BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J08 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 2.1 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 2.1 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 2.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 2.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 4.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 4.8 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 556 DTRRFPLEAPSCALLFRPWPLTGY 627 D FP + +C L F W G+ Sbjct: 156 DVEYFPFDEQTCVLKFGSWTYDGF 179 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 556 DTRRFPLEAPSCALLFRPWPLTGY 627 D FP + +C + F W GY Sbjct: 148 DVEYFPFDEQTCFMKFGSWTYDGY 171 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -2 Query: 671 MRKAPRF--PKGRKADRYPVSGQGRNRRAHEG 582 + APR P G Y +SG G+ A+EG Sbjct: 19 LEDAPRVKTPLGAIKGYYKISGNGKQYEAYEG 50 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -2 Query: 671 MRKAPRF--PKGRKADRYPVSGQGRNRRAHEG 582 + APR P G Y +SG G+ A+EG Sbjct: 19 LEDAPRVKTPLGAIKGYYKISGNGKQYEAYEG 50 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.6 bits (46), Expect = 4.8 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +1 Query: 565 RFPLEAPSCALLFRPW 612 +FP + C L+F W Sbjct: 148 KFPFDVQECPLIFESW 163 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 4.8 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = +1 Query: 556 DTRRFPLEAPSCALLFRPWPLTGY 627 D FP + C L + W GY Sbjct: 134 DVEFFPFDEQRCVLKWASWTYDGY 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,166 Number of Sequences: 438 Number of extensions: 4682 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -