BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J06 (836 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0756 + 5819367-5820038,5820847-5821005 64 2e-10 03_06_0386 + 33555682-33556344,33557138-33557299 64 2e-10 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 33 0.21 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.21 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 27 0.30 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 0.30 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 0.51 12_02_0299 - 17051570-17052474,17053542-17053755 26 0.52 12_02_1174 - 26696869-26698191 25 1.5 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.5 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 31 1.5 01_06_1321 + 36280691-36281269 25 1.6 11_06_0081 + 19886848-19888050,19888243-19888896 25 1.9 02_03_0279 + 17250347-17252098 25 1.9 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 25 1.9 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 30 2.0 05_03_0458 + 14280953-14281866,14281964-14282912 30 2.0 04_04_0057 + 22410167-22411330 30 2.0 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 30 2.0 05_07_0031 - 27183252-27183317,27183542-27184282 25 2.0 12_01_0319 + 2440129-2440661,2440875-2440902 25 2.1 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 30 2.6 04_03_1022 - 21778315-21779007 30 2.6 01_01_0046 - 331758-332627 25 3.3 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 29 3.5 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 27 4.2 10_08_0026 - 14253680-14253894,14253981-14254109,14254704-142547... 25 4.5 12_02_0687 + 22123216-22123760,22125021-22125330 29 6.1 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 29 6.1 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 6.1 07_03_0890 - 22332768-22333382 29 6.1 07_01_0080 + 587674-588510 29 6.1 02_05_0686 - 30900748-30902167,30903442-30904742 29 6.1 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 6.1 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 29 6.1 12_01_0841 - 7873458-7874225 28 8.0 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 28 8.0 12_01_0838 - 7830944-7831444 28 8.0 10_08_0218 - 15967064-15967906 28 8.0 07_03_1751 - 29215074-29216270 28 8.0 07_03_1136 + 24218601-24218734,24218769-24219906 28 8.0 07_03_0560 + 19479597-19480667 28 8.0 07_03_0558 + 19461369-19462448 28 8.0 07_03_0177 - 14770777-14772045 28 8.0 06_03_1506 + 30641428-30642168 28 8.0 06_03_0790 - 24636805-24637770 28 8.0 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 28 8.0 06_01_0178 + 1386981-1387505 28 8.0 05_04_0303 - 20010761-20011756 28 8.0 04_04_1413 - 33386049-33386339 28 8.0 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 28 8.0 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 28 8.0 03_01_0023 + 198414-198968 28 8.0 02_04_0400 - 22608519-22608844,22609044-22609122 28 8.0 02_01_0158 - 1103461-1104186 28 8.0 01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664,876... 28 8.0 01_01_0570 - 4231100-4232560 28 8.0 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 24 8.6 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 24 9.3 >07_01_0756 + 5819367-5820038,5820847-5821005 Length = 276 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/42 (59%), Positives = 37/42 (88%) Frame = +3 Query: 222 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIID 347 ++++++WVPVTKLGRLV+E KI K+E IYL SLP+KE +I++ Sbjct: 41 RQEEEKWVPVTKLGRLVKENKIHKIEEIYLHSLPVKEHQIVE 82 >03_06_0386 + 33555682-33556344,33557138-33557299 Length = 274 Score = 63.7 bits (148), Expect = 2e-10 Identities = 24/42 (57%), Positives = 37/42 (88%) Frame = +3 Query: 222 KEDQKEWVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIID 347 ++++++WVPVTKLGRLV+EG+ K+E IYL SLP+KE +I++ Sbjct: 38 RQEEEKWVPVTKLGRLVKEGRFSKIEEIYLHSLPVKEHQIVE 79 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPPPP 257 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 206 PPPPPPLPASSEPVDPSAASLPPLPPPPPPP 236 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 27.1 bits (57), Expect(2) = 0.30 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXKKT 833 PPPPPP P P P T Sbjct: 82 PPPPPPPPPPPPPPLSPTPTT 102 Score = 24.6 bits (51), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 81 SPPPPPPPPP 90 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPP 112 Score = 27.1 bits (57), Expect(2) = 0.30 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXKKT 833 PPPPPP P P P T Sbjct: 109 PPPPPPSPPPSAPPPPPPPPT 129 Score = 24.6 bits (51), Expect(2) = 0.30 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 104 SQPPPPPPPP 113 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 701 PXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 56 PTSPPPASPPLPSATPPLAASPPPPPPPPP 85 Score = 26.2 bits (55), Expect(2) = 0.51 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P P Sbjct: 79 PPPPPPPPRNSPSPPKP 95 Score = 24.6 bits (51), Expect(2) = 0.51 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 76 SPPPPPPPPP 85 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 26.2 bits (55), Expect(2) = 0.52 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P P Sbjct: 324 PPPPPPPPPSFPWPFPP 340 Score = 24.6 bits (51), Expect(2) = 0.52 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 319 SPPPPPPPPP 328 >12_02_1174 - 26696869-26698191 Length = 440 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 151 SLPPPPPPPP 160 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXK 827 PPPPPP P P K Sbjct: 160 PPPPPPRPPSVKPPVVQPK 178 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 701 PXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPP 787 PP PP P P PPPPPP Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPPP 593 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 642 PPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPP 719 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 641 PPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 24.6 bits (51), Expect(2) = 3.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 710 SAPPPPPPPP 719 Score = 23.0 bits (47), Expect(2) = 3.8 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P Sbjct: 714 PPPPPPPANRSNGPSAP 730 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPP 787 PP PP P P PPPPPP Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPPPHAPPPPPP 1956 >01_06_1321 + 36280691-36281269 Length = 192 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 146 SPPPPPPPPP 155 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXK 827 PPPPPP P P K Sbjct: 151 PPPPPPLPPAMYVPCFAAK 169 >11_06_0081 + 19886848-19888050,19888243-19888896 Length = 618 Score = 24.6 bits (51), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 261 SPPPPPPPPP 270 Score = 24.2 bits (50), Expect(2) = 1.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 262 PPPPPPPPPAAPAP 275 >02_03_0279 + 17250347-17252098 Length = 583 Score = 24.6 bits (51), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 123 SPPPPPPPPP 132 Score = 24.2 bits (50), Expect(2) = 1.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 128 PPPPPPPPPLFAKP 141 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 24.6 bits (51), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 144 SPPPPPPPPP 153 Score = 24.2 bits (50), Expect(2) = 1.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 145 PPPPPPPPPPQAPP 158 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPP Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPP 353 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 324 PSNPPPAPPPPPPPPSRFNNTTPKPPPPPPP 354 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P P PPPPP Sbjct: 65 PPPLPPLQPTPPPLPPTTLSCSSHPTPPPPP 95 >04_04_0057 + 22410167-22411330 Length = 387 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 184 PPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXKK 830 PPPPPP P P P KK Sbjct: 363 PPPPPPPPPRPPPPPPPIKK 382 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 24.6 bits (51), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 116 SPPPPPPPPP 125 Score = 24.2 bits (50), Expect(2) = 2.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 121 PPPPPPPPTTTTKP 134 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 24.6 bits (51), Expect(2) = 2.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 44 SGPPPPPPPP 53 Score = 24.2 bits (50), Expect(2) = 2.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 48 PPPPPPPPRAAAAP 61 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 31 PHPPPPPPLEPAPPSTPQLRGEASPPPPPPP 61 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 33 PPPPPPLEPAP-PSTPQLRGEASPPPPPPPP 62 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPP 46 >01_01_0046 - 331758-332627 Length = 289 Score = 24.6 bits (51), Expect(2) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 20 SPPPPPPPPP 29 Score = 23.4 bits (48), Expect(2) = 3.3 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXKK 830 PPPPPP P P + Sbjct: 27 PPPPPPSSSRYRPPSPPSSR 46 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PP PPPP Sbjct: 1182 PPPPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 698 PPXXPPXXXXPXP--XXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 1161 PPSPPPATPPPPPPLSPSLP----PPPPPPP 1187 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 26.6 bits (56), Expect(2) = 4.2 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXPXKKT 833 PPPPPP P P P ++ Sbjct: 52 PPPPPPPPTQPAPPPPPPARS 72 Score = 21.0 bits (42), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 765 SXPPPPPPXP 794 S P PPPP P Sbjct: 48 SPPRPPPPPP 57 >10_08_0026 - 14253680-14253894,14253981-14254109,14254704-14254769, 14254887-14255133 Length = 218 Score = 24.6 bits (51), Expect(2) = 4.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 164 SPPPPPPPSP 173 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P Sbjct: 165 PPPPPPPSPSSSSPATP 181 >12_02_0687 + 22123216-22123760,22125021-22125330 Length = 284 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -3 Query: 831 FFXGXXXXXXXXXXGGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 FF GGGGGGG G G GG GG Sbjct: 16 FFLASSFAADVVVAGGGGGGGGYDGGGDGEGGGGGDGEGGGGGGG 60 >12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561, 9769918-9769980,9770547-9771325 Length = 665 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 18 PPIRPRPPPVRPYASSAASPPPPPPPP 44 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGP---PPPPPPP 948 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPPP 110 >07_01_0080 + 587674-588510 Length = 278 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPP 117 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPPXXXXXXXXXXPXKN 832 PP PP P P PPPPPPP P N Sbjct: 94 PPPPPPSSGSPPPPPPPPP-----PPPPPPPPPLFTRRSHAPQDN 133 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPPXXXXXXXXXXPXK 829 PP PP P P PPPPPPP P K Sbjct: 344 PPPPPPAKGPPPPPPPKGPS----PPPPPPPGGKKGGPPPPPPK 383 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXX--PPPPPPP 790 PP PP P P PPPPPPP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 270 PPIPPPP---PMPALSVCGRAAAPPPPPPPP 297 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 831 FFXGXXXXXXXXXXGGGGGGGXXXXXXXXXXXGXGXXXXGGXXG 700 FF G GGGGGGG G G GG G Sbjct: 41 FFVGGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGG 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 54 GGGGGGGGYGGGGVGGGYGGGGGGYGGGGGG 84 >12_01_0841 - 7873458-7874225 Length = 255 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 72 GGGGGGGGGQGGGSGSGYGSGYGQGGGASGG 102 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 187 GGGGGGGGGGQGGGAHARGYGQGGGGGGGGG 217 >12_01_0838 - 7830944-7831444 Length = 166 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 116 GGGGGGGGGSGQGSGSGYGYGYGKGGGGGGG 146 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 118 GGGGGGGSGQGSGSGYGYGYGKGGGGGGGGG 148 >10_08_0218 - 15967064-15967906 Length = 280 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 37 GGGGGGGSEDGSGWGSGSGSGYGQAGGSSGG 67 >07_03_1751 - 29215074-29216270 Length = 398 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 302 GGGGGGGGGAGAGGGFGGGKGGGFGGGFGGG 332 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 278 GGGGGGGALENAREDGAEGGGGGGGGGGGGG 308 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 374 GGGGGGGGMLDKPDEAGGGGGGGSGGGGGGG 404 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 375 GGGGGGGMLDKPDEAGGGGGGGSGGGGGGGG 405 >07_03_0560 + 19479597-19480667 Length = 356 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 209 GGGGGGGFGGGGGKGGGFGAGGGMGGGAGGG 239 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 243 GGGGGGGMGGGGGGGMGGGAGGGFGGGAGGG 273 >07_03_0558 + 19461369-19462448 Length = 359 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 138 GGGGGGGLGGGGGHGGGFGAGGGVGGGAGGG 168 >07_03_0177 - 14770777-14772045 Length = 422 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 69 GGGGGGGGGGFGGGGGFGGGGGGGLGGGGGG 99 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 70 GGGGGGGGGFGGGGGFGGGGGGGLGGGGGGG 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 86 GGGGGGGLGGGGGGGLGGGGGFGKGGGVGGG 116 >06_03_1506 + 30641428-30642168 Length = 246 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 180 GGGGGGGGASGYRYGAGYGKGYGYGGGPGGG 210 >06_03_0790 - 24636805-24637770 Length = 321 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 549 GGGGGGGYSGGGGGGGYSGGGGGYSGGGRGG 579 >06_01_0178 + 1386981-1387505 Length = 174 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 47 GGGGGGGAGGKGGKGGAGGHGGAGGGGGGGG 77 >05_04_0303 - 20010761-20011756 Length = 331 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 45 GGGGGGGVGGGVVGGDGVGGGGGGGGGGGGG 75 >04_04_1413 - 33386049-33386339 Length = 96 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 64 GGGGGGGGGGCGGGGGGGGGGGCGGGGGSGG 94 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 65 GGGGGGGGGCGGGGGGGGGGGCGGGGGSGGG 95 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGG 70 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGG 73 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGGGSGGGCGGG 74 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 54 GGGGGGGGGGGGGSGGGCGGGGGGGGGSSGG 84 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 149 GGGGGGGGGGGDVGGDGGGGGDGNVGGGGGG 179 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 151 GGGGGGGGGDVGGDGGGGGDGNVGGGGGGGG 181 >03_01_0023 + 198414-198968 Length = 184 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 41 GGGGGGGGGGGRGGGGGSGGGSGGGGGSGGG 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGG 75 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 66 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 67 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 70 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 73 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 77 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 57 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 >02_01_0158 - 1103461-1104186 Length = 241 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 83 GGGGGGGGGFGSRGGGGSGGGGRSYGGSWGG 113 >01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664, 8761749-8761847,8761884-8761991,8762078-8762200, 8763030-8763287 Length = 372 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 3 GGGGGGGGGGVMAGPGVAGGGGGGGGGGVGG 33 >01_01_0570 - 4231100-4232560 Length = 486 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 115 GGGGGGGVGGGVGAGFGSGGGVGAGGGLRGG 145 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 24.2 bits (50), Expect(2) = 8.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 128 PPPPPPPPARTPMP 141 Score = 22.2 bits (45), Expect(2) = 8.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 765 SXPPPPPP 788 S PPPPPP Sbjct: 127 SPPPPPPP 134 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 23.8 bits (49), Expect(2) = 9.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 770 PPPPPPP 790 PPPPPPP Sbjct: 229 PPPPPPP 235 Score = 22.6 bits (46), Expect(2) = 9.3 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPP 787 PP P P P PPPP Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPPPP 196 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,296,624 Number of Sequences: 37544 Number of extensions: 320770 Number of successful extensions: 15806 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 3260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9743 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -