BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I23 (922 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_46036| Best HMM Match : PSRT (HMM E-Value=1) 29 4.0 SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) 29 5.3 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 29 5.3 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 9.2 SB_19124| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/63 (36%), Positives = 28/63 (44%) Frame = -1 Query: 379 RCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPH 200 R R+ SR R +R P R +R P P S R RS +PR R+ SR RR Sbjct: 223 RSRSRSRSPRRRRRSRSPRRRRRSRSPSPHHRSHRSRSRSRSPRRRHSRSRSPTHRRHRS 282 Query: 199 HFH 191 H Sbjct: 283 RSH 285 >SB_39786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 294 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = -1 Query: 364 SRDIRTTTEARRPGTARNTRRPKPTELSACCR----ERSETPRHRNKPSRPVWSRRSPHH 197 +RD R T R P ++ R P+P++ R +R P + + RP +R P H Sbjct: 191 NRDTRDTINNRHPRPSQQQRHPRPSQQQRHPRPSQQQRYPRPSQQQRQPRPSQQQRYPRH 250 >SB_23556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +1 Query: 166 SSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFSLCLGAGPL 342 ++ +S+Y ++++ + ++++Y + P S +A SD FSLC+ GPL Sbjct: 137 NTRLSEYLESRDCEAMDVR-LQRLYEHELVMYRLPESSATATPLSDLFDFSLCMCYGPL 194 >SB_46036| Best HMM Match : PSRT (HMM E-Value=1) Length = 878 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -1 Query: 352 RTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRN-KPSR 227 R+ T R+ T+ N R P P S R S +PR R+ PSR Sbjct: 543 RSYTSPRQRRTSPNNRSPPPRRRSPSPRRPSPSPRRRSTSPSR 585 >SB_43189| Best HMM Match : PGAMP (HMM E-Value=2.1) Length = 461 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = -1 Query: 370 AVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSPH 200 A+ + T RP + R R P S R +T PSRP + R PH Sbjct: 4 ALHNTLTRTRVPSRPCSLRTVRHPHTGTKSTMAYARDDTLTRTRVPSRPSRTVRHPH 60 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 397 GVTXSGRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETP 251 G + S RC+ ++ ++ ++PG+A +PK + S R+RS +P Sbjct: 1888 GFSQSRRCKTTAKALKKAKGKQKPGSATKKTKPK-QDSSKKKRKRSPSP 1935 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = -3 Query: 395 GHPFRAVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLLPGALRDAPSP 243 G P R G D H GP RH H +RL P RD P Sbjct: 132 GPPDRHTPPDRNGPPDRH-GPPDRHGMDHGRGRGRGRDRLSPPPHRDRGRP 181 >SB_19124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = -1 Query: 364 SRDIRTTTEARRPGTARNTRRPKPTELSACCRERSETPRHRNKPSRPVWSRRSP 203 +RD R T R P ++ R P+P++ ++R P + + RP +R P Sbjct: 151 NRDTRDTINNRHPRPSQQQRYPRPSQ-----QQRYPRPSQQQRHPRPSQQQRHP 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,563,508 Number of Sequences: 59808 Number of extensions: 244943 Number of successful extensions: 821 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2669453024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -