BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J08 (861 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82269-3|CAB05207.2| 1319|Caenorhabditis elegans Hypothetical pr... 28 9.8 Z82269-2|CAJ76945.1| 1129|Caenorhabditis elegans Hypothetical pr... 28 9.8 >Z82269-3|CAB05207.2| 1319|Caenorhabditis elegans Hypothetical protein F52G2.2a protein. Length = 1319 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 593 LSCSDPGRLPDTCPPFSPSGSVAPFS*PHAVGISVSVLXRSLQAGCV 733 L RLP+ S GS F+ PH G+ V + R GCV Sbjct: 644 LGAKSISRLPNEPRNGSKHGSTKRFTTPHVTGLVVDMEKRGNYFGCV 690 >Z82269-2|CAJ76945.1| 1129|Caenorhabditis elegans Hypothetical protein F52G2.2b protein. Length = 1129 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 593 LSCSDPGRLPDTCPPFSPSGSVAPFS*PHAVGISVSVLXRSLQAGCV 733 L RLP+ S GS F+ PH G+ V + R GCV Sbjct: 454 LGAKSISRLPNEPRNGSKHGSTKRFTTPHVTGLVVDMEKRGNYFGCV 500 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,071,241 Number of Sequences: 27780 Number of extensions: 351222 Number of successful extensions: 1083 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1020 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -