BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I23 (922 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 23 9.8 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 9.8 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 23.4 bits (48), Expect = 9.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 80 KPLGRSGNCVAHQILRIPYSEW 15 K G SGNC+A I+ + E+ Sbjct: 72 KTTGNSGNCIACAIIGVAREEY 93 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 9.8 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -3 Query: 374 QSREQGHQDHHRGPAPRHSEKHSASEADRAERLLP 270 Q ++Q H HH + K++ + +ER+LP Sbjct: 779 QQQQQQHHHHHLQQQQQIVGKNTLYSRNSSERMLP 813 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,096 Number of Sequences: 2352 Number of extensions: 7635 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100055142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -