BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J07 (837 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0189 + 1578935-1578950,1579227-1579390,1579493-1579605,157... 31 1.1 02_05_0331 + 28003454-28003912,28004649-28004873,28005017-280053... 29 3.5 >08_01_0189 + 1578935-1578950,1579227-1579390,1579493-1579605, 1579850-1580399,1580514-1580813,1581093-1581133, 1581359-1581606,1581983-1582086,1582177-1582323 Length = 560 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 280 RNPDVSWNKKTNPEPWEAYRNKQYKFYSPIRDY 378 R +V WN + E EAYR K+ P+RD+ Sbjct: 526 RKYNVKWNDEVTAEDMEAYRMKRIHHDDPMRDF 558 >02_05_0331 + 28003454-28003912,28004649-28004873,28005017-28005370, 28005673-28005702,28006869-28007342 Length = 513 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 238 GCGGAVFYTLRLALRNPDVSWNKKTNPEP 324 GC AV TL AL + KKTNP+P Sbjct: 385 GCNAAVMSTLLSALVAVEACLGKKTNPQP 413 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,352,697 Number of Sequences: 37544 Number of extensions: 318373 Number of successful extensions: 874 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -