BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J06 (836 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 6e-15 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 33 0.22 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 30 0.50 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.58 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.5 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 25 1.8 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 30 2.0 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 30 2.0 SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) 30 2.7 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 29 4.7 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 7.1 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 8.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 28 8.2 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 28 8.2 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.2 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 28 8.2 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 78.6 bits (185), Expect = 6e-15 Identities = 45/82 (54%), Positives = 56/82 (68%) Frame = +3 Query: 240 WVPVTKLGRLVREGKIDKLESIYLFSLPIKEFEIIDFFLGSSLX**RXLKNHALXXKKXX 419 WVPVTKLGRLV++ KI LE IYLFSLPIKEFEIIDFFLG++L LK + K+ Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALK-DEVLKIMPV-QKQTR 65 Query: 420 XGKGQRFQGXFLPLGXXXGXIG 485 G+ RF+ F+ +G G +G Sbjct: 66 AGQRTRFKA-FVAIGDSNGHVG 86 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 701 PXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 701 PXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PP PPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P P PPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P PPPPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 P PP P P PPPPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPP PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPP PPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 26.2 bits (55), Expect(2) = 0.50 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P P Sbjct: 713 PPPPPPPPGCAGLPPPP 729 Score = 24.6 bits (51), Expect(2) = 0.50 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 692 SVPPPPPPPP 701 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.2 bits (55), Expect(2) = 0.58 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 771 PPPPPPXPXXXXXPXXP 821 PPPPPP P P P Sbjct: 85 PPPPPPLPAPPPPPAQP 101 Score = 24.6 bits (51), Expect(2) = 0.58 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 48 SSPPPPPPSP 57 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPP 787 PP PP P P PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 817 SPPPPPPPPP 826 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 818 PPPPPPPPPPPEEP 831 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 710 PPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P PPPPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 765 SXPPPPPPXP 794 S PPPPPP P Sbjct: 1172 SPPPPPPPPP 1181 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 771 PPPPPPXPXXXXXP 812 PPPPPP P P Sbjct: 1173 PPPPPPPPPPPPTP 1186 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPP 322 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 698 PPXXPP--XXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPP PP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP P P P PPPPPPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 >SB_45835| Best HMM Match : TLD (HMM E-Value=0.4) Length = 174 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +1 Query: 235 KSGFLSPNSAVLFAKEKSTNSRAFTCFLYQSKNSRSLISSSARPXNDE 378 KSG L ++F E +S+AF C LY +KN SL R D+ Sbjct: 56 KSGRLGGMPNIVFNSEYQWSSKAFLCTLY-NKNGYSLAKLPQRGITDQ 102 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 301 PPPPPPTDFAPPP--PPPEPTSELPPPPPPP 329 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 23.8 bits (49), Expect(2) = 7.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 770 PPPPPPP 790 PPPPPPP Sbjct: 315 PPPPPPP 321 Score = 23.0 bits (47), Expect(2) = 7.1 Identities = 10/30 (33%), Positives = 10/30 (33%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPP 787 PP PP P PPPP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLP 309 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPP--PP 790 PP PP P P PPPPP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNG----PPPPPPP 400 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 698 PPXXPPXXXXPXPXXXXXXXXXXXPPPPPPP 790 PP PP P P PPPPPPP Sbjct: 384 PPPPPPPTNGPPP----PPPPTNGPPPPPPP 410 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 789 GGGGGGGXXXXXXXXXXXGXGXXXXGGXXGG 697 GGGGGGG G G GG GG Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,412,934 Number of Sequences: 59808 Number of extensions: 244181 Number of successful extensions: 3309 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1949 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2359470773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -