BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_I19 (838 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q16NQ5 Cluster: 1-acyl-sn-glycerol-3-phosphate acyltran... 35 2.9 UniRef50_UPI0000E49F56 Cluster: PREDICTED: similar to annexin A6... 33 8.9 >UniRef50_Q16NQ5 Cluster: 1-acyl-sn-glycerol-3-phosphate acyltransferase; n=6; Culicidae|Rep: 1-acyl-sn-glycerol-3-phosphate acyltransferase - Aedes aegypti (Yellowfever mosquito) Length = 273 Score = 34.7 bits (76), Expect = 2.9 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 92 KNEILHDFPSSL-CWLWPTLKTPXKVVENADSVVINDPESI 211 K E+L+ FP L CWLW TL K +A S + N+ ++I Sbjct: 121 KREVLYMFPFGLACWLWGTLFINRKNQRSAKSAINNESKAI 161 >UniRef50_UPI0000E49F56 Cluster: PREDICTED: similar to annexin A6; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to annexin A6 - Strongylocentrotus purpuratus Length = 302 Score = 33.1 bits (72), Expect = 8.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 280 PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 387 P Y P G GY P G Y PP G + P P P Sbjct: 38 PAGYPPQGGGYPPAAGGGY--PPPAGAGGYPPAPAP 71 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,121,812 Number of Sequences: 1657284 Number of extensions: 13641006 Number of successful extensions: 27688 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27623 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 72963732758 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -