP Sbjct: 67 PAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPP 109 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPP P P PPPP AP + P PPPA Sbjct: 95 PPPPPPPPAARPAP-PPPPPPPAAP-----KQPSPPPA 126 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P+ PPPP A P PP P P Sbjct: 95 PPPPPPP---PAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTP 136 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P+ P P P RP P PA P Sbjct: 177 PPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAP 222 Score = 35.9 bits (79), Expect = 1.7 Identities = 22/80 (27%), Positives = 23/80 (28%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP K+ A P PP PP PPPP Sbjct: 112 PPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAA 171 Query: 797 APXXXPXRPPLPPPAXXXXP 856 P P PP PA P Sbjct: 172 RPTPTPPPPPPAGPAARPTP 191 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PPPP P PP P A P Sbjct: 150 PPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAP 193 >UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1; Pseudomonas entomophila L48|Rep: Insecticidal toxin, SepC/Tcc class - Pseudomonas entomophila (strain L48) Length = 990 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPPP P P LPPP PP Sbjct: 702 PPPPPPSGMRLPPP--PPPPGMGTPPPPPPGMGLPPPPPGLRPP 743 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPX-RPPLPPP 838 PPPPPPP P PPPP P P RPP P P Sbjct: 713 PPPPPPPGMGTPP----PPPPGMGLPPPPPGLRPPPPGP 747 >UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=1; Plesiocystis pacifica SIR-1|Rep: Single-stranded DNA-binding protein - Plesiocystis pacifica SIR-1 Length = 198 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGG GGG Sbjct: 128 GGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGGNSGGG 173 Score = 43.6 bits (98), Expect = 0.008 Identities = 22/46 (47%), Positives = 23/46 (50%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G +GGGG GGG GG G G GGGG GGG Sbjct: 117 GGRGGGGGYDGGGG---GGGYGGGGGGGGYGGGGGSSYGGGGSGGG 159 Score = 43.2 bits (97), Expect = 0.011 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGG GGGG Sbjct: 120 GGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGG 165 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G +GGGG GGG GG G G GG GGGGG Sbjct: 110 GRDGGGGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGGGG 148 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GG GGG GG G G GGGGGGG Sbjct: 123 GGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGG 168 Score = 41.1 bits (92), Expect = 0.045 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GGG GGG Sbjct: 120 GGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGG 164 Score = 40.7 bits (91), Expect = 0.059 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGG--GGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GG GG GG GG G G GGG GGGG Sbjct: 113 GGGGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGG 160 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G GG GGGG Sbjct: 121 GGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGG 165 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GG GGGG Sbjct: 129 GGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGGNSGGGG 174 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG------GGGXXGXGXXXXXGGGGGGG 724 GG GGGRGG G G G GGG G G GGG GGG Sbjct: 109 GGRDGGGGGGRGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGG 159 Score = 39.5 bits (88), Expect = 0.14 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G+ GGGG G G GGG GG Sbjct: 129 GGGGGYGGGGGGGGYGGGGGSSY-GGGGSGGGGYGGGGGGGNSGG 172 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 821 GGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG GGG GG G G GGGGGGGG Sbjct: 109 GGRDGGGGGGRGGGGGYDGGGGGGGYGGGGGGGG 142 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GG GGGG Sbjct: 116 GGGRGGGGGYDGGGGGGGYGGGGGGGGYGGGGGSSYGGGGSGGGG 160 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 858 GGXXXX--AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG 733 GG GGG GG G G GGGG G G GGGG Sbjct: 131 GGGYGGGGGGGGYGGGGGSSYGGGGSGGGGYGGGGGGGNSGGGG 174 >UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein; n=1; Streptomyces ambofaciens ATCC 23877|Rep: Putative secreted proline-rich protein - Streptomyces ambofaciens ATCC 23877 Length = 193 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P P P P P PPPP AP P +PP P P P Sbjct: 73 PTPTPTPTPTPTPPPPKPPPPPPPAPEPPPRKPPAPKPEAPPAP 116 Score = 41.5 bits (93), Expect = 0.034 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P PPP P P P PP P P PP P P P Sbjct: 81 PTPTPPPPKPPPPPPPAPEPPPRKPPAPKPEAPPAPTPTPTPSP 124 Score = 39.5 bits (88), Expect = 0.14 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P P+ PPP P P PP PPA P Sbjct: 69 PTPTPTPTPTPTPTPTPPPPKPPPPPPPAPEPPPRKPPAPKPEAP 113 Score = 39.1 bits (87), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPA 841 P PPPPP P P PP P AP P P P PA Sbjct: 88 PKPPPPPPPAPEPPPRKPPAPKPEAPPAPTPTPTPSPTPA 127 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P AP P P P PA P Sbjct: 91 PPPPPPAPEPPPRKPPAPKPEAPPAPTPTPTPSPTPAPARPAAP 134 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = +2 Query: 725 PPPP---PPPXXXXXPXPSXPPPPXXX---APXXXPXRPPLPPPAXXXXP 856 PPPP PPP P P PP P +P P RP P PA P Sbjct: 93 PPPPAPEPPPRKPPAPKPEAPPAPTPTPTPSPTPAPARPAAPAPAPSATP 142 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P P P P P+ P P P P PP P P P Sbjct: 63 PCPEPTPTPTPTPTPTPTPTPTPPPPKPPPPPPPAPEPPPRKPP 106 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P P P P P P+ P P P P P PPP P Sbjct: 65 PEPTPTPTPTPTPTPTPTPTPPPPKPPPPPPPAPEPPPRKPPAP 108 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P PP PPP Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 44.4 bits (100), Expect = 0.005 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP P PP PPP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 44.0 bits (99), Expect = 0.006 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 1/92 (1%) Frame = +2 Query: 587 GXATLFXXXXPPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXP-PPPPPPXXXXXP 763 G F PPPP A S L P PPPPPP P Sbjct: 556 GNKPAFSPPPPPPPPPPPPLPQSNYAS--SQPPPPPPPPPLPNCLVPSPPPPPPPPPILP 613 Query: 764 XPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 S PPPP P P LPPP PP Sbjct: 614 NRSVPPPP--PPPPPLPNHSVLPPPPPPPPPP 643 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +2 Query: 725 PPPPPPP---XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPP+ Sbjct: 603 PPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPS 644 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP------XRPPLPPP 838 PPPPPPP P S PPPP P P +PP PPP Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P PPPP P P R PPPA Sbjct: 620 PPPPPPPLPNHSVLPPPPPPP---PPPSLPNRLVPPPPA 655 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P P P P P PPPP P P PP PPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPP 571 Score = 38.7 bits (86), Expect = 0.24 Identities = 23/81 (28%), Positives = 24/81 (29%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPPXXXXXPXPSXPPPPXXX 796 PPPP G A PPPPP P P PPP Sbjct: 714 PPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPK 773 Query: 797 APXXXPXRPPLPPPAXXXXPP 859 P P PPL + PP Sbjct: 774 PPGTVPPPPPLHGASGRPHPP 794 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 9/47 (19%) Frame = +2 Query: 725 PPPPPP---------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P P PPPP + PPLPPP Sbjct: 691 PPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPP 737 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXR-PPLPPP 838 PPPPPPP PS P PP P R PP PPP Sbjct: 713 PPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPP 752 Score = 37.9 bits (84), Expect = 0.42 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPPP P+ PPP P P PPLP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPP----PPPPPPPPPLP 576 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA-----PXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PPPP P P PP P PP Sbjct: 604 PPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPP 653 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPPP P PPPP P PP P Sbjct: 621 PPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPPPPP PP P PP PP P Sbjct: 601 SPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLP 646 >UniRef50_Q6QNA3 Cluster: Proline-rich protein 1; n=2; Solanaceae|Rep: Proline-rich protein 1 - Capsicum annuum (Bell pepper) Length = 260 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P+ PP PP P P +PP PPA PP Sbjct: 65 PTPPPAKSPSPPPAKPPTPPPAKPPSPPPSKPPTKPPAKSPSPP 108 Score = 42.3 bits (95), Expect = 0.019 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 737 PPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P P PP +P P +PP PPPA PP Sbjct: 51 PPPKNSPAPSPIDTPTPPPAKSPSPPPAKPPTPPPAKPPSPP 92 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPP P P+ PP PP P P + P PPPA P Sbjct: 73 PSPPPAKPPTPPPAKPPSPPPSKPPTKPPAKSPSPPPAKPPTKP 116 Score = 40.3 bits (90), Expect = 0.078 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP-PXXXAPXXXPXRPPLPPP 838 PP PPP P PS PP P +P P +PP PP Sbjct: 80 PPTPPPAKPPSPPPSKPPTKPPAKSPSPPPAKPPTKPP 117 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P+ P PP P P +PP PPP+ P Sbjct: 57 PAPSPIDTPTPPPAKSPSPPPAKPPTPPPAKPPSPPPSKPPTKP 100 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P + P P P P + P PPPA PP Sbjct: 39 PAQAPKPHKGHHPPPKNSPAPSPIDTPTPPPAKSPSPPPAKPPTPP 84 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPP P P PP P P +PP P P Sbjct: 88 PPSPPPSKPPTKPPAKSPSPP----PAKPPTKPPTPSP 121 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P P + PPPA Sbjct: 353 PPPPPPP---PPPPPPPPPPPPRPPPPPPPIKKGAPPPA 388 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PP A Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAP--PPAPPKA 392 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP PPPP P P PP PPP PP Sbjct: 353 PPPPPP----------PPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 37.9 bits (84), Expect = 0.42 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP PR P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPP 378 >UniRef50_Q69QS1 Cluster: Putative uncharacterized protein P0463D04.12; n=3; Oryza sativa|Rep: Putative uncharacterized protein P0463D04.12 - Oryza sativa subsp. japonica (Rice) Length = 144 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GGGG GGG GG G G GGGGGGG Sbjct: 103 GGHGGHGGGGCGGGGGGGGGGGCCGGGGGCGGGGGGGGGGG 143 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 103 GGHGGHGGGGCGGGGGGGGGGGCCGGGGGCGGG----GGGGGGGG 143 >UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Oryza sativa|Rep: Putative glycine-rich protein - Oryza sativa subsp. japonica (Rice) Length = 174 Score = 44.4 bits (100), Expect = 0.005 Identities = 21/47 (44%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GGG G G GGGGGGGG+ Sbjct: 33 GGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGK 79 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGG--XXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GG GGGGG Sbjct: 27 GGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGG 74 Score = 42.3 bits (95), Expect = 0.019 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G +G GG G GGG G G G GGGGGGGG Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGG 99 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/49 (44%), Positives = 23/49 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 G GGG GG G GA GG G G G GGGGGGG K + Sbjct: 34 GASGGGGGGGGGGGGGGGGGAGGKGGKGGAG-GHGGAGGGGGGGGGKGR 81 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/47 (40%), Positives = 21/47 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G +G +GG G G G GG G GG GG GGR Sbjct: 73 GGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGR 119 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGRGGR G G GGGG G G GG GG Sbjct: 19 GGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGG 62 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG G G G GGGGGG Sbjct: 30 GGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGG 75 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +G +GG G G G GG G GG GGGGG Sbjct: 51 GGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGG 96 Score = 41.5 bits (93), Expect = 0.034 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G G GG GGG G G GGGGGGGG+ Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGK 101 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G RG GG G GGG GG G G GG GG GG Sbjct: 20 GRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGG 65 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G RG GG GGG GG G G GG GG GG Sbjct: 24 GGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGG 68 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -3 Query: 834 GGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGRGGR G GA GGGG G G G GG GG Sbjct: 24 GGRGGRGGRG-GASGGGGGGGGGGGGGGGGGAGGKGG 59 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G+ G GG GG GG G G GGGGGG Sbjct: 52 GGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGG 97 Score = 39.9 bits (89), Expect = 0.10 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 857 GGXXGXRGEEG-GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G G GGG GGG GG G G GGGGGG GR Sbjct: 58 GGKGGAGGHGGAGGGGGGGGGKGRKGGAG--GHGGAGGGGGGGGGKGR 103 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G GR G G GGGG G G G GG GG Sbjct: 67 GGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGG 112 Score = 39.1 bits (87), Expect = 0.18 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG GG GG G G GGGGGG GR Sbjct: 40 GGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGG-----GGGGGGKGR 81 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G +G GG G GGG G G G GG GG GG Sbjct: 76 GGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGG 121 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXX-GAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG+GG+ G G GGGG G G GG GG G Sbjct: 47 GGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAG 92 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G +GG G G G GG G G GG GG GG Sbjct: 48 GGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGG 93 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXG-----XGXXXXXGGGGGGGXKXK 712 GG GG+GG G GGGG G G GGGGGGG K + Sbjct: 50 GGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGR 103 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G+ GG G GG GG G G GGGGGGG Sbjct: 13 GEPGQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGG 53 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGR--XGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG+ G G GGGG G G G GG GG Sbjct: 44 GGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGG 90 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G GR G G GA GGGG G G GG GG G Sbjct: 71 GGGGGGGGKGRKGGAGGHGGAGG-GGGGGGGKGRKGGRGGDGGSG 114 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 G G G GGGG GG G G G GG GG GG+ Sbjct: 83 GGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQ 128 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G G G G G G GG GG GG Sbjct: 45 GGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGG 90 Score = 35.9 bits (79), Expect = 1.7 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 G AGGG GG G G GG G G GG GG G + Sbjct: 86 GGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGR 131 Score = 35.5 bits (78), Expect = 2.2 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -3 Query: 858 GGXXXXAG-GGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG G GG GG G G G G G GGGGGGG K Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRK 104 Score = 35.1 bits (77), Expect = 2.9 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG G GR G G GG GG G G GG GG G Sbjct: 89 GGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDG 135 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG G +GGR G G GG G G GG GGG Sbjct: 94 GGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGGG 137 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GGG GG G G GG G G GGGGG G K Sbjct: 41 GGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGG-----GGGGGKGRK 82 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXX--GGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGGG G G G G G GG GG GGR Sbjct: 83 GGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGR 131 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G RG G GG GG GG G G GGGG GG Sbjct: 16 GQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGG---GGGGAGG 56 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXG-GGGGGGG 720 GG G G G GG GG GG G G G GG GG G Sbjct: 46 GGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAG 92 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 857 GGXXGXRGEEGG-GGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGG 726 GG G +G +GG GG GG GG G G GG GGG Sbjct: 95 GGGGGGKGRKGGRGGDGGSGGAGGRGGDG--GSGGQGGRGGDGGG 137 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GG G G G G GG GG Sbjct: 75 GGGGKGRKGGAGGHGGAGGGGGGGGGKGRKG-GRGGDGGSGGAGG 118 >UniRef50_Q00S27 Cluster: Chromosome 19 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 19 contig 1, DNA sequence - Ostreococcus tauri Length = 1757 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPP PPP P PS PP P P P PP PPP+ Sbjct: 308 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPP--PPSPPPS 344 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPP 838 P PP PP P PS PP PP P P PP PPP Sbjct: 300 PSPPAPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 338 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP PPP P PS PP P P P PP P P Sbjct: 305 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSP 341 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP P P P PP P P PP PPP+ P Sbjct: 298 PAPSPPAPPSPPPSPP-PSPPPSPPPSPPPSPPPSPPPSPPPPSP 341 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +2 Query: 740 PPXXXXXPXPSXPP-PPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P PP PP P P PP PPP+ PP Sbjct: 293 PALAAPAPSPPAPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 333 >UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliophyta|Rep: Cell wall protein like - Arabidopsis thaliana (Mouse-ear cress) Length = 428 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP P +PP PPP PP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPP-PPPVVTPPPP 156 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSX-PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P+ PPPP P P P PPP PP Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPP 132 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P P P PPPP P PP P P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPP P P PPP PP Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPP 139 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P+ PPP P P PPP PP Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPP P PPPP P +PP PPP PP Sbjct: 74 PCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPP-PPPYVKPPPP 116 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPP----PPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PPP P PPPP P P P PPP PP Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP-PPPPYVKPPP 115 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPX--RPPLPPPAXXXXPP 859 PPPP P P PPPP P P P PPP PP Sbjct: 130 PPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 8/53 (15%) Frame = +2 Query: 725 PPPP----PPPXXXXXPXP---SXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PPPP PPP P P PPPP P P P PPP PP Sbjct: 122 PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 7/45 (15%) Frame = +2 Query: 725 PPP----PPPPXXXXXPXP--SXPPP-PXXXAPXXXPXRPPLPPP 838 PPP PPPP P P + PPP P AP P P PPP Sbjct: 131 PPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPL--PPPAXXXXPP 859 PP P P P+ PP P P +PP PPP PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPP 77 >UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 352 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P PPPP AP P R P PPP PP Sbjct: 264 PPRPPAPQVPPPPPQAPPPPPPNAPMGMPPRIP-PPPVGGTQPP 306 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP +PP PPP PP Sbjct: 280 PPPPPPNAPMGMPPRIPPPPVGGT------QPPPPPPPLANGPP 317 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA-PXXXPXRPPLPPP 838 PPPPPPP P PPP A P PP PP Sbjct: 305 PPPPPPPLANGPPRSIPPPPMTGGAMANFTPGAPPPRPP 343 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PP--PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP--PPAXXXXPP 859 PP PPPPP P PPP P PPL PP PP Sbjct: 276 PPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPPP 324 >UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG05197; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05197 - Caenorhabditis briggsae Length = 219 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPPP P PP P P PP Sbjct: 137 PPPPPPPQRRPPPPPHHRPPPPPGYRPPPPSYYPPPPLPVIVGPPP 182 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +3 Query: 717 SSXPPPPPPP---XXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPP P PP PP PP LP PP Sbjct: 133 SKNQPPPPPPPQRRPPPPPHHRPPPPPGYRPPPPSYYPPPPLPVIVGPPP 182 >UniRef50_Q4CNE1 Cluster: Putative uncharacterized protein; n=4; Eukaryota|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 311 Score = 44.4 bits (100), Expect = 0.005 Identities = 23/47 (48%), Positives = 24/47 (51%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G +G GG GGG GG G G GGGGGGGGR Sbjct: 244 GGGGGRGGFDGDGGGGGGGGRGGFGG----GGGRGGFDGGGGGGGGR 286 Score = 41.9 bits (94), Expect = 0.026 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GGGG GGG G G G GGGGG GG Sbjct: 180 GGRGGNRGG-GGGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGG 224 Score = 41.9 bits (94), Expect = 0.026 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGGRGG G G G GG G G GGGGGG Sbjct: 240 GRGGGGGGGRGGFDGDGGGGGGGGRGGFGGGGGRGGFDGGGGGG 283 Score = 41.5 bits (93), Expect = 0.034 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGG----XXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G G GG GGG GG G G GGGGGGGGR Sbjct: 214 GGFGGGGGRGGFGGGDGGGGGERFHRGRGGGGGGGRGGFDGDGGGGGGGGR 264 Score = 41.1 bits (92), Expect = 0.045 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG-----GXXXXGGXXXXGXGXXXXXG-GGGGGGGR 717 GG RG+ GGGG GG G GG G G G GGGGGGGR Sbjct: 197 GGNRNNRGDGGGGGGGRGGFGGGGGRGGFGGGDGGGGGERFHRGRGGGGGGGR 249 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GGGG G GGGGGGG Sbjct: 219 GGGRGGFGGGDGGGGGERFHRGRGGGGGGGRGGFDGDGGGGGGGG 263 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG G G GGGG GG Sbjct: 180 GGRGGNRGGGGGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGG 224 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGGRGG G G GGG G G G GGGGG Sbjct: 204 GDGGGGGGGRGG-FGGGGGRGGFGGGDGGGGGERFHRGRGGGGG 246 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G GE G GGG G G G GG GGGGGR Sbjct: 227 GGDGGGGGERFHRGRGGGGGGGRGGFDGDGGGGGGGGRGGFGGGGGR 273 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GRGG G G GGG G G GGGG GG Sbjct: 231 GGGGERFHRGRGGGGGGGRGGFDGDGGGGGGGGRGGFGGGGGRGG 275 Score = 37.1 bits (82), Expect = 0.73 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGG------GGGGGG 720 GG RG GGGG GG GG G G GG GGGGGG Sbjct: 233 GGERFHRGRGGGGGGGRGGFDGDGGGGGGGGRGGFGGGGGRGGFDGGGGGGG 284 Score = 35.9 bits (79), Expect = 1.7 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -3 Query: 855 GXXXXAGGG-RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AG G RGGR G G GGG G G G GGGGG Sbjct: 169 GINSPAGSGKRGGRGGNRGGG---GGGNRGGGGNRNNRGDGGGGG 210 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 836 GEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXG-GGGGGGGR 717 G+ GG G GGG GG G G G GGGGGGGR Sbjct: 177 GKRGGRGGNRGGG----GGGNRGGGGNRNNRGDGGGGGGGR 213 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG G GG G G G GGG GGGG Sbjct: 188 GGGGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGGFGGGDGGGG 233 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG G R G GG GG G G GGG GGG Sbjct: 188 GGGGGNRGGG-GNRNNRGDGGGGGGGRGGFGGGGGRGGFGGGDGGG 232 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G GG G G GG GGGG Sbjct: 189 GGGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGGFGGGDGGGG 233 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXK 718 GG GG R R G GG G G G GGGGG + Sbjct: 190 GGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGGFGGGDGGGGGER 236 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGG-RXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 G GGGRGG G G GGGG G G G GG G + + Sbjct: 254 GDGGGGGGGGRGGFGGGGGRGGFDGGGGGGGGRGGFRGRGNGGRIGGESR 303 Score = 33.5 bits (73), Expect = 8.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 858 GGXXXXAGGGR--GGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G GGGG G G GG GGG Sbjct: 183 GGNRGGGGGGNRGGGGNRNNRGDGGGGGGGRGGFGGGGGRGGFGGG 228 >UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=2; Caenorhabditis|Rep: Ground-like (Grd related) protein 4 - Caenorhabditis elegans Length = 210 Score = 44.4 bits (100), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P P PPP P P P PPP PP Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPP 72 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P PPP P P PP PPP PP Sbjct: 31 PPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPP 76 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPP P P P PPPP P P PP PPP P Sbjct: 46 PPPPICPPQFCPPPPMCPPPPPPPPP---PMCPPPPPPMPSYSP 86 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = +2 Query: 725 PPPPP---PPXXXXXPXPSXPP----PPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP PP P P PP PP P P PP+ PP P Sbjct: 32 PPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPPMP 82 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +3 Query: 717 SSXPPP-PPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPP PPPP P PP PP PP PP PP Sbjct: 24 SMGPPPCPPPPPPMCAPPPLPCPPPPICPP-QFCPPPPMCPPPPPPPP 70 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 F PPPP P P P PPP P P + P P Sbjct: 55 FCPPPPMCPPPPPPPPPPMCPPPPPPMPSYSPCQSYAPAP 94 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 44.4 bits (100), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPP--XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P PPPP P PP PPP P Sbjct: 292 PPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPPANLPP 337 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPPP A PP PPP PP Sbjct: 293 PPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPPANLPP 337 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPA 841 PPPPP P P PPP AP P PP PPPA Sbjct: 281 PPPPPSDGSLPPP---PPPPPGAPGGGAPPPPPPPPPA 315 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP-------LPPPAXXXXPP 859 PPPPP P P P P AP P PP +PPP PP Sbjct: 281 PPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPP 332 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP PPPP P PPLP P Sbjct: 307 PPPPPPPPAAAGGAGVPPPPPPPPPPANL---PPLPSP 341 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 S PPPPPPP P PP PP A PP PP Sbjct: 289 SLPPPPPPP--PGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPP 332 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP A PP PPP Sbjct: 488 PPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPP 525 Score = 42.7 bits (96), Expect = 0.015 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P PPPP +PP PPP Sbjct: 487 PPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPP 524 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPP A P PP PPP Sbjct: 458 PPPPPPP----PPPPPPPPPTQSSAAGGGPPPPPPPPP 491 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +2 Query: 725 PPPPPPP----XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPP+ Sbjct: 467 PPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPS 509 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S PPPPPPP P PP PP P PP Sbjct: 456 ASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPP 502 Score = 33.9 bits (74), Expect = 6.8 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 4/79 (5%) Frame = +2 Query: 617 PPPPXKXKKSXXGXXAXXFSXXXXXXXXXXLXXXFXPPPPPPP----XXXXXPXPSXPPP 784 PPPP +S + PPPPPP P P PPP Sbjct: 467 PPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPP 526 Query: 785 PXXXAPXXXPXRPPLPPPA 841 P A + P P PA Sbjct: 527 PPPGAASQGSSQGPSPLPA 545 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +2 Query: 725 PPPPPPPXXXXX-------PXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP + PLP P Sbjct: 502 PPPPPPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSPLPAP 546 >UniRef50_Q90WR5 Cluster: Keratin alpha; n=1; Lampetra fluviatilis|Rep: Keratin alpha - Lampetra fluviatilis (River lamprey) Length = 629 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGG GGG Sbjct: 536 GGGGCGGGGGGGGGSGFGLGLGLGGGGGGFGGGGFSSGGGGFGGG 580 Score = 40.7 bits (91), Expect = 0.059 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G RG GGG GGG GG G GGGGGG G Sbjct: 49 GMGGGFRGGHCGGGGGYGGGGGYGGGGGYGGSSFSFGGGGGGGGAG 94 Score = 37.9 bits (84), Expect = 0.42 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G GG G G GGG GGGG Sbjct: 538 GGCGGGGG--GGGGSGFGLGLGLGGGGGGFGGGGFSSGGGGFGGGG 581 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG GG G G GGGG GGG Sbjct: 523 GGFGLGLGLGGGGGGGGCGGGGGGGGGSGFGLGLGLGGGGGGFGGG 568 Score = 37.5 bits (83), Expect = 0.55 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G GG G G GGG G G GGGG GG Sbjct: 523 GGFGLGLGLGGGGGGGGCGGGGGGGGGSGFGLGLGLGGGGGGFGG 567 Score = 36.7 bits (81), Expect = 0.96 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG GGGGG GG Sbjct: 52 GGFRG--GHCGGGGGYGGGGGYGGGGGYGGSSFSFGGGGGGGGAGG 95 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG GG G G GGGG G G GGGGG G Sbjct: 518 GGGDGGGFGLGLGLGGGGGGGGCGGG----GGGGGGSG 551 Score = 36.3 bits (80), Expect = 1.3 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G G GGG GG G G G GGGGGG Sbjct: 519 GGDGGGFGLGLGLGGGGGGGGCGGGGGGGGGSGFGLGLGLGGGGGG 564 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GGG G Sbjct: 557 GLGGGGGGFGGGGFSSGGGGFGGGGFSSGGGGFSSGGGGGSSSFG 601 Score = 35.1 bits (77), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG G G G G GGG Sbjct: 62 GGGYGGGGGYGGGGGYGGSSFSFGGGGGGGGAGGFAAGGFGARGGG 107 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G G G G G GGGG G G G GGGGG Sbjct: 519 GGDGGGFGLGLGLGGGGGGGGCGGGGGGGGGSGFGLGLGLGGGGG 563 Score = 35.1 bits (77), Expect = 2.9 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G G G G G GGGG GG Sbjct: 534 GGGGGGCGGGGGGGGGSGFGLGLGLGGGGGGFGGGGFSSGGGGFGG 579 Score = 35.1 bits (77), Expect = 2.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGG---GGGG 724 GG G G GG G G GGG G G GGG GGGG Sbjct: 548 GGSGFGLGLGLGGGGGGFGGGGFSSGGGGFGGGGFSSGGGGFSSGGGG 595 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGG--GGG 724 GG GGG GG G + GGGG G GG G GGG Sbjct: 61 GGGGYGGGGGYGGGGGYGGSSFSFGGGGGGGGAGGFAAGGFGARGGG 107 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGG 730 G GGG G G G GGGG G GGGGG Sbjct: 555 GLGLGGGGGGFGGGGFSSGGGGFGGGGFSSGGGGFSSGGGGG 596 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXG---GGGGGG 724 GG G G G G G GGGG G G G GGGGGG Sbjct: 517 GGGGDGGGFGLGLGLGGGGGGGGCGGGGGGGGGSGFGLGLGLGGGGGG 564 Score = 34.3 bits (75), Expect = 5.1 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG G GGGG GGG Sbjct: 535 GGGGGCGGGGGGGGGSGFGLGLGLGGGGGGFGGGGFSSGGGGFGGG 580 Score = 33.9 bits (74), Expect = 6.8 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGG---GGGGG 724 G GGG GG G G GGGG G G GG GGGGG Sbjct: 553 GLGLGLGGGGGGFGG---GGFSSGGGGFGGGGFSSGGGGFSSGGGGG 596 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = +2 Query: 707 LXXXFXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 L F PPPPPP P P PPPP P PP PPPA Sbjct: 299 LRYSFASPPPPPPPPPPPPPPPPPPPPPPPPP------PPPPPPA 337 Score = 37.9 bits (84), Expect = 0.42 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXA 799 PPPPPPP P P PPPP A Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPAFEA 340 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXPP 858 P PP PPP PPPP P P PP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 770 SXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 S PPPP P P PP PPP PP Sbjct: 305 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 726 PPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFL 833 PPPPPPP P PP PP A F+ Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPAFEAREFI 344 >UniRef50_A0HB13 Cluster: Putative uncharacterized protein precursor; n=1; Comamonas testosteroni KF-1|Rep: Putative uncharacterized protein precursor - Comamonas testosteroni KF-1 Length = 515 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG AGGG GG G G G GG G G GGG GGG Sbjct: 53 GGGDVVAGGGTGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGG 97 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG GG G G GGG GG Sbjct: 60 GGGTGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGNTGG 105 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGG-GGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GG GG G G GGG GG Sbjct: 64 GGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGNTGGGDGG 109 Score = 34.3 bits (75), Expect = 5.1 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GG G G G GGG GGG Sbjct: 61 GGTGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGTGGGNTGGG 106 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 827 GGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GGG GGG GG G G G GGG GG Sbjct: 53 GGGDVVAGGGTGGTGGGTGGGTGGGTGGGTGGGTGG 88 >UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 832 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P PPPP P PP PPP Sbjct: 41 PPPPPPPMRRRAPLP--PPPPPAMRRRVLPRPPPPPPP 76 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP AP PP PPPA Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPL-----PPPPPPA 61 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 740 PPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PP P P PPPP P PP PPP P Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAP 53 >UniRef50_Q60E27 Cluster: Putative uncharacterized protein OSJNBb0012L23.10; n=2; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBb0012L23.10 - Oryza sativa subsp. japonica (Rice) Length = 723 Score = 44.0 bits (99), Expect = 0.006 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG AGGG GR G GA GGGG G G GGGGGG Sbjct: 656 GGGGGAAGGGGRGRVGAGAGAAPGGGGG--GGGGAASGGGGGGG 697 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G G GGG G G G G G GGGGGG GR Sbjct: 656 GGGGGAAG--GGGRGRVGAGAGAAPGGGGGGGGGAASGGGGGGGRGR 700 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG-GGGGG 720 GG +GGGG GG GG G G GGG GGGGG Sbjct: 645 GGAGAALAPDGGGGGGAAGG----GGRGRVGAGAGAAPGGGGGGGGG 687 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 AG G GA GG G G G GGGGGGG Sbjct: 647 AGAALAPDGGGGGGAAGGGGRGRVGAGAGAAPGGGGGGG 685 >UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=3; Oryza sativa (japonica cultivar-group)|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 1779 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P PS PPPP P PP PPP PP Sbjct: 1363 PSPPAPPPPPAAPSPSAPPPPPAAPSPLAP--PPPPPPPCPPAPP 1405 Score = 41.9 bits (94), Expect = 0.026 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PP PP P+ PPPP +P P P P P PP Sbjct: 1352 PSPPAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPPP 1396 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F P PP P P P PPPP P PP P PP Sbjct: 1349 FRAPSPPAPPSPPAPSPPAPPPPPAAPSPSAPPPPPAAPSPLAPPPP 1395 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P P P P P P PP PP P Sbjct: 1369 PPPPAAPSPSAPPPPPAAPSPLAPPPPPPPPCPPAPPKTRSRQAP 1413 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPP P PPPP AP R PPPA Sbjct: 1380 PPPPPAAPSPLAPPPPPPPPCPPAPPKTRSR-QAPPPA 1416 >UniRef50_Q0J6R0 Cluster: Os08g0280200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os08g0280200 protein - Oryza sativa subsp. japonica (Rice) Length = 658 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P PPPP AP P RP PPP Sbjct: 53 PPPPPAPTSSPVRMSGPPPPPPPPAPNSCPSRPAPPPP 90 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP-AXXXXPP 859 PPPP P P P P PPP P PP PPP A PP Sbjct: 54 PPPPAPTSSPVRMSGPPPPPPPPAPNSCPSRPAPPPPPPPPLASTSSPP 102 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPP P PPPP A P RP P P Sbjct: 72 PPPPPAPNSCPSRPAPPPPPPPPLASTSSPPRPAAPSP 109 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP + PPPP + PP PP Sbjct: 152 PPPPPPPCSSSNQLSAPPPPPPSFSKNNGSIAPPPAPP 189 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPPPXXXXX--PXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P+ P P P RP PPP Sbjct: 88 PPPPPPPLASTSSPPRPAAPSPCQLHTSTSSPARPVPPPP 127 Score = 35.9 bits (79), Expect = 1.7 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 11/57 (19%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPP------PPXXXAPXXXPXR-----PPLPPPAXXXXP 856 F PP PPPP P P PP AP P R PP PPPA P Sbjct: 26 FRPPAPPPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPPPPAPNSCP 82 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPP S P PP P PP PPP Sbjct: 122 PVPPPPPTLSTIRSSAPTPPLLPGATSAPSPPPPPPP 158 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPP 827 S PPPPPPP PP PP +PP Sbjct: 67 SGPPPPPPPPAPNSCPSRPAPPPPPPPPLASTSSPP 102 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PS P P P P PP PPP PP Sbjct: 17 PPPPPPSPSPPPPPSPSPSPP---PPPSPSPPPSPPPPSSPPPP 57 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P PS PPPP +P P P PPP P Sbjct: 17 PPPPPPSPSPPPPPSPSPS-PPPPPSPSPPPSPPPPSSPPPPQRPRP 62 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP P P PS P PP +P P PP P P PP Sbjct: 9 PPPPTPLSPPPPPPS-PSPPPPPSPSPSPPPPPSPSPPPSPPPP 51 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P P PP P P P P P PP Sbjct: 26 PPPPPSPSPSPPPPPSPSPPPSPPPPSSPPPPQRPRPLTPPTPP 69 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPP 835 P P PPP P PS PPP P P PP PP Sbjct: 32 PSPSPPPPPSPSPPPSPPPPSSPPPPQRPRPLTPPTPP 69 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 725 PPPPPPP-XXXXXPXPSXPPPPXXXAPXXXPXRPPLP 832 PPPPP P P PS PPPP P P PP P Sbjct: 36 PPPPPSPSPPPSPPPPSSPPPPQRPRP-LTPPTPPTP 71 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 720 SXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXP 854 S PPPPP P P PP P PP PP P Sbjct: 16 SPPPPPPSPSPPPPPSPSPSPPPPPSPSPPPSPPPPSSPPPPQRP 60 Score = 34.3 bits (75), Expect = 5.1 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 5/43 (11%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPS----XPPPPXXXAPXXXPXRP-PLPPP 838 PPPPP P P PS PPP P P RP PL PP Sbjct: 26 PPPPPSPSPSPPPPPSPSPPPSPPPPSSPP--PPQRPRPLTPP 66 >UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG06865; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG06865 - Caenorhabditis briggsae Length = 646 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGG GG Sbjct: 114 GGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGG 158 Score = 42.7 bits (96), Expect = 0.015 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGG GG Sbjct: 128 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGGCGG 173 Score = 42.3 bits (95), Expect = 0.019 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G GA GGGG G G GGGG GG Sbjct: 93 GGGGGGCGGGGGG-CGGGGGACGGGGGGCGGGGGGCGGGGGGCGG 136 Score = 42.3 bits (95), Expect = 0.019 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GGGG GGG GG G GGGGGGG Sbjct: 97 GGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGG 141 Score = 42.3 bits (95), Expect = 0.019 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG GG G G GGGG G GGGGG G K Sbjct: 128 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGGCGGGVK 176 Score = 41.9 bits (94), Expect = 0.026 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGG GGG Sbjct: 85 GGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGG 130 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGG GG Sbjct: 93 GGGGGGCG--GGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGG 136 Score = 41.5 bits (93), Expect = 0.034 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G GGGGGG G Sbjct: 100 GGGGGGCG--GGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 143 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGG GGG Sbjct: 107 GGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGG 152 Score = 41.5 bits (93), Expect = 0.034 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G GGGG GGG Sbjct: 114 GGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGG 159 Score = 41.1 bits (92), Expect = 0.045 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGG G Sbjct: 83 GGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCG 128 Score = 41.1 bits (92), Expect = 0.045 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G GGGGGG G Sbjct: 90 GGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCG 135 Score = 41.1 bits (92), Expect = 0.045 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG G G G GGGGGG Sbjct: 104 GGCGGGGGACGGGGGGCGGGGGGCGGGGG-GCGGGGGGGCGGGGGG 148 Score = 40.7 bits (91), Expect = 0.059 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G G GGGG G G GGGGGG Sbjct: 107 GGGGGACGGGGGGCGG--GGGGCGGGGGGCGGGGGGGCGGGGGG 148 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGGGGG Sbjct: 89 GGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGG 133 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGG G G GGGGGG Sbjct: 96 GGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGG 140 Score = 40.3 bits (90), Expect = 0.078 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGGG Sbjct: 100 GGGGGGCGGG-GGACGGGGGGCGGGGGGCGGGGGGC--GGGGGGG 141 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGG-RGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGGG Sbjct: 110 GGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGG 155 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGGG GGG GG G G GGGGGG Sbjct: 111 GACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGG 155 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXG-----GGGGGG 724 GG GGG GG G G GGGG G G G GGGGGG Sbjct: 121 GGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGG 170 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGGG G Sbjct: 86 GGCGGGCGGGGGGCGG--GGGGCGGGGGACGGGGGGCGGGGGGCG 128 Score = 39.5 bits (88), Expect = 0.14 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGG---GGGGG 720 GG G G GGGG GGG GG G G GGG GGGGG Sbjct: 94 GGGGGCGG--GGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGG 140 Score = 38.3 bits (85), Expect = 0.31 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GG GG G G GGGG G GGGGGG Sbjct: 83 GGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGG 126 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GGG GGG GG G G GGGG GGG Sbjct: 82 GGGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGG 123 Score = 37.9 bits (84), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G G GGGGG Sbjct: 103 GGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGG 147 Score = 37.1 bits (82), Expect = 0.73 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G GGG GG G G GG GGG Sbjct: 122 GGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGG 167 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGG GGG GG G G G GG GG Sbjct: 121 GGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGG 166 Score = 34.7 bits (76), Expect = 3.9 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXG-GGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G G GGG G G GGG GGG Sbjct: 117 GGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCG---GGGGGCGGG 159 >UniRef50_A7RV64 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 335 Score = 44.0 bits (99), Expect = 0.006 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXG-GXXXXGXGXXXXXGGGGGGGG 720 G G G +GGGG GGG G G G G GGGGGGGG Sbjct: 271 GGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGGDGGGGGGGG 316 Score = 41.9 bits (94), Expect = 0.026 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G+ GGGG GG GG G G GGGG G G Sbjct: 253 GGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNG 298 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG GGG GG G G GG GGG G Sbjct: 264 GGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGGDG 309 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG GG G GA G G G G GGGGG Sbjct: 212 GGGGVGGGGGNGGGAGNGVGAGGCGCGNDGGNGGGGAGNGGGGG 255 Score = 39.5 bits (88), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGG G G G GGG G G GGGGGGG Sbjct: 280 GGGGVGNGGGDGGGGAGNGGGGGGNGGGDGGGGGGGGG 317 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G G GGGG GGG GG G G G G GGG Sbjct: 234 GCGCGNDGGNGGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGGG 278 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GG GG G G GGGG G G Sbjct: 242 GNGGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNG 287 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 G GGG G G G GGGG G GGGGGG K Sbjct: 274 GNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGGDGGGGGGGGGAASSK 322 Score = 38.7 bits (86), Expect = 0.24 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G G GG GGG G G G GGGGGG Sbjct: 259 GGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGG 303 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AG G G G G GGG G G GGGG GG Sbjct: 263 GGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGG 306 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G GGGG GGG GG G G GG GGGG Sbjct: 241 GGNGGGGAGNGGGGGCNGGG--DSGGGGGAGAGGAGNGGGDGGGG 283 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G GA G GG G G GG GGGG Sbjct: 252 GGGGCNGGGDSGG--GGGAGAGGAGNGGGDGGGGVGNGGGDGGGG 294 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GG G G G G G G GGGG GG Sbjct: 214 GGVGGGGGNGGGAGNGVGAGGCGCGNDGGNGGGGAGNGGGGGCNGG 259 Score = 36.3 bits (80), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG G G G GGG GGG Sbjct: 249 GNGGGGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGG 293 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEG--GGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G G GGG GGG GG G G GGG GG Sbjct: 245 GGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGG 292 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG G G G GGG G GGG GGG Sbjct: 263 GGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGG 307 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G GGG G G GG G GG Sbjct: 233 GGCGCGNDGGNGGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGG 277 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GGG GGG GG G G G GGG G Sbjct: 236 GCGNDGGNGGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGGGDG 280 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G GGG G G G GGGG Sbjct: 258 GGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGG 301 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG G G G G GGGG G G GGG GGG Sbjct: 238 GNDGGNGGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGN-GGGDGGG 282 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GGG G G GGG G G G GGGG Sbjct: 251 GGGGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGG 294 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRG-GRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G G G G G G GGGGGG Sbjct: 258 GGGDSGGGGGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGG 303 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG G GG G G GGG G G GGG GG Sbjct: 266 GGAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGGDGG 310 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G AG G G G GGGG G GGG GGG Sbjct: 267 GAGAGGAGNGGGDGGGGVGNGGGDGGGGAGNGGGGGGNGGGDGGG 311 Score = 33.5 bits (73), Expect = 8.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGG GGG G G G GGGG G G Sbjct: 206 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGNDGGNGGGGAGNG 251 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G G G G G GG G GG Sbjct: 244 GGGGAGNGGGGGCNGGGDSGGGGGAGAGGAGNGGGDGGGGVGNGG 288 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPPA 841 PPPPP P P P PPPP P P PP+P PA Sbjct: 1097 PPPPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMPGPA 1136 Score = 42.7 bits (96), Expect = 0.015 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPP---PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P AP PP PPP PP Sbjct: 1030 PPPPPPP-----PPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPP 1072 Score = 42.7 bits (96), Expect = 0.015 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P + P P P P PP P P PP Sbjct: 1066 PPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPP 1110 Score = 41.5 bits (93), Expect = 0.034 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP-XXXPXRPPLPPP 838 PPPPPPP PPPP P P PP PPP Sbjct: 1092 PPPPPPPPPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPP 1130 Score = 41.1 bits (92), Expect = 0.045 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P P P P PP PPP Sbjct: 1036 PPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPP 1073 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P + PPP P P P +PPP P Sbjct: 1091 PPPPPPPPPPPMPGMAGMPPP-PPPPPPMPGMPGMPPPPPPPMP 1133 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 725 PPPPPPPXXXXXP---XPSXPPP-PXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPPP P P P P P P P PP PPP P Sbjct: 1031 PPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLP 1078 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P P P PP+P A PP Sbjct: 1068 PPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPP 1112 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +3 Query: 717 SSXPPPPPPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPPXXXXPP 857 +S PPPPPPP P P P PP PP PP Sbjct: 1027 ASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPP 1073 Score = 35.9 bits (79), Expect = 1.7 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 10/55 (18%) Frame = +2 Query: 725 PPPPPP----------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P P P PPPP P P P P A PP Sbjct: 1039 PPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPP 1093 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PP P P P PPPP P PP PPP Sbjct: 1082 PPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPP 1117 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PPP A P PP P P PP Sbjct: 1090 PPPPPP-------PPPPPPMPGMAGMPPPPPPPPPMPGMPGMPP 1126 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 10/54 (18%) Frame = +2 Query: 725 PPPPPP----------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P P PPPP PP PPP P Sbjct: 1069 PPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPGMP 1122 >UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 592 Score = 44.0 bits (99), Expect = 0.006 Identities = 19/39 (48%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXP-SXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPPP P P + P PP AP P PP P P Sbjct: 229 PPPPPPPAAPPRPVPEAAPAPPPPPAPKRGPAPPPPPAP 267 Score = 41.1 bits (92), Expect = 0.045 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +2 Query: 725 PPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P PPPP P P P PPP Sbjct: 212 PPPPPPSNPPGGNLRAPPPPPPPPAAPPRPVPEAAPAPPP 251 Score = 39.9 bits (89), Expect = 0.10 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +2 Query: 725 PPPPPPPXXXXX-----PXPSXPPP--PXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P P PPP P P P PP P P PP Sbjct: 211 PPPPPPPSNPPGGNLRAPPPPPPPPAAPPRPVPEAAPAPPPPPAPKRGPAPP 262 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P PPP + P P P PA PP Sbjct: 247 PAPPPPPAPKRGPAP-PPPPAPRRSGKFEPEPAPTPAPARDSPPP 290 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPP--PPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPP P S PP PP P P R P+PPP P Sbjct: 382 PTAPPPLPPKAPAASAPPLPPPSSRPPPTLPARSPVPPPPAPPPP 426 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P+ PPP AP PPLPPP+ P Sbjct: 368 PPPPPSREPVHAHTPTAPPPLPPKAPAASA--PPLPPPSSRPPP 409 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX---PPPPXXXAPXXXPXRPPLPPP 838 PP PPP P+ PPPP P R PLPPP Sbjct: 398 PPLPPPSSRPPPTLPARSPVPPPPAPPPPRRSLHRVPLPPP 438 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 44.0 bits (99), Expect = 0.006 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P PP P P P +PPP PP Sbjct: 1009 PPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPP 1053 Score = 39.1 bits (87), Expect = 0.18 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +2 Query: 725 PPPPPP-------PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P P P PPPP P PP PPP Sbjct: 1010 PPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPPP 1054 Score = 38.7 bits (86), Expect = 0.24 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP 802 PPPPPPP P P PPPP P Sbjct: 1032 PPPPPPPGMPGMPPPPPPPPPPPGMP 1057 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +2 Query: 728 PPPPPPXXXXXPXP------SXPPPPXXXAPXXXPXRPPLPPP 838 PPPPPP P PPPP P P PP PPP Sbjct: 1007 PPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPP 1049 Score = 36.3 bits (80), Expect = 1.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 11/49 (22%) Frame = +2 Query: 725 PPPPPPP-----------XXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 P PPPPP P P PPPP P P PP PPP Sbjct: 1005 PAPPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPPPPPP 1053 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP P + P P P P PP PPP PP Sbjct: 1007 PPPPPPPP----PGMNAPVAPGFGGPPPPPP-PP-PPPGMPGMPP 1045 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAP 802 F PPPPPP P PPPP P Sbjct: 1025 FGGPPPPPPPPPPPGMPGMPPPPPPPPP 1052 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR 820 PPPPPPP PPPP P P + Sbjct: 1028 PPPPPPPPPPPGMPGMPPPPPPPPPPPGMPGK 1059 >UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 1440 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 725 PPPPPP---PXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPPP P P+ PPPP AP P PP+ P A P Sbjct: 1346 PPPPPPSLFPTESSNAPPAPPPPPPPSAPLAVPPPPPMAPAAPPLAP 1392 Score = 43.6 bits (98), Expect = 0.008 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPPP + PP P P P P PPP PP Sbjct: 1345 PPPPPPPSLFPTESSNAPPAPPPPPPPSAPLAVPPPPPMAPAAPP 1389 Score = 37.5 bits (83), Expect = 0.55 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PPPP P PP PPP P Sbjct: 1334 PPPPPIPLQV----PPPPPPPPSLFPTESSNAPPAPPPPPPPSAP 1374 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXX--APXXXPXRPPLPPP-AXXXXPP 859 PPPPP P P PPP + P PP PPP A PP Sbjct: 1334 PPPPPIPLQVPPPPPPPPSLFPTESSNAPPAPPPPPPPSAPLAVPP 1379 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPPP P PPPP A P PPL P PP Sbjct: 1362 PPAPPPPPPPSAPLAVPPPPPM--A----PAAPPLAPAPSPGGPP 1400 >UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2; Aspergillus|Rep: Contig An08c0110, complete genome - Aspergillus niger Length = 384 Score = 44.0 bits (99), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR--PPLPPPAXXXXP 856 PPPPPPP P PPP P P R PP PPP P Sbjct: 190 PPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPPPGASAP 235 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P+ PPPP A P PP PPPA PP Sbjct: 175 PPPPPVSTRKPSAPAPPPPPPPSASPAAP--PPPPPPASAPRPP 216 Score = 38.7 bits (86), Expect = 0.24 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPPP P PP AP P P P P+ PP Sbjct: 259 PPPPPPAASAPAAPPPPPPSAPPVAPPSEPLSRPSPLPSAIAPPP 303 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP PPP P PPPP P PP PPP+ P Sbjct: 161 PPRAPPPLPGSAKGP--PPPPVSTRKPSAPAPPPPPPPSASPAAP 203 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAP 802 PPPPPPP P PPPP P Sbjct: 3 PPPPPPPPPGGMGGPPPPPPPAGNLP 28 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 734 PPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPPP P PPP A P PP PP Sbjct: 132 PPPPAMSAPKPPGARPPPRPPATESAPDAPPRAPP 166 >UniRef50_P17816 Cluster: Glycine-rich cell wall structural protein precursor; n=14; Magnoliophyta|Rep: Glycine-rich cell wall structural protein precursor - Hordeum vulgare (Barley) Length = 200 Score = 44.0 bits (99), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GG GGGG Sbjct: 72 GGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGG 116 Score = 40.7 bits (91), Expect = 0.059 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG-----GXXXXGGXXXXGXGXXXXXGGGGGGGGR 717 GG G EGGGG GG G GG G G GGGG GGGR Sbjct: 120 GGGYHGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGGYPGHGGGGGHGGGR 171 Score = 40.3 bits (90), Expect = 0.078 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G GGGG GGG GG G G GG GGGG Sbjct: 55 GGHGGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGG 99 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G EGGGG GGG GG G G G GG GG Sbjct: 86 GGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYGGGGGYHGHGGEGG 131 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G EGGGG GGG GG G G G GG GG Sbjct: 103 GGGYPGHGGEGGGGYGGGGGYHGHGGEGGGGYGGGGGYHGHGGEGG 148 Score = 39.1 bits (87), Expect = 0.18 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 857 GGXXGX-RGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GGGG GGG GG G G G GGGGGG Sbjct: 47 GGHHGHGRGGHGGGGYGGGGGYGGGGGGYPGGGG-----GYGGGGGG 88 Score = 39.1 bits (87), Expect = 0.18 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG GGG GG GG GGGGG Sbjct: 60 GGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGG 105 Score = 38.7 bits (86), Expect = 0.24 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGGXKXK 712 GG GGG G G G GGGG G G GGGG GG + K Sbjct: 130 GGGGYGGGGGYHGHGGEGGGGYGGGGGGYPGHG-----GGGGHGGGRCK 173 Score = 38.3 bits (85), Expect = 0.31 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXG---XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G G GGGGG Sbjct: 58 GGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGG 105 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G G GGGGG Sbjct: 79 GGGYGGGGGGYPGHGGEGGGGYG-GGGGYPGHGGEGGGGYGGGGG 122 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GG GGGG Sbjct: 91 GHGGEGGGGYGG-GGGYPGHGGEGGGGYGGGGGYHGHGGEGGGG 133 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G G G GGGGG Sbjct: 96 GGGGYGGGGGYPGHGGEGGGGYG-GGGGYHGHGGEGGGGYGGGGG 139 Score = 37.9 bits (84), Expect = 0.42 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 855 GXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G GG GGGG Sbjct: 108 GHGGEGGGGYGG-GGGYHGHGGEGGGGYGGGGGYHGHGGEGGGG 150 Score = 37.1 bits (82), Expect = 0.73 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXG-GGGGGG 724 GG GGG G G G GGGG G G G GGGGGG Sbjct: 113 GGGGYGGGGGYHGHGGEGGGGYG-GGGGYHGHGGEGGGGYGGGGGG 157 Score = 36.7 bits (81), Expect = 0.96 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G G G GGG GG G G GGG GGGG Sbjct: 45 GGGGHHGHGRGGHGGGGYGGGGGYGGGGGGYPGGGGGYGGGG 86 Score = 36.7 bits (81), Expect = 0.96 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GG GG G G GGG G G GG GGGG Sbjct: 55 GGHGGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGGGG 99 Score = 35.9 bits (79), Expect = 1.7 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G G GGGG G GG G G G GGGG G Sbjct: 73 GGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYG 118 Score = 35.5 bits (78), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGG 727 GG GG GG G G GGGG G GGGGGG Sbjct: 47 GGHHGHGRGGHGG--GGYGGGGGYGGGGGGYPGGGGGYGGGGGG 88 Score = 34.7 bits (76), Expect = 3.9 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 855 GXXXXAGGGRGGRXG-XXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 G GGG GG G G GGGG G G G GG GG Sbjct: 53 GRGGHGGGGYGGGGGYGGGGGGYPGGGGGYGGGGGGYPGHGGEGG 97 Score = 34.7 bits (76), Expect = 3.9 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGG--GXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G GG G GG G GG G G GG GGGG Sbjct: 70 GGGGGYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGG 116 Score = 33.5 bits (73), Expect = 8.9 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXG--XGXXXXXGGGGGGGG 720 G G G GGGG G G GG G G GGG GGGG Sbjct: 74 GYPGGGGGYGGGGGGYPGHGGEGGGGYGGGGGYPGHGGEGGGGYGGGG 121 >UniRef50_UPI0000E4A916 Cluster: PREDICTED: hypothetical protein; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 416 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G + GGGG G G GGGGGGG Sbjct: 371 GGGGSGGGGGDSGGGGGDYSSGGGGGGGGGGGGGGGDSGGGGGGG 415 Score = 40.7 bits (91), Expect = 0.059 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 827 GGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GGGG GGG GG G GGGGGGGG Sbjct: 371 GGGGSGGGGGDSGGGGGDYSSGGGGGGGGGGGGGGG 406 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G G+ GGGG G GG G G GGGGGGG Sbjct: 373 GGSGGGGGDSGGGGGDYSSGGGGGGGGGGGGGGGDS--GGGGGGG 415 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 845 GXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 G G GGGG GGG G G G GG GGGG Sbjct: 371 GGGGSGGGGGDSGGGGGDYSSGGGGGGGGGGGGGGGDSGGGG 412 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG + GGG GG G G GGGGGGGG Sbjct: 355 GGDHSDHQDHSHSYSSGGGGSGGGGGDSGGGGGDYSSGGGGGGGGG 400 >UniRef50_UPI0000DB7674 Cluster: PREDICTED: hypothetical protein; n=2; Eumetazoa|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 441 Score = 43.6 bits (98), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPPPP P P PPPP P RPP PPP P Sbjct: 95 PPPPPTPYVPPSPTSRPPPPPTPYVPPSPTSRPP-PPPTPYVPP 137 Score = 43.2 bits (97), Expect = 0.011 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXR-PPLPPPAXXXXPP 859 PPPPP P P PPPP P R PP+P P PP Sbjct: 111 PPPPPTPYVPPSPTSRPPPPPTPYVPPSPTSRPPPIPTPYLPPSPP 156 Score = 41.1 bits (92), Expect = 0.045 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP PP P P PP P P P PP PP + PP Sbjct: 37 YVPPSPPTSRPPPPPTPYVPPSPPTSRPPPTPYLPPSPPTSRPRPPP 83 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPP P P PPPP P RPP PPP P Sbjct: 79 PRPPPTPYVPPSPTSRPPPPPTPYVPPSPTSRPP-PPPTPYVPP 121 Score = 38.7 bits (86), Expect = 0.24 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PP PP P P P PP +P P RPP PP PP Sbjct: 255 PPSPPSPPITRPPSPPSPPVTRPPSPPSPPVTRPPSPPSPPVTRPP 300 Score = 38.3 bits (85), Expect = 0.31 Identities = 20/50 (40%), Positives = 21/50 (42%), Gaps = 5/50 (10%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXX---PXRPPLP--PPAXXXXPP 859 PPPPP P P S PPP P P PP P PP+ PP Sbjct: 47 PPPPPTPYVPPSPPTSRPPPTPYLPPSPPTSRPRPPPTPYVPPSPTSRPP 96 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPPP P P PP P P P P P P PP Sbjct: 127 PPPPPTPYVPPSPTSRPPPIPTPYLPPSPPTSRPPPTPYLPPSPP 171 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PP PP P P P PP +P P RPP PP PP Sbjct: 222 PPSPPSPPVTRPPSPPSPPITRPPSPPSPPITRPPSPPSPPITRPP 267 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PP PP P P P PP +P P RPP PP PP Sbjct: 233 PPSPPSPPITRPPSPPSPPITRPPSPPSPPITRPPSPPSPPVTRPP 278 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 PP PP P P P PP +P P RPP PP PP Sbjct: 244 PPSPPSPPITRPPSPPSPPITRPPSPPSPPVTRPPSPPSPPVTRPP 289 Score = 37.1 bits (82), Expect = 0.73 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPP-XXXAPXXXPXRPPLPPPAXXXXPP 859 PP PP P P S PPPP P P P P P PP Sbjct: 30 PPAPPTPYVPPSPPTSRPPPPPTPYVPPSPPTSRPPPTPYLPPSPP 75 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P P P+ PPP P P P PPP+ P Sbjct: 143 PPPIPTPYLPPSP-PTSRPPPTPYLPPSPPINRPSPPPSSYLPP 185 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPP P P + P PP P RPP P P PP Sbjct: 160 PPPTPYLPPSPPINRPSPPPSSYLPPSPSRPPSPQPPPTRPPP 202 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSX--PPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PPP P+ P PP P P PP PP PP Sbjct: 191 PSPQPPPTRPPPTGPTYLPPSPPVTHPPITRPPSPPSPPVTRPPSPP 237 Score = 35.5 bits (78), Expect = 2.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXP-PPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP P P S P PPP P RPP PPP P Sbjct: 64 PPPTPYLPPSPPTSRPRPPPTPYVPPSPTSRPP-PPPTPYVPP 105 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P PP P P P PP PP PP Sbjct: 136 PPSPTSRPPPIPTPYLPPSPPTSRPPPTPYLPPSPPINRPSPPP 179 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPP 835 PP PP P P P PP +P P RPP PP Sbjct: 266 PPSPPSPPVTRPPSPPSPPVTRPPSPPSPPVTRPPSPP 303 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 731 PPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPP-LPPPAXXXXPP 859 P PPP P PS PP P P P LPP PP Sbjct: 175 PSPPPSSYLPPSPSRPPSPQPPPTRPPPTGPTYLPPSPPVTHPP 218 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +2 Query: 719 FXPPPPPP--PXXXXXPXPSXPPPPXXXAPXXXPX-RPPLPPPAXXXXPP 859 + PP PP P P P PP +P P RPP PP PP Sbjct: 207 YLPPSPPVTHPPITRPPSPPSPPVTRPPSPPSPPITRPPSPPSPPITRPP 256 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 + PP PP P P PP P P P P +PP PP Sbjct: 69 YLPPSPPTSRPRPPPTPYVPPSPTSRPP--PPPTPYVPPSPTSRPPP 113 >UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucleopolyhedrovirus|Rep: 1629capsid - Hyphantria cunea nuclear polyhedrosis virus (HcNPV) Length = 539 Score = 43.6 bits (98), Expect = 0.008 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PPPP PP P P+ PPPP P P PP PPP PP Sbjct: 240 PPPPTPP----PPPPNMPPPP--PPPPNMPPPPPPPPPPPLSLPP 278 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 717 SSXPPPP-PPPXXXXXPXXXXXPPXXXXPPXXXXXAPPFLPP 839 ++ PPPP PPP P PP PP P LPP Sbjct: 237 TNVPPPPTPPPPPPNMPPPPPPPPNMPPPPPPPPPPPLSLPP 278 >UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; Aedes taeniorhynchus iridescent virus|Rep: Putative uncharacterized protein - Aedes taeniorhynchus iridescent virus Length = 407 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRP-PLPPPAXXXXPP 859 P PP PP P P PPPP P P +P P+PPP PP Sbjct: 283 PDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPP 329 Score = 42.7 bits (96), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRP-PLPPPAXXXXP 856 PPPPPPP P P P P P P P P PPP P Sbjct: 297 PPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPPQP 341 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLP-PPAXXXXPP 859 PP PP P P P PPP P P PP P PP PP Sbjct: 289 PPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPP 334 Score = 42.3 bits (95), Expect = 0.019 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P PPPPP P P+ PP P P P P PPP PP Sbjct: 295 PDPPPPP----PPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPP 335 Score = 40.3 bits (90), Expect = 0.078 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 719 FXPPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 F P PPP P P P PPP P P PP P P PP Sbjct: 269 FKPDPPPQPKPQPPPDPPKPPPDP---PKPDPPPPPPPKPTPPPDPP 312 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 PPP PP P P P P P P PP P P P Sbjct: 307 PPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPPQPVPILPIPP 349 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPP P P P PP P P P PP+PP P Sbjct: 305 PTPPPDP-PKPKPDPVPPPKPTPPPPKPTPP-PPIPPQPVPILP 346 >UniRef50_Q2IIP5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 205 Score = 43.6 bits (98), Expect = 0.008 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPP 838 PPP P P P P PPP P P PP PPP Sbjct: 40 PPPQPQPDPQPAPQPQPPPPAPQPEPQPPPPEPPPPPP 77 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXP 856 P PPPP P P+ P P AP P PP PP P Sbjct: 37 PQPPPPQPQPDPQPAPQPQPPPPAPQPEPQPPPPEPPPPPPQP 79 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 PP P P P P PPP P P P PPP P Sbjct: 22 PPAPGPQPQPQPQPDPQPPPPQPQPDPQPAPQPQPPPPAPQPEP 65 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXP-XRPPLPPPAXXXXPP 859 P P P P P P PPP P P +PP P P PP Sbjct: 23 PAPGPQPQPQPQPDPQPPPPQPQPDPQPAPQPQPPPPAPQPEPQPP 68 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P P P P P P P AP P PP P P PP Sbjct: 27 PQPQPQPQPDPQPPPPQPQPDPQPAPQPQPP-PPAPQPEPQPPPP 70 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 728 PPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPAXXXXPP 859 P P PP P P P P P P P PPP PP Sbjct: 35 PDPQPPPPQPQPDPQPAPQPQPPPPAPQP-EPQPPPPEPPPPPP 77 >UniRef50_Q0LCI7 Cluster: Putative uncharacterized protein; n=1; Herpetosiphon aurantiacus ATCC 23779|Rep: Putative uncharacterized protein - Herpetosiphon aurantiacus ATCC 23779 Length = 456 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG G G G GGGG G GGGGGGG Sbjct: 156 GGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGGGG 200 Score = 41.5 bits (93), Expect = 0.034 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG +GGG GG G GGG G GGGGGGG Sbjct: 155 GGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGGG 199 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG G G GGGGGGG Sbjct: 154 GGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGGG 199 Score = 39.9 bits (89), Expect = 0.10 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGG GGG G G GGGGGGGG Sbjct: 155 GGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGGGG 200 Score = 39.5 bits (88), Expect = 0.14 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGG---XXGXGXXXXXGGGGGGG 724 GG AGGG G G+ GGGG G G GGGGGGG Sbjct: 139 GGAGIAAGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGG 186 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GG GGG GG G GGGGGGGG Sbjct: 156 GGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGGGGG 201 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GG G G G GGGGGG Sbjct: 153 GGGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGGG 198 Score = 37.9 bits (84), Expect = 0.42 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G GGGG GGG GG G G GGGGGGGG Sbjct: 163 GGGGGSSSGGGGGGSSSGGGGG--GGSSTAGAGGG---GGGGGGGG 203 Score = 37.5 bits (83), Expect = 0.55 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 854 GXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 G G GGGG GGG GG G G GGGGGGG Sbjct: 146 GGGGSSSGGGGGGSSSGGGG---GGSSSGGGGGGSSSGGGGGGG 186 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 840 AGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 +GG G G G GGG G G GGGGGG Sbjct: 129 SGGSNAGATGGGAGIAAGGGGSSSGGGGGGSSSGGGGGG 167 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGG--XXGXGXXXXXGGGGGGG 724 GG A GG G G+ GGGG G G GGGGGG Sbjct: 130 GGSNAGATGGGAGIAAGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGG 176 Score = 33.9 bits (74), Expect = 6.8 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 5/50 (10%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGG-----GXXGXGXXXXXGGGGGGG 724 GG GGG G G+ GGG G G G G GGGGG Sbjct: 148 GGSSSGGGGGGSSSGGGGGGSSSGGGGGGSSSGGGGGGGSSTAGAGGGGG 197 >UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2; Hyphomonadaceae|Rep: OmpA/MotB domain protein precursor - Maricaulis maris (strain MCS10) Length = 359 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 725 PPPPPPPXXXXXPXPSXPPPPXXXAPXXXPXRPPLPPPA 841 PPPPPPP P P PPPP P PP PPPA Sbjct: 216 PPPPPPPPPPPPPPPPPPPPP--------PPPPPPPPPA 246 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP P P PP Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPP 241 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP P P PP Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPP 242 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP P P PP Sbjct: 218 PPPPPPPPPPPPPPPPPPPPPPPPPP 243 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP P P PP Sbjct: 219 PPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 781 PPXXXXPPPXXXPPPPSSPRXPXXPP 858 PP PPP PPPP P P PP Sbjct: 220 PPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXP 846 P P PP PPP PPPP P P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 244 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 760 PXPXXXXPPXXXXPPPXXXPPPPSSPRXP 846 P P PP PPP PPPP P P Sbjct: 217 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 766 PXXXXPPXXXXPPPXXXPPPPSSPRXPXXP 855 P PP PPP PPPP P P P Sbjct: 216 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 245 >UniRef50_A5WD13 Cluster: Putative uncharacterized protein precursor; n=3; Psychrobacter|Rep: Putative uncharacterized protein precursor - Psychrobacter sp. PRwf-1 Length = 396 Score = 43.6 bits (98), Expect = 0.008 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = -3 Query: 837 GGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GGGRGGR G G GGG G G GG GGGG Sbjct: 342 GGGRGGRGGRGGGVVFFPGGGFGGGGGGFGGGGFGGGG 379 Score = 39.9 bits (89), Expect = 0.10 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 4/49 (8%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXX----GAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGRGGR G G GGGG G G GGGGGG Sbjct: 338 GGGKGGGRGGRGGRGGGVVFFPGGGFGGGGGGFGGGGFGGGGFGGGGGG 386 Score = 39.9 bits (89), Expect = 0.10 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGG 723 GG G RG GGG GG GG G G GGGGGG Sbjct: 342 GGGRGGRGGRGGGVVFFPGGGFGGGGGGFGGGGFGGGGFGGGGGG 386 Score = 36.7 bits (81), Expect = 0.96 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 858 GGXXXXAGGGRGGRXGXXXGAXXXGGGGXXGXGXXXXXGGGGGGG 724 GG GGG GG G G GGGG G G GGGG GG Sbjct: 353 GGVVFFPGGGFGG-GGGGFGGGGFGGGGFGGGG--GGFGGGGAGG 394 Score = 33.9 bits (74), Expect = 6.8 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -1 Query: 857 GGXXGXRGEEGGGGXXXGGGXXXXGGXXXXGXGXXXXXGGGGGGGG 720 GG G RG GG G GG GG G G G GGGG G Sbjct: 339 GGKGGGRGGRGGRG---GGVVFFPGGGFGGGGGGFGGGGFGGGGFG 381 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,324,746 Number of Sequences: 1657284 Number of extensions: 13046432 Number of successful extensions: 519260 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 48576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236264 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 97163815826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -