BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_J03 (825 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0727 + 19765175-19765384,19765523-19765595,19766476-197665... 32 0.64 07_03_0481 - 18572206-18574314,18574591-18575185,18575304-185753... 31 0.84 01_05_0560 - 23288078-23288370,23288448-23288733 30 2.6 12_01_0934 - 9273325-9273807,9273898-9274062,9274155-9274235,927... 29 3.4 04_04_0766 - 27923120-27923554,27923843-27924580,27924815-279248... 29 4.5 01_01_0206 - 1770622-1771347 29 4.5 >09_04_0727 + 19765175-19765384,19765523-19765595,19766476-19766570, 19766666-19768450,19768533-19768721,19768816-19768958, 19769075-19769320,19769975-19770059,19770117-19770191, 19770304-19770369,19770466-19770712,19770824-19771242 Length = 1210 Score = 31.9 bits (69), Expect = 0.64 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +1 Query: 472 VPTLPPFNPKPIYIDMGNRYRRHASDD-QEELRQYNEHFL-ISEGY 603 +P LP NP+P+ D G ASDD E+L F+ ++ GY Sbjct: 1119 LPELPELNPEPMVTDNGENAAMPASDDIPEQLEVVKRRFMELTTGY 1164 >07_03_0481 - 18572206-18574314,18574591-18575185,18575304-18575371, 18577344-18577458,18578179-18578333,18578673-18580621, 18580691-18581372,18581550-18581621,18582558-18583199, 18583301-18583402,18585011-18585100 Length = 2192 Score = 31.5 bits (68), Expect = 0.84 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 247 PRAPSTADHPILPSKIDDVQLDPNRRYVRSVTNPENNEASIEHSHHT 387 P P T H I S +DD+ R VR +P+N ++ + S +T Sbjct: 2064 PEPPETGTHRIEFSAVDDMDTGSCRSPVRDTPDPDNQKSELSGSGNT 2110 >01_05_0560 - 23288078-23288370,23288448-23288733 Length = 192 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 244 VPRAPSTADHPILPSKIDDVQLDPNRRYVRS 336 +PR P A H +L S DDV DP+ RYV S Sbjct: 120 LPR-PLRAGHYVLSSPPDDVDHDPDHRYVFS 149 >12_01_0934 - 9273325-9273807,9273898-9274062,9274155-9274235, 9274347-9274475,9274590-9274661,9274758-9274826, 9275143-9275514,9275590-9275703,9275729-9275848 Length = 534 Score = 29.5 bits (63), Expect = 3.4 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +1 Query: 457 RGKLPVPTLPPFNPKPIYIDMG--NRYRRHASDDQEELRQYNEHFLISEGYFPKNRESSR 630 R KLP T P P P+ G N+ R+H +E + + + +L P R SS Sbjct: 424 RNKLPSTTTSPMKPLPVETKRGPLNQERKHIMTGKEIVPVFTKSWLSGS---PTARLSSP 480 Query: 631 NKRF 642 +RF Sbjct: 481 RRRF 484 >04_04_0766 - 27923120-27923554,27923843-27924580,27924815-27924874, 27925281-27925328 Length = 426 Score = 29.1 bits (62), Expect = 4.5 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +3 Query: 156 LQATANTAPDNTYSATSWPGTAMAVSR*QCSSCAKYCRPSDSSFENRRRAARS 314 L T++ APD +A + + V+ SS CRPS SSF +R A S Sbjct: 154 LVPTSSPAPDQAPAAEATDVDDVVVAALDSSSIDGSCRPSPSSFVAWKRTADS 206 >01_01_0206 - 1770622-1771347 Length = 241 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 448 LYPRGKL-PVPTLPPFNPKP 504 L+ GKL PVP LPP +PKP Sbjct: 68 LFAGGKLLPVPPLPPVHPKP 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,072,917 Number of Sequences: 37544 Number of extensions: 476074 Number of successful extensions: 1416 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1416 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2268190812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -