BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J04 (853 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC129990-1|AAI29991.1| 695|Homo sapiens nuclear fragile X menta... 34 0.75 BC129989-1|AAI29990.1| 120|Homo sapiens NUFIP2 protein protein. 34 0.75 BC108307-1|AAI08308.1| 695|Homo sapiens nuclear fragile X menta... 34 0.75 AY232289-1|AAP69984.1| 695|Homo sapiens proliferation-inducing ... 34 0.75 AJ493465-1|CAD38278.1| 695|Homo sapiens FMRP interacting protei... 34 0.75 AB037742-1|BAA92559.1| 714|Homo sapiens KIAA1321 protein protein. 34 0.75 Y08266-1|CAA69592.1| 191|Homo sapiens DAN15 protein. 33 1.3 AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod... 33 1.3 AK096940-1|BAC04906.1| 226|Homo sapiens protein ( Homo sapiens ... 32 2.3 AK127601-1|BAC87052.1| 415|Homo sapiens protein ( Homo sapiens ... 31 4.0 L05913-1|AAC37526.1| 475|Homo sapiens cAMP responsive element b... 31 7.0 L05912-1|AAC37527.1| 369|Homo sapiens cAMP responsive element b... 31 7.0 L05911-1|AAC37525.1| 501|Homo sapiens cAMP responsive element b... 31 7.0 L05515-1|AAA52072.1| 508|Homo sapiens cAMP response element-bin... 31 7.0 D82060-1|BAA11528.1| 429|Homo sapiens membrane protein with his... 31 7.0 BC112223-1|AAI12224.1| 831|Homo sapiens solute carrier family 3... 31 7.0 BC101516-1|AAI01517.1| 831|Homo sapiens solute carrier family 3... 31 7.0 BC059400-1|AAH59400.2| 369|Homo sapiens cAMP responsive element... 31 7.0 BC000645-1|AAH00645.1| 469|Homo sapiens solute carrier family 3... 31 7.0 AL844527-11|CAI41839.1| 469|Homo sapiens solute carrier family ... 31 7.0 AL662824-23|CAI17615.1| 469|Homo sapiens solute carrier family ... 31 7.0 AL645940-9|CAI18067.1| 469|Homo sapiens solute carrier family 3... 31 7.0 AL031228-11|CAA20238.1| 469|Homo sapiens solute carrier family ... 31 7.0 AF117221-1|AAD12305.1| 429|Homo sapiens KE4 protein protein. 31 7.0 AB209262-1|BAD92499.1| 368|Homo sapiens cAMP responsive element... 31 7.0 AB033091-1|BAA86579.1| 835|Homo sapiens KIAA1265 protein protein. 31 7.0 BC033649-1|AAH33649.1| 274|Homo sapiens PRR7 protein protein. 30 9.3 BC024233-1|AAH24233.2| 274|Homo sapiens proline rich 7 (synapti... 30 9.3 BC021240-1|AAH21240.1| 274|Homo sapiens PRR7 protein protein. 30 9.3 >BC129990-1|AAI29991.1| 695|Homo sapiens nuclear fragile X mental retardation protein interacting protein 2 protein. Length = 695 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 11 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 47 >BC129989-1|AAI29990.1| 120|Homo sapiens NUFIP2 protein protein. Length = 120 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 11 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 47 >BC108307-1|AAI08308.1| 695|Homo sapiens nuclear fragile X mental retardation protein interacting protein 2 protein. Length = 695 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 11 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 47 >AY232289-1|AAP69984.1| 695|Homo sapiens proliferation-inducing gene 1 protein. Length = 695 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 11 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 47 >AJ493465-1|CAD38278.1| 695|Homo sapiens FMRP interacting protein, 82kD protein. Length = 695 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 11 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 47 >AB037742-1|BAA92559.1| 714|Homo sapiens KIAA1321 protein protein. Length = 714 Score = 33.9 bits (74), Expect = 0.75 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 389 QRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 Q H H H H H Q Q P H H +F+ H H + Sbjct: 30 QHHHSHHHPH-HHPQQQQQQPHHHHHYYFYNHSHNHHH 66 >Y08266-1|CAA69592.1| 191|Homo sapiens DAN15 protein. Length = 191 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQ 279 P Q+H H H H H HL H H L +++FQ Q Sbjct: 72 PHQQHHHHHHAHHHHHHAHHL--HHHHALQQQLNQFQQQ 108 >AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remodeling complex subunit OSA2 protein. Length = 2165 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQ 279 P Q+H H H H H HL H H L +++FQ Q Sbjct: 9 PHQQHHHHHHAHHHHHHAHHL--HHHHALQQQLNQFQQQ 45 >AK096940-1|BAC04906.1| 226|Homo sapiens protein ( Homo sapiens cDNA FLJ39621 fis, clone SMINT2001158. ). Length = 226 Score = 32.3 bits (70), Expect = 2.3 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 5/46 (10%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPV----HRHRL-HFHVHEFQHQYL 273 P+ +H H H H H H + V H H L H H H F H ++ Sbjct: 46 PLTLTHIHTHPHTHISTHTHPLTVTHITHTHLLTHIHSHSFTHAHM 91 >AK127601-1|BAC87052.1| 415|Homo sapiens protein ( Homo sapiens cDNA FLJ45698 fis, clone FEBRA2017811. ). Length = 415 Score = 31.5 bits (68), Expect = 4.0 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H+H H H H H H H++ + H Y Sbjct: 296 HIHMHMHTHTHTHTY-THAHA-HIHINTYMHTY 326 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -3 Query: 395 PVQRHRLHF--HGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 P+ H +H H H H + H H + V H +H H+H + H + Sbjct: 228 PIHSH-IHTWTHTHAHTYTHAH-IHVCTH-IHMHIHTYTHMH 266 Score = 30.7 bits (66), Expect = 7.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 377 LHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 +H H H++ H H + +H H H H H + H + Sbjct: 283 MHSHAHINTHTHAH-IHMHMH-THTHTHTYTHAH 314 Score = 30.3 bits (65), Expect = 9.3 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRH-RLHFHVHEFQHQY 276 H H H+H + H H H H +H H+H H + Sbjct: 100 HIHTHMHTYTHAH---THAHIHIHVHIHMNIHTH 130 >L05913-1|AAC37526.1| 475|Homo sapiens cAMP responsive element binding protein protein. Length = 475 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 238 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 269 >L05912-1|AAC37527.1| 369|Homo sapiens cAMP responsive element binding protein protein. Length = 369 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 132 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 163 >L05911-1|AAC37525.1| 501|Homo sapiens cAMP responsive element binding protein protein. Length = 501 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 264 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 295 >L05515-1|AAA52072.1| 508|Homo sapiens cAMP response element-binding protein protein. Length = 508 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 271 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 302 >D82060-1|BAA11528.1| 429|Homo sapiens membrane protein with histidine rich charge clusters protein. Length = 429 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >BC112223-1|AAI12224.1| 831|Homo sapiens solute carrier family 39 (zinc transporter), member 10 protein. Length = 831 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -3 Query: 398 VPVQRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYLVLVQR 258 V V+ H H H H +H H +H H H + H F + + +R Sbjct: 162 VSVKSDDKHMHDHNHRLRHHH--RLHHHLDHNNTHHFHNDSITPSER 206 >BC101516-1|AAI01517.1| 831|Homo sapiens solute carrier family 39 (zinc transporter), member 10 protein. Length = 831 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -3 Query: 398 VPVQRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYLVLVQR 258 V V+ H H H H +H H +H H H + H F + + +R Sbjct: 162 VSVKSDDKHMHDHNHRLRHHH--RLHHHLDHNNTHHFHNDSITPSER 206 >BC059400-1|AAH59400.2| 369|Homo sapiens cAMP responsive element binding protein 5 protein. Length = 369 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 132 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 163 >BC000645-1|AAH00645.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AL844527-11|CAI41839.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AL662824-23|CAI17615.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AL645940-9|CAI18067.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AL031228-11|CAA20238.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AF117221-1|AAD12305.1| 429|Homo sapiens KE4 protein protein. Length = 429 Score = 30.7 bits (66), Expect = 7.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -3 Query: 383 HRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYL 273 H +HGH H+ H H H H H H + H+ L Sbjct: 68 HESIWHGHTHDHDHGH---SHEDLHHGHSHGYSHESL 101 >AB209262-1|BAD92499.1| 368|Homo sapiens cAMP responsive element binding protein 5 isoform beta variant protein. Length = 368 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 Query: 374 HFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQY 276 H H H H QHQ L P H + H H H H + Sbjct: 131 HHHMHSHPHQHQTLPPHHPYP-HQHQHPAHHPH 162 >AB033091-1|BAA86579.1| 835|Homo sapiens KIAA1265 protein protein. Length = 835 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -3 Query: 398 VPVQRHRLHFHGHVHEFQHQHLVPVHRHRLHFHVHEFQHQYLVLVQR 258 V V+ H H H H +H H +H H H + H F + + +R Sbjct: 166 VSVKSDDKHMHDHNHRLRHHH--RLHHHLDHNNTHHFHNDSITPSER 210 >BC033649-1|AAH33649.1| 274|Homo sapiens PRR7 protein protein. Length = 274 Score = 30.3 bits (65), Expect = 9.3 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPVHRH---RLHFHVHEFQHQY 276 P R RL H H H H+ P+ H + H H H H + Sbjct: 78 PPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH 120 >BC024233-1|AAH24233.2| 274|Homo sapiens proline rich 7 (synaptic) protein. Length = 274 Score = 30.3 bits (65), Expect = 9.3 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPVHRH---RLHFHVHEFQHQY 276 P R RL H H H H+ P+ H + H H H H + Sbjct: 78 PPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH 120 >BC021240-1|AAH21240.1| 274|Homo sapiens PRR7 protein protein. Length = 274 Score = 30.3 bits (65), Expect = 9.3 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -3 Query: 395 PVQRHRLHFHGHVHEFQHQHLVPVHRH---RLHFHVHEFQHQY 276 P R RL H H H H+ P+ H + H H H H + Sbjct: 78 PPHRSRLEAPAHAHSHPHVHVHPLLHHGPAQPHAHAHPHPHHH 120 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,218,378 Number of Sequences: 237096 Number of extensions: 461586 Number of successful extensions: 1764 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1509 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10816958492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -